F353399

General Info

Members Datasets Scaffolds Average Seq Length
241 201 201 127

Family's Representative Sequence

Representative Sequence 3300002739|JGI25158J39367_1000824|JGI25158J39367_10008245
Length 131
Sequence MMKLLLDTHLLLLAAGEPGKLPPAVLAEIENTDNVLLFSAVSLWEVAIKRGLGRADFTVDPRLLRRGLIDNGYQELPITSEHAVAVDGLPAIHRDPFDRILVAQSIVEGVTLLTVDELVGRYPAPIRCMQK

Samples

Sample ID Description Type Environment
1 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
2 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
3 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
4 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
5 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
6 2643221607 Rhizobium sp. Root73 Isolate Unclassified
7 2643221618 Ensifer sp. Root231 Isolate Unclassified
8 2643221626 Ensifer sp. Root31 Isolate Unclassified
9 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
10 2643221655 Ensifer sp. Root1252 Isolate Unclassified
11 2643221659 Ensifer sp. Root127 Isolate Unclassified
12 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
13 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
14 2643221698 Ensifer sp. Root142 Isolate Unclassified
15 2643221712 Ensifer sp. Root258 Isolate Unclassified
16 2643221723 Ensifer sp. Root278 Isolate Unclassified
17 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
18 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
19 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
20 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
21 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
22 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
23 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
24 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
25 2857558681 Duganella sp. R-74565 Isolate Unclassified
26 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
27 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
28 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
29 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
30 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
31 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
32 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
33 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
37 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
38 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
39 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
40 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
130 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
131 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
189 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
190 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
192 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
193 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
194 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
197 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
198 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
199 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
200 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
201 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.65
Metatranscriptomes 0
Isolates 15.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.52
Nodule 7.05
Rhizoplane 1.66
Rhizosphere 63.07
Stem 0
Stem Tuber 0
Unclassified 13.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000824 3300002739 Bacteria 5918
2 JGI25159J45721_1000049 3300002987 Bacteria 58138
3 rootH2_10025785 3300003320 Bacteria 5727
4 rootH1_10001713 3300003323 Bacteria 3802
5 JGI25160J50197_1000147 3300003354 Bacteria 62036
6 JGI25161J50226_1001246 3300003374 Bacteria 8220
7 Ga0055526_1000816 3300003771 Bacteria 23236
8 Ga0055524_1011876 3300003775 Bacteria 3374
9 Ga0055536_1025410 3300003781 Bacteria 1688
10 Ga0055536_1038660 3300003781 Bacteria 1154
11 Ga0055530_10044646 3300003791 Bacteria 1061
12 Ga0055531_10039941 3300003794 Bacteria 1384
13 Ga0055543_1000129 3300004625 Bacteria 62841
14 Ga0065165_1000477 3300005262 Bacteria 62229
15 Ga0070677_10064788 3300005333 Unclassified 1519
16 Ga0070680_100009116 3300005336 Bacteria 7611
17 Ga0070688_100104228 3300005365 Bacteria 1875
18 Ga0070659_100330382 3300005366 Bacteria 1276
19 Ga0070659_102153867 3300005366 Bacteria 501
20 Ga0070709_10007468 3300005434 Bacteria 5993
21 Ga0070714_100602408 3300005435 Bacteria 1055
22 Ga0070713_100002892 3300005436 Bacteria 11231
23 Ga0070713_100050442 3300005436 Bacteria 3438
24 Ga0070710_10018195 3300005437 Bacteria 3611
25 Ga0070711_100301352 3300005439 Bacteria 1274
26 Ga0070708_100490693 3300005445 Unclassified 1159
27 Ga0070681_10099997 3300005458 Bacteria 2846
28 Ga0070706_100091901 3300005467 Unclassified 2815
29 Ga0070707_100437906 3300005468 Bacteria 1268
30 Ga0070679_100010552 3300005530 Bacteria 8764
31 Ga0070697_101622433 3300005536 Bacteria 578
32 Ga0068853_100009294 3300005539 Bacteria 7929
33 Ga0068853_100186215 3300005539 Bacteria 1885
34 Ga0070665_100156932 3300005548 Bacteria 2277
35 Ga0070665_100944067 3300005548 Bacteria 875
36 Ga0068855_100621879 3300005563 Bacteria 1163
37 Ga0068855_100868330 3300005563 Bacteria 955
38 Ga0068857_100287962 3300005577 Bacteria 1512
39 Ga0068854_100656179 3300005578 Bacteria 901
40 Ga0068856_100817160 3300005614 Bacteria 952
41 Ga0068852_100131682 3300005616 Bacteria 2304
42 Ga0068852_101055192 3300005616 Bacteria 832
43 Ga0068863_100000445 3300005841 Bacteria 41968
44 Ga0070717_10131842 3300006028 Unclassified 2150
45 Ga0070715_10000543 3300006163 Bacteria 9914
46 Ga0070716_100005619 3300006173 Bacteria 6088
47 Ga0070712_100006688 3300006175 Bacteria 7166
48 Ga0075367_10084726 3300006178 Bacteria 1922
49 Ga0105248_10274159 3300009177 Bacteria 1899
50 Ga0105237_10003459 3300009545 Bacteria 18738
51 Ga0105237_10136602 3300009545 Bacteria 2446
52 Ga0105237_10875047 3300009545 Unclassified 905
53 Ga0105238_10345442 3300009551 Bacteria 1476
54 Ga0099796_10491278 3300010159 Bacteria 549
55 Ga0105239_10002416 3300010375 Bacteria 23787
56 Ga0105239_10469690 3300010375 Bacteria 1428
57 Ga0105239_10757711 3300010375 Bacteria 1111
58 Ga0157370_10289133 3300013104 Bacteria 1514
59 Ga0157370_10355288 3300013104 Bacteria 1350
60 Ga0157369_10181273 3300013105 Bacteria 2216
61 Ga0157369_10200658 3300013105 Bacteria 2094
62 Ga0157369_10210361 3300013105 Bacteria 2039
63 Ga0157372_10215633 3300013307 Bacteria 2225
64 Ga0157372_10575135 3300013307 Bacteria 1313
65 Ga0157376_10277178 3300014969 Unclassified 1578
66 Ga0157376_10582560 3300014969 Unclassified 1111
67 Ga0157376_11032928 3300014969 Bacteria 845
68 Ga0209436_100992 3300025208 Bacteria 10937
69 Ga0209130_1000234 3300025284 Bacteria 71914
70 Ga0209676_1001505 3300025292 Bacteria 21274
71 Ga0209025_1000337 3300025294 Bacteria 103480
72 Ga0209564_1000117 3300025295 Bacteria 207096
73 Ga0209758_1032527 3300025297 Bacteria 2115
74 Ga0209050_1007652 3300025298 Bacteria 5986
75 Ga0209256_1001481 3300025299 Bacteria 24008
76 Ga0207426_1000410 3300025302 Bacteria 71914
77 Ga0209051_1038757 3300025303 Bacteria 1730
78 Ga0209257_1001789 3300025304 Bacteria 23644
79 Ga0207682_10128444 3300025893 Unclassified 1130
80 Ga0207692_10006288 3300025898 Bacteria 4813
81 Ga0207647_10008096 3300025904 Bacteria 7554
82 Ga0207685_10008833 3300025905 Bacteria 2894
83 Ga0207699_10307724 3300025906 Bacteria 1108
84 Ga0207707_10071126 3300025912 Bacteria 3031
85 Ga0207695_10440024 3300025913 Bacteria 1187
86 Ga0207695_10908532 3300025913 Unclassified 760
87 Ga0207671_10000504 3300025914 Bacteria 53102
88 Ga0207693_10009069 3300025915 Bacteria 8119
89 Ga0207660_10011445 3300025917 Bacteria 5776
90 Ga0207652_10025918 3300025921 Bacteria 4878
91 Ga0207646_10905364 3300025922 Bacteria 782
92 Ga0207700_10037892 3300025928 Bacteria 3496
93 Ga0207700_10074487 3300025928 Unclassified 2626
94 Ga0207664_10009805 3300025929 Bacteria 6740
95 Ga0207664_10508880 3300025929 Bacteria 1079
96 Ga0207665_10000678 3300025939 Bacteria 22978
97 Ga0207667_11168327 3300025949 Bacteria 750
98 Ga0207640_10730600 3300025981 Bacteria 852
99 Ga0207639_10006241 3300026041 Bacteria 8098
100 Ga0207702_10230519 3300026078 Bacteria 1731
101 Ga0207641_10000249 3300026088 Bacteria 68784
102 Ga0207674_10031330 3300026116 Bacteria 5587
103 Ga0207698_10300833 3300026142 Bacteria 1493
104 Ga0209371_1013384 3300027312 Bacteria 2308
105 Ga0268266_10002704 3300028379 Bacteria 18601
106 Ga0268266_10797704 3300028379 Bacteria 912
107 Ga0307515_10019713 3300028794 Bacteria 12108
108 Ga0268256_1013603 3300030500 Bacteria 2455
109 Ga0265328_10000037 3300031239 Bacteria 93790
110 Ga0307414_10329351 3300032004 Bacteria 1303
111 Ga0316580_10096104 3300032139 Bacteria 907
112 Ga0307510_10000016 3300033180 Bacteria 206932
113 Ga0373925_0624612 3300037068 Bacteria 888
114 Ga0395898_0783402 3300037466 Bacteria 894
115 Ga0395901_1617490 3300038443 Bacteria 601
116 Ga0436360_0461448 3300039438 Unclassified 598
117 Ga0436360_0520041 3300039438 Bacteria 655
118 Ga0436361_0618783 3300039447 Bacteria 553
119 Ga0436362_0264867 3300039453 Unclassified 677
120 Ga0439438_090288 3300041405 Bacteria 747
121 Ga0439438_144127 3300041405 Bacteria 569
122 Ga0439447_162748 3300041407 Bacteria 514
123 Ga0439465_0008931 3300041413 Bacteria 3158
124 Ga0439445_0018364 3300042004 Bacteria 1735
125 Ga0439449_0352767 3300042007 Bacteria 557
126 Ga0495580_0048327 3300046472 Plasmid 3013
127 Ga0495582_0655351 3300046473 Bacteria 607
128 Ga0495584_0240656 3300046491 Bacteria 920
129 Ga0495607_0118140 3300046501 Bacteria 1396
130 Ga0495607_0143849 3300046501 Bacteria 1227
131 Ga0495607_0327119 3300046501 Bacteria 713
132 Ga0495583_0389186 3300046506 Bacteria 548
133 Ga0495606_0087379 3300046507 Bacteria 1925
134 Ga0495610_0013323 3300046512 Bacteria 4892
135 Ga0495610_0217194 3300046512 Bacteria 774
136 Ga0495620_0101292 3300046515 Bacteria 1148
137 Ga0495637_0071066 3300046520 Bacteria 1404
138 Ga0495654_0123895 3300046530 Bacteria 1167
139 Ga0495609_0069244 3300046538 Bacteria 1551
140 Ga0495597_0165901 3300046542 Bacteria 899
141 Ga0495645_0292078 3300046543 Bacteria 1068
142 Ga0495633_0158201 3300046558 Bacteria 1045
143 Ga0495668_0264893 3300046616 Bacteria 941
144 Ga0495625_0161756 3300046660 Bacteria 1499
145 Ga0495659_0140358 3300046664 Bacteria 964
146 Ga0495661_0154700 3300046665 Bacteria 1236
147 Ga0495588_0141436 3300046674 Bacteria 1271
148 Ga0495588_0270670 3300046674 Bacteria 895
149 Ga0495687_058369 3300047443 Bacteria 1600
150 Ga0495687_172867 3300047443 Bacteria 713
151 Ga0495675_0112593 3300047444 Bacteria 1698
152 Ga0495673_0148755 3300047469 Bacteria 907
153 Ga0495681_0237205 3300047470 Bacteria 725
154 Ga0495686_0314445 3300047472 Bacteria 860
155 Ga0496102_0916775 3300048905 Bacteria 798
156 Ga0496104_0549166 3300048907 Bacteria 1066
157 Ga0496112_0927497 3300048915 Bacteria 792
158 Ga0496119_0000330 3300048922 Bacteria 66230
159 Ga0496120_0013645 3300048923 Bacteria 5460
160 Ga0496120_0029887 3300048923 Bacteria 3321
161 Ga0496121_0047558 3300048924 Bacteria 3659
162 Ga0496121_0223583 3300048924 Bacteria 1324
163 Ga0496121_0446782 3300048924 Bacteria 834
164 Ga0496121_0744819 3300048924 Unclassified 583
165 Ga0496125_0007706 3300048928 Bacteria 11406
166 Ga0496125_0113454 3300048928 Bacteria 1955
167 Ga0496126_0030703 3300048929 Bacteria 5088
168 Ga0501034_0001728 3300049571 Bacteria 28110
169 Ga0501036_0020611 3300049572 Bacteria 5538
170 Ga0501037_0154307 3300049573 Bacteria 1640
171 Ga0501038_0015369 3300049574 Bacteria 6960
172 Ga0501043_0036317 3300049579 Bacteria 3876
173 Ga0501046_0324029 3300049580 Bacteria 1122
174 Ga0501047_0003513 3300049581 Bacteria 14807
175 Ga0501067_0000332 3300049583 Bacteria 25723
176 Ga0501068_0016345 3300049584 Bacteria 4276
177 Ga0501069_0006000 3300049585 Bacteria 6339
178 Ga0501070_0020548 3300049586 Bacteria 5537
179 Ga0501072_0000433 3300049588 Bacteria 30002
180 Ga0501073_0004239 3300049589 Bacteria 10756
181 Ga0501074_0014918 3300049590 Bacteria 5653
182 Ga0501198_048181 3300049649 Bacteria 754
183 Ga0501079_0033287 3300049741 Bacteria 3965
184 Ga0501079_1289020 3300049741 Unclassified 575
185 Ga0501080_0026248 3300049742 Bacteria 5412
186 Ga0501083_0010128 3300049744 Bacteria 6643
187 Ga0501035_0123346 3300049822 Bacteria 2263
188 Ga0501044_0024332 3300049823 Bacteria 6431
189 Ga0501044_0444405 3300049823 Bacteria 1204
190 nmdc:mga03683_222378_c1 3300050489 Bacteria 871
191 nmdc:mga07m45_920913_c1 3300050496 Unclassified 500
192 Ga0500610_0219448 3300053079 Bacteria 901
193 Ga0500578_0473543 3300053086 Bacteria 709
194 Ga0500643_027966 3300053087 Bacteria 1747
195 Ga0500651_0000789 3300053093 Bacteria 15474
196 Ga0500651_0080896 3300053093 Bacteria 2012
197 Ga0500556_0002193 3300053104 Bacteria 6559
198 Ga0500642_0093750 3300053130 Bacteria 1390
199 Ga0500604_0029878 3300053151 Bacteria 1591
200 Ga0500604_0100288 3300053151 Bacteria 954
201 Ga0501082_0279061 3300060353 Bacteria 1454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10025785 rootH2_100257856 105
2 3300005336 Ga0070680_100009116 Ga0070680_1000091162 109
3 3300005458 Ga0070681_10099997 Ga0070681_100999972 109
4 3300005530 Ga0070679_100010552 Ga0070679_1000105525 109
5 3300005616 Ga0068852_101055192 Ga0068852_1010551922 109
6 3300013104 Ga0157370_10289133 Ga0157370_102891332 109
7 3300013105 Ga0157369_10210361 Ga0157369_102103612 109
8 3300025912 Ga0207707_10071126 Ga0207707_100711264 109
9 3300025917 Ga0207660_10011445 Ga0207660_100114453 109
10 3300025921 Ga0207652_10025918 Ga0207652_100259185 109
11 3300026078 Ga0207702_10230519 Ga0207702_102305192 109
12 3300049823 Ga0501044_0444405 Ga0501044_0444405_25_354 109
13 3300049741 Ga0501079_1289020 Ga0501079_1289020_117_494 111
14 3300005365 Ga0070688_100104228 Ga0070688_1001042283 112
15 3300050496 nmdc:mga07m45_920913_c1 nmdc:mga07m45_920913_c1_120_482 120
16 iso_pu_bacteria 2513237144 2513910022 123
17 iso_pu_bacteria 2585427608 2585896953 124
18 iso_pu_bacteria 2757320392 2757569359 124
19 iso_pu_bacteria 2791355082 2792579882 124
20 iso_pu_bacteria 2791355092 2792627466 124
21 iso_pu_bacteria 2840764183 2840766971 124
22 iso_pu_bacteria 2857558681 2857561096 124
23 iso_pu_bacteria 2874123672 2874125426 124
24 iso_pu_bacteria 2928521798 2928526385 124
25 iso_pu_bacteria 3004334049 3004342084 124
26 iso_pu_bacteria 643692032 643823257 124
27 3300039438 Ga0436360_0461448 Ga0436360_0461448_67_444 125
28 iso_pu_bacteria 2513237093 2513634001 125
29 iso_pu_bacteria 2724679232 2725950620 125
30 iso_pu_bacteria 2765235942 2766063377 125
31 iso_pu_bacteria 2842110456 2842112535 125
32 iso_pu_bacteria 2857516855 2857521979 125
33 iso_pu_bacteria 2933586486 2933588576 125
34 iso_pu_bacteria 2936367885 2936369304 125
35 iso_pu_bacteria 2936375103 2936377348 125
36 iso_pu_bacteria 8005376324 8005377811 125
37 iso_pu_bacteria 8005556819 8005560239 125
38 iso_pu_bacteria 8005563573 8005564306 125
39 iso_pu_bacteria 8018163183 8018167382 125
40 iso_pu_bacteria 8024479707 8024479912 125
41 3300039453 Ga0436362_0264867 Ga0436362_0264867_230_610 126
42 iso_pu_bacteria 2582581866 2585392576 126
43 iso_pu_bacteria 2643221607 2644048440 126
44 iso_pu_bacteria 2643221636 2644201801 126
45 iso_pu_bacteria 2643221686 2644481242 126
46 iso_pu_bacteria 2643221689 2644500076 126
47 iso_pu_bacteria 2599185352 2600196478 127
48 iso_pu_bacteria 2643221618 2644106702 127
49 iso_pu_bacteria 2643221626 2644148053 127
50 iso_pu_bacteria 2643221655 2644310006 127
51 iso_pu_bacteria 2643221659 2644331957 127
52 iso_pu_bacteria 2643221698 2644545597 127
53 iso_pu_bacteria 2643221712 2644616224 127
54 iso_pu_bacteria 2643221723 2644671938 127
55 3300003323 rootH1_10001713 rootH1_100017136 128
56 3300005333 Ga0070677_10064788 Ga0070677_100647883 128
57 3300005366 Ga0070659_100330382 Ga0070659_1003303821 128
58 3300005366 Ga0070659_102153867 Ga0070659_1021538671 128
59 3300005434 Ga0070709_10007468 Ga0070709_100074688 128
60 3300005435 Ga0070714_100602408 Ga0070714_1006024081 128
61 3300005436 Ga0070713_100002892 Ga0070713_1000028927 128
62 3300005436 Ga0070713_100050442 Ga0070713_1000504423 128
63 3300005437 Ga0070710_10018195 Ga0070710_100181952 128
64 3300005439 Ga0070711_100301352 Ga0070711_1003013521 128
65 3300005445 Ga0070708_100490693 Ga0070708_1004906933 128
66 3300005467 Ga0070706_100091901 Ga0070706_1000919013 128
67 3300005468 Ga0070707_100437906 Ga0070707_1004379062 128
68 3300005536 Ga0070697_101622433 Ga0070697_1016224332 128
69 3300005539 Ga0068853_100009294 Ga0068853_1000092948 128
70 3300005539 Ga0068853_100186215 Ga0068853_1001862152 128
71 3300005548 Ga0070665_100156932 Ga0070665_1001569323 128
72 3300005548 Ga0070665_100944067 Ga0070665_1009440672 128
73 3300005563 Ga0068855_100621879 Ga0068855_1006218791 128
74 3300005563 Ga0068855_100868330 Ga0068855_1008683302 128
75 3300005577 Ga0068857_100287962 Ga0068857_1002879622 128
76 3300005578 Ga0068854_100656179 Ga0068854_1006561792 128
77 3300005614 Ga0068856_100817160 Ga0068856_1008171602 128
78 3300005616 Ga0068852_100131682 Ga0068852_1001316825 128
79 3300005841 Ga0068863_100000445 Ga0068863_10000044529 128
80 3300006028 Ga0070717_10131842 Ga0070717_101318422 128
81 3300006163 Ga0070715_10000543 Ga0070715_100005433 128
82 3300006173 Ga0070716_100005619 Ga0070716_1000056192 128
83 3300006175 Ga0070712_100006688 Ga0070712_1000066884 128
84 3300006178 Ga0075367_10084726 Ga0075367_100847262 128
85 3300009177 Ga0105248_10274159 Ga0105248_102741592 128
86 3300009545 Ga0105237_10003459 Ga0105237_1000345911 128
87 3300009545 Ga0105237_10136602 Ga0105237_101366021 128
88 3300009545 Ga0105237_10875047 Ga0105237_108750472 128
89 3300009551 Ga0105238_10345442 Ga0105238_103454423 128
90 3300010159 Ga0099796_10491278 Ga0099796_104912782 128
91 3300010375 Ga0105239_10002416 Ga0105239_1000241620 128
92 3300010375 Ga0105239_10469690 Ga0105239_104696903 128
93 3300010375 Ga0105239_10757711 Ga0105239_107577112 128
94 3300013104 Ga0157370_10355288 Ga0157370_103552882 128
95 3300013105 Ga0157369_10181273 Ga0157369_101812734 128
96 3300013105 Ga0157369_10200658 Ga0157369_102006582 128
97 3300013307 Ga0157372_10215633 Ga0157372_102156333 128
98 3300013307 Ga0157372_10575135 Ga0157372_105751352 128
99 3300014969 Ga0157376_10277178 Ga0157376_102771781 128
100 3300014969 Ga0157376_10582560 Ga0157376_105825601 128
101 3300014969 Ga0157376_11032928 Ga0157376_110329282 128
102 3300025297 Ga0209758_1032527 Ga0209758_10325273 128
103 3300025893 Ga0207682_10128444 Ga0207682_101284442 128
104 3300025898 Ga0207692_10006288 Ga0207692_100062882 128
105 3300025904 Ga0207647_10008096 Ga0207647_100080966 128
106 3300025905 Ga0207685_10008833 Ga0207685_100088332 128
107 3300025906 Ga0207699_10307724 Ga0207699_103077242 128
108 3300025913 Ga0207695_10440024 Ga0207695_104400242 128
109 3300025913 Ga0207695_10908532 Ga0207695_109085322 128
110 3300025914 Ga0207671_10000504 Ga0207671_100005049 128
111 3300025915 Ga0207693_10009069 Ga0207693_100090693 128
112 3300025922 Ga0207646_10905364 Ga0207646_109053642 128
113 3300025928 Ga0207700_10037892 Ga0207700_100378924 128
114 3300025928 Ga0207700_10074487 Ga0207700_100744872 128
115 3300025929 Ga0207664_10009805 Ga0207664_100098055 128
116 3300025929 Ga0207664_10508880 Ga0207664_105088802 128
117 3300025939 Ga0207665_10000678 Ga0207665_1000067820 128
118 3300025949 Ga0207667_11168327 Ga0207667_111683272 128
119 3300025981 Ga0207640_10730600 Ga0207640_107306001 128
120 3300026041 Ga0207639_10006241 Ga0207639_100062418 128
121 3300026088 Ga0207641_10000249 Ga0207641_1000024912 128
122 3300026116 Ga0207674_10031330 Ga0207674_100313307 128
123 3300026142 Ga0207698_10300833 Ga0207698_103008332 128
124 3300027312 Ga0209371_1013384 Ga0209371_10133841 128
125 3300028379 Ga0268266_10002704 Ga0268266_100027048 128
126 3300028379 Ga0268266_10797704 Ga0268266_107977042 128
127 3300030500 Ga0268256_1013603 Ga0268256_10136035 128
128 3300031239 Ga0265328_10000037 Ga0265328_1000003730 128
129 3300032004 Ga0307414_10329351 Ga0307414_103293512 128
130 3300032139 Ga0316580_10096104 Ga0316580_100961042 128
131 3300033180 Ga0307510_10000016 Ga0307510_10000016102 128
132 3300037068 Ga0373925_0624612 Ga0373925_0624612_175_561 128
133 3300037466 Ga0395898_0783402 Ga0395898_0783402_172_558 128
134 3300038443 Ga0395901_1617490 Ga0395901_1617490_190_576 128
135 3300039438 Ga0436360_0520041 Ga0436360_0520041_21_407 128
136 3300039447 Ga0436361_0618783 Ga0436361_0618783_69_455 128
137 3300042004 Ga0439445_0018364 Ga0439445_0018364_521_907 128
138 3300046472 Ga0495580_0048327 Ga0495580_0048327_585_971 128
139 3300046473 Ga0495582_0655351 Ga0495582_0655351_38_424 128
140 3300046491 Ga0495584_0240656 Ga0495584_0240656_55_441 128
141 3300046501 Ga0495607_0118140 Ga0495607_0118140_979_1365 128
142 3300046501 Ga0495607_0143849 Ga0495607_0143849_315_701 128
143 3300046501 Ga0495607_0327119 Ga0495607_0327119_234_620 128
144 3300046506 Ga0495583_0389186 Ga0495583_0389186_121_507 128
145 3300046507 Ga0495606_0087379 Ga0495606_0087379_820_1206 128
146 3300046512 Ga0495610_0013323 Ga0495610_0013323_3294_3680 128
147 3300046512 Ga0495610_0217194 Ga0495610_0217194_80_466 128
148 3300046515 Ga0495620_0101292 Ga0495620_0101292_268_654 128
149 3300046520 Ga0495637_0071066 Ga0495637_0071066_746_1132 128
150 3300046530 Ga0495654_0123895 Ga0495654_0123895_290_676 128
151 3300046538 Ga0495609_0069244 Ga0495609_0069244_863_1249 128
152 3300046542 Ga0495597_0165901 Ga0495597_0165901_56_442 128
153 3300046543 Ga0495645_0292078 Ga0495645_0292078_237_623 128
154 3300046558 Ga0495633_0158201 Ga0495633_0158201_256_642 128
155 3300046616 Ga0495668_0264893 Ga0495668_0264893_326_712 128
156 3300046660 Ga0495625_0161756 Ga0495625_0161756_794_1180 128
157 3300046664 Ga0495659_0140358 Ga0495659_0140358_236_622 128
158 3300046665 Ga0495661_0154700 Ga0495661_0154700_148_534 128
159 3300046674 Ga0495588_0141436 Ga0495588_0141436_672_1058 128
160 3300046674 Ga0495588_0270670 Ga0495588_0270670_217_603 128
161 3300047443 Ga0495687_058369 Ga0495687_058369_387_773 128
162 3300047443 Ga0495687_172867 Ga0495687_172867_281_667 128
163 3300047444 Ga0495675_0112593 Ga0495675_0112593_34_420 128
164 3300047469 Ga0495673_0148755 Ga0495673_0148755_287_673 128
165 3300047470 Ga0495681_0237205 Ga0495681_0237205_325_711 128
166 3300047472 Ga0495686_0314445 Ga0495686_0314445_56_442 128
167 3300048905 Ga0496102_0916775 Ga0496102_0916775_217_603 128
168 3300048907 Ga0496104_0549166 Ga0496104_0549166_292_678 128
169 3300048915 Ga0496112_0927497 Ga0496112_0927497_81_467 128
170 3300048922 Ga0496119_0000330 Ga0496119_0000330_10784_11170 128
171 3300048922 Ga0496119_0000330 Ga0496119_0000330_14731_15117 128
172 3300048923 Ga0496120_0013645 Ga0496120_0013645_935_1321 128
173 3300048923 Ga0496120_0029887 Ga0496120_0029887_2586_2972 128
174 3300048924 Ga0496121_0047558 Ga0496121_0047558_422_808 128
175 3300048924 Ga0496121_0744819 Ga0496121_0744819_43_429 128
176 3300048928 Ga0496125_0007706 Ga0496125_0007706_1984_2370 128
177 3300048928 Ga0496125_0007706 Ga0496125_0007706_9316_9702 128
178 3300048928 Ga0496125_0113454 Ga0496125_0113454_911_1297 128
179 3300048929 Ga0496126_0030703 Ga0496126_0030703_4661_5047 128
180 3300048929 Ga0496126_0030703 Ga0496126_0030703_714_1100 128
181 3300049571 Ga0501034_0001728 Ga0501034_0001728_593_979 128
182 3300049572 Ga0501036_0020611 Ga0501036_0020611_508_894 128
183 3300049573 Ga0501037_0154307 Ga0501037_0154307_359_745 128
184 3300049574 Ga0501038_0015369 Ga0501038_0015369_5686_6072 128
185 3300049579 Ga0501043_0036317 Ga0501043_0036317_762_1148 128
186 3300049580 Ga0501046_0324029 Ga0501046_0324029_532_918 128
187 3300049581 Ga0501047_0003513 Ga0501047_0003513_13559_13945 128
188 3300049583 Ga0501067_0000332 Ga0501067_0000332_18567_18953 128
189 3300049584 Ga0501068_0016345 Ga0501068_0016345_3707_4093 128
190 3300049585 Ga0501069_0006000 Ga0501069_0006000_590_976 128
191 3300049586 Ga0501070_0020548 Ga0501070_0020548_4454_4840 128
192 3300049588 Ga0501072_0000433 Ga0501072_0000433_24590_24976 128
193 3300049589 Ga0501073_0004239 Ga0501073_0004239_9908_10294 128
194 3300049590 Ga0501074_0014918 Ga0501074_0014918_697_1083 128
195 3300049649 Ga0501198_048181 Ga0501198_048181_329_715 128
196 3300049741 Ga0501079_0033287 Ga0501079_0033287_406_792 128
197 3300049742 Ga0501080_0026248 Ga0501080_0026248_698_1084 128
198 3300049744 Ga0501083_0010128 Ga0501083_0010128_3165_3551 128
199 3300049822 Ga0501035_0123346 Ga0501035_0123346_1832_2218 128
200 3300049823 Ga0501044_0024332 Ga0501044_0024332_3041_3427 128
201 3300053079 Ga0500610_0219448 Ga0500610_0219448_268_654 128
202 3300053086 Ga0500578_0473543 Ga0500578_0473543_20_406 128
203 3300053087 Ga0500643_027966 Ga0500643_027966_1136_1522 128
204 3300053093 Ga0500651_0000789 Ga0500651_0000789_3782_4168 128
205 3300053093 Ga0500651_0080896 Ga0500651_0080896_210_596 128
206 3300053104 Ga0500556_0002193 Ga0500556_0002193_4123_4509 128
207 3300053130 Ga0500642_0093750 Ga0500642_0093750_18_404 128
208 3300053151 Ga0500604_0100288 Ga0500604_0100288_477_863 128
209 3300060353 Ga0501082_0279061 Ga0501082_0279061_270_656 128
210 3300028794 Ga0307515_10019713 Ga0307515_100197134 129
211 3300048924 Ga0496121_0223583 Ga0496121_0223583_868_1257 129
212 3300048924 Ga0496121_0446782 Ga0496121_0446782_11_400 129
213 3300003781 Ga0055536_1025410 Ga0055536_10254103 130
214 3300003781 Ga0055536_1038660 Ga0055536_10386601 130
215 3300003791 Ga0055530_10044646 Ga0055530_100446462 130
216 3300025298 Ga0209050_1007652 Ga0209050_10076526 130
217 3300041405 Ga0439438_090288 Ga0439438_090288_212_604 130
218 3300041407 Ga0439447_162748 Ga0439447_162748_23_415 130
219 3300041413 Ga0439465_0008931 Ga0439465_0008931_2467_2859 130
220 3300042007 Ga0439449_0352767 Ga0439449_0352767_136_528 130
221 3300050489 nmdc:mga03683_222378_c1 nmdc:mga03683_222378_c1_105_497 130
222 3300053151 Ga0500604_0029878 Ga0500604_0029878_89_481 130
223 3300002739 JGI25158J39367_1000824 JGI25158J39367_10008245 131
224 3300002987 JGI25159J45721_1000049 JGI25159J45721_10000496 131
225 3300003354 JGI25160J50197_1000147 JGI25160J50197_100014756 131
226 3300003374 JGI25161J50226_1001246 JGI25161J50226_10012463 131
227 3300003771 Ga0055526_1000816 Ga0055526_100081621 131
228 3300003775 Ga0055524_1011876 Ga0055524_10118764 131
229 3300003794 Ga0055531_10039941 Ga0055531_100399411 131
230 3300004625 Ga0055543_1000129 Ga0055543_10001296 131
231 3300005262 Ga0065165_1000477 Ga0065165_100047757 131
232 3300025208 Ga0209436_100992 Ga0209436_10099212 131
233 3300025284 Ga0209130_1000234 Ga0209130_10002346 131
234 3300025292 Ga0209676_1001505 Ga0209676_100150522 131
235 3300025294 Ga0209025_1000337 Ga0209025_100033779 131
236 3300025295 Ga0209564_1000117 Ga0209564_100011749 131
237 3300025299 Ga0209256_1001481 Ga0209256_100148121 131
238 3300025302 Ga0207426_1000410 Ga0207426_10004106 131
239 3300025303 Ga0209051_1038757 Ga0209051_10387572 131
240 3300025304 Ga0209257_1001789 Ga0209257_100178913 131
241 3300041405 Ga0439438_144127 Ga0439438_144127_68_463 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

4

124

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.7218 1 130
3zvk-assembly1.cif.gz_B crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7169 2 130
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.7168 2 130
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7124 2 128
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.7123 1 130
ID Description Score Start End Superfamily
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.824 5 125 3.40.50.1010
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8004 5 125 3.40.50.1010
af_Q60288_5_153_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7206 4 131 3.40.50.1010
af_P9WF81_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7187 5 120 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7169 2 130 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A2X2D9H7-F1-model_v4 PIN domain-containing protein 0.9759 2 128
AF-A0A3G2NDB8-F1-model_v4 deleted 0.9756 2 128
AF-A0A5P2SEI4-F1-model_v4 deleted 0.9749 2 128
AF-A0A6H0IXD5-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9746 2 129
AF-A0A0L6JAP8-F1-model_v4 Twitching motility protein PilT 0.97 21 129

Feature Viewer

pLDDT pTM Quality
96.07 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map