F353034

General Info

Members Datasets Scaffolds Average Seq Length
240 119 240 130

Family's Representative Sequence

Representative Sequence 3300035410|Ga0373924_0046230|Ga0373924_0046230_107_568
Length 153
Sequence MTPGYPSAFRGIRYVDCYQEGATLSAHREPVEASNAPAAIGPYVHAVRAGGLLFCSGQIPLDPRTGDLVGGSAGAQAGRCLENLAAVCDAAGTTLGDAVKLTVYLTDMRTFPEVNDVYSSFFESDPPARVAIGVSALPRGAMVEIDAVVALPD

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
61 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
62 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
63 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
73 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
81 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
114 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
115 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
116 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
117 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.67
Rhizosphere 82.5
Stem 0
Stem Tuber 0
Unclassified 15.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101963993 3300005329 Unclassified 562
2 Ga0068869_100034891 3300005334 Bacteria 3562
3 Ga0070689_100157653 3300005340 Bacteria 1833
4 Ga0070692_10255860 3300005345 Bacteria 1050
5 Ga0070669_100058319 3300005353 Bacteria 2833
6 Ga0070675_100396763 3300005354 Bacteria 1230
7 Ga0070673_100151351 3300005364 Bacteria 1965
8 Ga0070688_100007051 3300005365 Bacteria 6046
9 Ga0070659_100000030 3300005366 Bacteria 128662
10 Ga0070709_10032696 3300005434 Bacteria 3139
11 Ga0070714_100024402 3300005435 Bacteria 4979
12 Ga0070714_100035743 3300005435 Bacteria 4164
13 Ga0070714_100159636 3300005435 Bacteria 2039
14 Ga0070714_100909956 3300005435 Bacteria 854
15 Ga0070713_100023261 3300005436 Bacteria 4805
16 Ga0070713_100171873 3300005436 Bacteria 1942
17 Ga0070713_100407014 3300005436 Bacteria 1271
18 Ga0070713_100743592 3300005436 Bacteria 938
19 Ga0070710_10000009 3300005437 Bacteria 165863
20 Ga0070710_10628738 3300005437 Bacteria 750
21 Ga0070701_10115744 3300005438 Bacteria 1504
22 Ga0070711_100104716 3300005439 Bacteria 2065
23 Ga0070711_100998491 3300005439 Bacteria 718
24 Ga0070705_100010467 3300005440 Bacteria 4644
25 Ga0070684_100676202 3300005535 Bacteria 962
26 Ga0070684_101398482 3300005535 Unclassified 659
27 Ga0070672_100627920 3300005543 Bacteria 937
28 Ga0070686_100014524 3300005544 Bacteria 4543
29 Ga0070696_100540875 3300005546 Bacteria 932
30 Ga0068855_100334920 3300005563 Bacteria 1670
31 Ga0068857_100292868 3300005577 Bacteria 1499
32 Ga0068859_100006206 3300005617 Bacteria 12139
33 Ga0068864_100387207 3300005618 Bacteria 1326
34 Ga0068861_100133482 3300005719 Bacteria 2018
35 Ga0081455_10837334 3300005937 Bacteria 575
36 Ga0070717_10000013 3300006028 Bacteria 228046
37 Ga0070717_10043256 3300006028 Bacteria 3676
38 Ga0070717_10056110 3300006028 Bacteria 3253
39 Ga0070717_10228216 3300006028 Bacteria 1639
40 Ga0070715_10038025 3300006163 Bacteria 1996
41 Ga0070712_100000003 3300006175 Bacteria 253696
42 Ga0070712_100002739 3300006175 Bacteria 10888
43 Ga0075433_10819037 3300006852 Bacteria 813
44 Ga0075433_11097454 3300006852 Bacteria 692
45 Ga0075429_100002162 3300006880 Bacteria 16410
46 Ga0075429_101640664 3300006880 Unclassified 559
47 Ga0097620_100006206 3300006931 Bacteria 12139
48 Ga0075435_100700930 3300007076 Bacteria 880
49 Ga0105240_10030438 3300009093 Bacteria 7016
50 Ga0105247_10406278 3300009101 Bacteria 972
51 Ga0105237_10002708 3300009545 Bacteria 21638
52 Ga0105249_10398079 3300009553 Bacteria 1407
53 Ga0105239_10063767 3300010375 Bacteria 4045
54 Ga0105246_10228466 3300011119 Bacteria 1464
55 Ga0157375_10040068 3300013308 Bacteria 4513
56 Ga0157376_10223371 3300014969 Bacteria 1746
57 Ga0206354_10145159 3300020081 Bacteria 909
58 Ga0206353_11829792 3300020082 Bacteria 686
59 Ga0213874_10004962 3300021377 Bacteria 3074
60 Ga0213874_10139021 3300021377 Bacteria 840
61 Ga0213874_10152622 3300021377 Bacteria 807
62 Ga0213874_10162969 3300021377 Bacteria 784
63 Ga0213876_10007564 3300021384 Bacteria 5900
64 Ga0213876_10017366 3300021384 Bacteria 3799
65 Ga0213876_10134793 3300021384 Bacteria 1313
66 Ga0213875_10007998 3300021388 Bacteria 5434
67 Ga0213875_10020932 3300021388 Bacteria 3136
68 Ga0213875_10034386 3300021388 Bacteria 2393
69 Ga0213875_10043723 3300021388 Bacteria 2103
70 Ga0213875_10135692 3300021388 Bacteria 1151
71 Ga0213875_10408538 3300021388 Bacteria 648
72 Ga0207692_10000005 3300025898 Bacteria 370169
73 Ga0207692_10083382 3300025898 Bacteria 1715
74 Ga0207710_10176844 3300025900 Bacteria 1045
75 Ga0207685_10108060 3300025905 Bacteria 1201
76 Ga0207699_10415769 3300025906 Bacteria 960
77 Ga0207699_10687624 3300025906 Bacteria 748
78 Ga0207695_10073029 3300025913 Bacteria 3497
79 Ga0207671_10001682 3300025914 Bacteria 25096
80 Ga0207693_10000028 3300025915 Bacteria 120041
81 Ga0207693_10001462 3300025915 Bacteria 20878
82 Ga0207693_10389937 3300025915 Bacteria 1089
83 Ga0207693_11171935 3300025915 Unclassified 581
84 Ga0207663_11129993 3300025916 Bacteria 630
85 Ga0207700_10037950 3300025928 Bacteria 3493
86 Ga0207700_10151398 3300025928 Bacteria 1917
87 Ga0207700_10613173 3300025928 Bacteria 969
88 Ga0207664_10000046 3300025929 Bacteria 140749
89 Ga0207664_10015856 3300025929 Bacteria 5486
90 Ga0207664_10038913 3300025929 Bacteria 3689
91 Ga0207664_10042139 3300025929 Bacteria 3562
92 Ga0207664_10242138 3300025929 Bacteria 1571
93 Ga0207664_10512561 3300025929 Bacteria 1075
94 Ga0207664_10515663 3300025929 Bacteria 1071
95 Ga0207664_10616023 3300025929 Bacteria 975
96 Ga0207690_10002454 3300025932 Bacteria 11210
97 Ga0207665_10034555 3300025939 Bacteria 3354
98 Ga0207712_10166496 3300025961 Bacteria 1718
99 Ga0265326_10000030 3300028558 Bacteria 96518
100 Ga0265326_10240343 3300028558 Bacteria 522
101 Ga0265319_1000825 3300028563 Bacteria 19722
102 Ga0265334_10002014 3300028573 Bacteria 9625
103 Ga0265318_10208099 3300028577 Bacteria 715
104 Ga0265336_10003640 3300028666 Bacteria 6009
105 Ga0265338_10000536 3300028800 Bacteria 66434
106 Ga0265338_10145397 3300028800 Bacteria 1850
107 Ga0265338_10387234 3300028800 Bacteria 999
108 Ga0265320_10214318 3300031240 Bacteria 858
109 Ga0265340_10329994 3300031247 Bacteria 675
110 Ga0265327_10027944 3300031251 Bacteria 3238
111 Ga0265314_10582995 3300031711 Bacteria 578
112 Ga0373953_0213383 3300035117 Bacteria 836
113 Ga0373955_0114600 3300035172 Bacteria 1561
114 Ga0373924_0046230 3300035410 Bacteria 1793
115 Ga0373933_0067480 3300035724 Bacteria 2170
116 Ga0395899_0071546 3300037312 Bacteria 2538
117 Ga0395900_0020474 3300037418 Bacteria 6753
118 Ga0395905_0005551 3300037471 Bacteria 12861
119 Ga0436364_0225316 3300037853 Bacteria 5477
120 Ga0436364_0380503 3300037853 Bacteria 652
121 Ga0436364_0530770 3300037853 Bacteria 1375
122 Ga0436364_0610619 3300037853 Bacteria 962
123 Ga0436364_0678596 3300037853 Bacteria 3855
124 Ga0436364_0869006 3300037853 Bacteria 2959
125 Ga0436364_0908739 3300037853 Bacteria 827
126 Ga0436364_1275466 3300037853 Bacteria 3623
127 Ga0436364_1374271 3300037853 Bacteria 119265
128 Ga0395901_0016610 3300038443 Bacteria 7501
129 Ga0436365_0354569 3300039437 Bacteria 2565
130 Ga0436365_0389162 3300039437 Bacteria 545
131 Ga0436365_0555597 3300039437 Bacteria 857
132 Ga0436365_0789045 3300039437 Bacteria 983
133 Ga0436365_0821011 3300039437 Bacteria 4014
134 Ga0436365_1232084 3300039437 Bacteria 613
135 Ga0436365_1398412 3300039437 Bacteria 5697
136 Ga0436360_0336250 3300039438 Bacteria 1084
137 Ga0436360_0493657 3300039438 Bacteria 818
138 Ga0436361_0666354 3300039447 Bacteria 2816
139 Ga0436363_0252156 3300039450 Bacteria 801
140 Ga0436363_0505036 3300039450 Bacteria 717
141 Ga0436363_0592184 3300039450 Bacteria 48672
142 Ga0436363_0912902 3300039450 Bacteria 685
143 Ga0436363_0931432 3300039450 Bacteria 3014
144 Ga0436363_1125313 3300039450 Bacteria 989
145 Ga0436363_1272522 3300039450 Bacteria 681
146 Ga0436363_1651254 3300039450 Bacteria 3257
147 Ga0436362_0075962 3300039453 Bacteria 554
148 Ga0436362_0293290 3300039453 Bacteria 640
149 Ga0436362_0434824 3300039453 Bacteria 3473
150 Ga0436362_1119095 3300039453 Bacteria 661
151 Ga0466965_0007725 3300044683 Bacteria 4949
152 Ga0466965_0031483 3300044683 Bacteria 2587
153 Ga0466965_0311568 3300044683 Bacteria 856
154 Ga0466966_0077520 3300044684 Bacteria 2074
155 Ga0466966_0323211 3300044684 Bacteria 927
156 Ga0466966_0355849 3300044684 Bacteria 880
157 Ga0466966_0394828 3300044684 Bacteria 831
158 Ga0466966_0702067 3300044684 Bacteria 610
159 Ga0466961_0095829 3300044693 Bacteria 1871
160 Ga0466961_0265516 3300044693 Bacteria 1052
161 Ga0466961_0610988 3300044693 Unclassified 655
162 Ga0466963_0013406 3300044694 Bacteria 5033
163 Ga0466963_0028816 3300044694 Bacteria 3569
164 Ga0466963_0179042 3300044694 Bacteria 1480
165 Ga0466963_0268848 3300044694 Bacteria 1198
166 Ga0466963_0477189 3300044694 Bacteria 880
167 Ga0466963_0804937 3300044694 Bacteria 663
168 Ga0466963_0859494 3300044694 Bacteria 639
169 Ga0466964_0784035 3300044706 Bacteria 537
170 Ga0466971_0020736 3300044719 Bacteria 2921
171 Ga0466971_0045808 3300044719 Bacteria 1964
172 Ga0466971_0103484 3300044719 Bacteria 1310
173 Ga0466971_0289576 3300044719 Bacteria 785
174 Ga0466968_0030771 3300044735 Bacteria 2225
175 Ga0466968_0043900 3300044735 Bacteria 1894
176 Ga0466968_0075316 3300044735 Bacteria 1475
177 Ga0466968_0599708 3300044735 Unclassified 556
178 Ga0466970_0009666 3300044765 Bacteria 4880
179 Ga0466970_0139006 3300044765 Bacteria 1337
180 Ga0466970_0193050 3300044765 Bacteria 1132
181 Ga0466970_0328008 3300044765 Bacteria 866
182 Ga0466970_0558536 3300044765 Bacteria 662
183 Ga0466957_0002475 3300044842 Bacteria 9917
184 Ga0466957_0053597 3300044842 Bacteria 2459
185 Ga0466957_0472527 3300044842 Bacteria 866
186 Ga0466957_0542734 3300044842 Bacteria 810
187 Ga0466957_0889720 3300044842 Bacteria 636
188 Ga0466959_0010743 3300045049 Bacteria 6560
189 Ga0466959_0025378 3300045049 Bacteria 4392
190 Ga0466959_0089847 3300045049 Bacteria 2207
191 Ga0466959_0110037 3300045049 Bacteria 1967
192 Ga0466959_0111747 3300045049 Bacteria 1949
193 Ga0466959_0179857 3300045049 Bacteria 1480
194 Ga0466959_0213560 3300045049 Bacteria 1340
195 Ga0466959_0288222 3300045049 Bacteria 1126
196 Ga0466959_0494308 3300045049 Bacteria 827
197 Ga0466959_1211353 3300045049 Unclassified 502
198 Ga0466958_0002483 3300045836 Bacteria 9282
199 Ga0466958_0008307 3300045836 Bacteria 5749
200 Ga0466958_0021192 3300045836 Bacteria 3795
201 Ga0466958_0148720 3300045836 Bacteria 1477
202 Ga0466958_0152730 3300045836 Bacteria 1457
203 Ga0466958_0267343 3300045836 Bacteria 1095
204 Ga0466958_0399628 3300045836 Bacteria 887
205 Ga0466958_0407924 3300045836 Bacteria 878
206 Ga0466967_0002386 3300045976 Bacteria 11644
207 Ga0466967_0055589 3300045976 Bacteria 3487
208 Ga0466967_0214899 3300045976 Bacteria 1825
209 Ga0466967_0528098 3300045976 Bacteria 1160
210 Ga0466967_0566383 3300045976 Bacteria 1119
211 Ga0466967_1092073 3300045976 Bacteria 795
212 Ga0466967_2368208 3300045976 Unclassified 526
213 Ga0495651_0307264 3300046462 Bacteria 1062
214 Ga0495653_0000183 3300046463 Bacteria 51182
215 Ga0495653_0031241 3300046463 Bacteria 4234
216 Ga0495653_0226462 3300046463 Bacteria 1254
217 Ga0495664_0633275 3300046477 Bacteria 634
218 Ga0495608_0108454 3300046511 Bacteria 1786
219 Ga0495628_0202930 3300046516 Bacteria 1493
220 Ga0495652_0047093 3300046529 Bacteria 3699
221 Ga0495665_0165577 3300046531 Bacteria 1152
222 Ga0495640_0248674 3300046533 Bacteria 1114
223 Ga0495657_0001991 3300046675 Bacteria 17408
224 Ga0495599_0049975 3300046678 Bacteria 2621
225 Ga0495604_0011283 3300047317 Bacteria 7094
226 Ga0495593_0068760 3300047673 Bacteria 1843
227 Ga0496108_0996580 3300048911 Bacteria 716
228 Ga0496112_0000463 3300048915 Bacteria 27080
229 Ga0496113_0047278 3300048916 Bacteria 3197
230 Ga0496113_0412146 3300048916 Bacteria 1085
231 Ga0496124_0135726 3300048927 Bacteria 1948
232 nmdc:mga09592_2020_c1 3300050508 Bacteria 16366
233 nmdc:mga0rr50_724255_c1 3300050513 Bacteria 849
234 nmdc:mga08x19_212134_c1 3300050514 Bacteria 1329
235 nmdc:mga0a205_393462_c1 3300050515 Bacteria 1250
236 Ga0495601_0577788 3300053077 Bacteria 722
237 Ga0495595_0519460 3300053084 Bacteria 607
238 Ga0495619_0270257 3300053085 Bacteria 1178
239 Ga0466962_0028748 3300061719 Bacteria 2663
240 Ga0466962_0081011 3300061719 Bacteria 1552

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006028 Ga0070717_10000013 Ga0070717_10000013113 123
2 3300037853 Ga0436364_0610619 Ga0436364_0610619_350_721 123
3 3300039438 Ga0436360_0336250 Ga0436360_0336250_218_589 123
4 3300005334 Ga0068869_100034891 Ga0068869_1000348915 125
5 3300005340 Ga0070689_100157653 Ga0070689_1001576532 125
6 3300005345 Ga0070692_10255860 Ga0070692_102558602 125
7 3300005353 Ga0070669_100058319 Ga0070669_1000583192 125
8 3300005354 Ga0070675_100396763 Ga0070675_1003967632 125
9 3300005364 Ga0070673_100151351 Ga0070673_1001513512 125
10 3300005365 Ga0070688_100007051 Ga0070688_1000070513 125
11 3300005438 Ga0070701_10115744 Ga0070701_101157442 125
12 3300005543 Ga0070672_100627920 Ga0070672_1006279202 125
13 3300005544 Ga0070686_100014524 Ga0070686_1000145242 125
14 3300005563 Ga0068855_100334920 Ga0068855_1003349202 125
15 3300005577 Ga0068857_100292868 Ga0068857_1002928682 125
16 3300005617 Ga0068859_100006206 Ga0068859_1000062064 125
17 3300005618 Ga0068864_100387207 Ga0068864_1003872072 125
18 3300005719 Ga0068861_100133482 Ga0068861_1001334823 125
19 3300006931 Ga0097620_100006206 Ga0097620_10000620610 125
20 3300009553 Ga0105249_10398079 Ga0105249_103980792 125
21 3300013308 Ga0157375_10040068 Ga0157375_100400685 125
22 3300037312 Ga0395899_0071546 Ga0395899_0071546_582_971 125
23 3300037418 Ga0395900_0020474 Ga0395900_0020474_5348_5737 125
24 3300037471 Ga0395905_0005551 Ga0395905_0005551_3840_4229 125
25 3300038443 Ga0395901_0016610 Ga0395901_0016610_2481_2870 125
26 3300044693 Ga0466961_0095829 Ga0466961_0095829_284_673 125
27 3300044719 Ga0466971_0103484 Ga0466971_0103484_348_737 125
28 3300044842 Ga0466957_0053597 Ga0466957_0053597_1539_1928 125
29 3300045836 Ga0466958_0021192 Ga0466958_0021192_1843_2232 125
30 3300005435 Ga0070714_100909956 Ga0070714_1009099562 126
31 3300005436 Ga0070713_100743592 Ga0070713_1007435921 126
32 3300044684 Ga0466966_0355849 Ga0466966_0355849_216_596 126
33 3300021388 Ga0213875_10034386 Ga0213875_100343862 127
34 3300037853 Ga0436364_0225316 Ga0436364_0225316_2490_2873 127
35 3300039450 Ga0436363_1272522 Ga0436363_1272522_125_508 127
36 3300039453 Ga0436362_0293290 Ga0436362_0293290_135_518 127
37 3300044735 Ga0466968_0030771 Ga0466968_0030771_1081_1464 127
38 3300044842 Ga0466957_0472527 Ga0466957_0472527_26_409 127
39 3300045049 Ga0466959_0110037 Ga0466959_0110037_107_490 127
40 3300006175 Ga0070712_100000003 Ga0070712_10000000313 128
41 3300009545 Ga0105237_10002708 Ga0105237_100027086 128
42 3300025914 Ga0207671_10001682 Ga0207671_1000168211 128
43 3300025915 Ga0207693_10000028 Ga0207693_1000002879 128
44 3300037853 Ga0436364_0380503 Ga0436364_0380503_16_402 128
45 3300039437 Ga0436365_0555597 Ga0436365_0555597_424_810 128
46 3300039450 Ga0436363_0912902 Ga0436363_0912902_96_482 128
47 3300039453 Ga0436362_1119095 Ga0436362_1119095_30_416 128
48 3300044694 Ga0466963_0859494 Ga0466963_0859494_157_543 128
49 3300044842 Ga0466957_0889720 Ga0466957_0889720_43_429 128
50 3300005439 Ga0070711_100998491 Ga0070711_1009984911 129
51 3300005937 Ga0081455_10837334 Ga0081455_108373341 129
52 3300006880 Ga0075429_101640664 Ga0075429_1016406642 129
53 3300021377 Ga0213874_10139021 Ga0213874_101390212 129
54 3300021388 Ga0213875_10135692 Ga0213875_101356922 129
55 3300021388 Ga0213875_10408538 Ga0213875_104085381 129
56 3300025916 Ga0207663_11129993 Ga0207663_111299932 129
57 3300037853 Ga0436364_0530770 Ga0436364_0530770_671_1060 129
58 3300037853 Ga0436364_0869006 Ga0436364_0869006_2042_2431 129
59 3300037853 Ga0436364_0908739 Ga0436364_0908739_400_789 129
60 3300039437 Ga0436365_0354569 Ga0436365_0354569_80_469 129
61 3300039437 Ga0436365_0789045 Ga0436365_0789045_215_604 129
62 3300039437 Ga0436365_1232084 Ga0436365_1232084_121_510 129
63 3300039450 Ga0436363_1125313 Ga0436363_1125313_480_869 129
64 3300039453 Ga0436362_0434824 Ga0436362_0434824_1151_1540 129
65 3300044683 Ga0466965_0007725 Ga0466965_0007725_2494_2883 129
66 3300044683 Ga0466965_0031483 Ga0466965_0031483_1085_1474 129
67 3300044684 Ga0466966_0323211 Ga0466966_0323211_202_591 129
68 3300044694 Ga0466963_0013406 Ga0466963_0013406_668_1057 129
69 3300044694 Ga0466963_0477189 Ga0466963_0477189_127_516 129
70 3300044719 Ga0466971_0020736 Ga0466971_0020736_1680_2069 129
71 3300044719 Ga0466971_0289576 Ga0466971_0289576_83_472 129
72 3300044735 Ga0466968_0043900 Ga0466968_0043900_208_597 129
73 3300044735 Ga0466968_0599708 Ga0466968_0599708_152_541 129
74 3300044765 Ga0466970_0139006 Ga0466970_0139006_648_1037 129
75 3300044842 Ga0466957_0002475 Ga0466957_0002475_8864_9253 129
76 3300045049 Ga0466959_0010743 Ga0466959_0010743_865_1254 129
77 3300045049 Ga0466959_0179857 Ga0466959_0179857_231_620 129
78 3300045049 Ga0466959_0213560 Ga0466959_0213560_654_1043 129
79 3300045049 Ga0466959_1211353 Ga0466959_1211353_64_471 129
80 3300045836 Ga0466958_0002483 Ga0466958_0002483_979_1368 129
81 3300045836 Ga0466958_0008307 Ga0466958_0008307_3517_3906 129
82 3300045836 Ga0466958_0407924 Ga0466958_0407924_69_458 129
83 3300045976 Ga0466967_0002386 Ga0466967_0002386_7343_7732 129
84 3300045976 Ga0466967_0566383 Ga0466967_0566383_73_468 129
85 3300045976 Ga0466967_2368208 Ga0466967_2368208_39_428 129
86 3300046463 Ga0495653_0000183 Ga0495653_0000183_8063_8455 129
87 3300048916 Ga0496113_0412146 Ga0496113_0412146_459_848 129
88 3300061719 Ga0466962_0081011 Ga0466962_0081011_626_1015 129
89 3300005329 Ga0070683_101963993 Ga0070683_1019639931 130
90 3300005366 Ga0070659_100000030 Ga0070659_10000003015 130
91 3300005434 Ga0070709_10032696 Ga0070709_100326962 130
92 3300005435 Ga0070714_100024402 Ga0070714_1000244025 130
93 3300005435 Ga0070714_100035743 Ga0070714_1000357434 130
94 3300005435 Ga0070714_100159636 Ga0070714_1001596362 130
95 3300005436 Ga0070713_100023261 Ga0070713_1000232612 130
96 3300005436 Ga0070713_100171873 Ga0070713_1001718731 130
97 3300005436 Ga0070713_100407014 Ga0070713_1004070142 130
98 3300005437 Ga0070710_10000009 Ga0070710_1000000959 130
99 3300005437 Ga0070710_10628738 Ga0070710_106287382 130
100 3300005439 Ga0070711_100104716 Ga0070711_1001047162 130
101 3300005440 Ga0070705_100010467 Ga0070705_1000104673 130
102 3300005535 Ga0070684_100676202 Ga0070684_1006762022 130
103 3300005535 Ga0070684_101398482 Ga0070684_1013984822 130
104 3300005546 Ga0070696_100540875 Ga0070696_1005408752 130
105 3300006028 Ga0070717_10043256 Ga0070717_100432562 130
106 3300006028 Ga0070717_10056110 Ga0070717_100561104 130
107 3300006028 Ga0070717_10228216 Ga0070717_102282162 130
108 3300006163 Ga0070715_10038025 Ga0070715_100380252 130
109 3300006175 Ga0070712_100002739 Ga0070712_1000027397 130
110 3300006852 Ga0075433_10819037 Ga0075433_108190372 130
111 3300006852 Ga0075433_11097454 Ga0075433_110974542 130
112 3300006880 Ga0075429_100002162 Ga0075429_1000021626 130
113 3300007076 Ga0075435_100700930 Ga0075435_1007009302 130
114 3300009093 Ga0105240_10030438 Ga0105240_100304386 130
115 3300009101 Ga0105247_10406278 Ga0105247_104062782 130
116 3300010375 Ga0105239_10063767 Ga0105239_100637672 130
117 3300011119 Ga0105246_10228466 Ga0105246_102284662 130
118 3300014969 Ga0157376_10223371 Ga0157376_102233712 130
119 3300020081 Ga0206354_10145159 Ga0206354_101451592 130
120 3300020082 Ga0206353_11829792 Ga0206353_118297922 130
121 3300021377 Ga0213874_10004962 Ga0213874_100049622 130
122 3300021377 Ga0213874_10152622 Ga0213874_101526222 130
123 3300021377 Ga0213874_10162969 Ga0213874_101629691 130
124 3300021384 Ga0213876_10007564 Ga0213876_100075642 130
125 3300021384 Ga0213876_10017366 Ga0213876_100173663 130
126 3300021384 Ga0213876_10134793 Ga0213876_101347932 130
127 3300021388 Ga0213875_10007998 Ga0213875_100079983 130
128 3300021388 Ga0213875_10020932 Ga0213875_100209323 130
129 3300021388 Ga0213875_10043723 Ga0213875_100437232 130
130 3300025898 Ga0207692_10000005 Ga0207692_10000005267 130
131 3300025898 Ga0207692_10083382 Ga0207692_100833822 130
132 3300025900 Ga0207710_10176844 Ga0207710_101768442 130
133 3300025905 Ga0207685_10108060 Ga0207685_101080602 130
134 3300025906 Ga0207699_10415769 Ga0207699_104157692 130
135 3300025906 Ga0207699_10687624 Ga0207699_106876242 130
136 3300025913 Ga0207695_10073029 Ga0207695_100730292 130
137 3300025915 Ga0207693_10001462 Ga0207693_100014628 130
138 3300025915 Ga0207693_10389937 Ga0207693_103899372 130
139 3300025915 Ga0207693_11171935 Ga0207693_111719351 130
140 3300025928 Ga0207700_10037950 Ga0207700_100379502 130
141 3300025928 Ga0207700_10151398 Ga0207700_101513982 130
142 3300025928 Ga0207700_10613173 Ga0207700_106131732 130
143 3300025929 Ga0207664_10000046 Ga0207664_10000046115 130
144 3300025929 Ga0207664_10015856 Ga0207664_100158562 130
145 3300025929 Ga0207664_10038913 Ga0207664_100389132 130
146 3300025929 Ga0207664_10042139 Ga0207664_100421393 130
147 3300025929 Ga0207664_10242138 Ga0207664_102421381 130
148 3300025929 Ga0207664_10512561 Ga0207664_105125612 130
149 3300025929 Ga0207664_10515663 Ga0207664_105156632 130
150 3300025929 Ga0207664_10616023 Ga0207664_106160231 130
151 3300025932 Ga0207690_10002454 Ga0207690_100024542 130
152 3300025939 Ga0207665_10034555 Ga0207665_100345552 130
153 3300025961 Ga0207712_10166496 Ga0207712_101664962 130
154 3300028558 Ga0265326_10000030 Ga0265326_100000306 130
155 3300028558 Ga0265326_10240343 Ga0265326_102403431 130
156 3300028563 Ga0265319_1000825 Ga0265319_100082517 130
157 3300028573 Ga0265334_10002014 Ga0265334_100020142 130
158 3300028577 Ga0265318_10208099 Ga0265318_102080992 130
159 3300028666 Ga0265336_10003640 Ga0265336_100036405 130
160 3300028800 Ga0265338_10000536 Ga0265338_100005363 130
161 3300028800 Ga0265338_10145397 Ga0265338_101453972 130
162 3300028800 Ga0265338_10387234 Ga0265338_103872342 130
163 3300031240 Ga0265320_10214318 Ga0265320_102143181 130
164 3300031247 Ga0265340_10329994 Ga0265340_103299942 130
165 3300031251 Ga0265327_10027944 Ga0265327_100279443 130
166 3300031711 Ga0265314_10582995 Ga0265314_105829952 130
167 3300035117 Ga0373953_0213383 Ga0373953_0213383_377_769 130
168 3300035172 Ga0373955_0114600 Ga0373955_0114600_1116_1508 130
169 3300035410 Ga0373924_0046230 Ga0373924_0046230_107_568 130
170 3300035724 Ga0373933_0067480 Ga0373933_0067480_617_1009 130
171 3300037853 Ga0436364_0678596 Ga0436364_0678596_667_1059 130
172 3300037853 Ga0436364_1275466 Ga0436364_1275466_2757_3149 130
173 3300037853 Ga0436364_1374271 Ga0436364_1374271_114273_114665 130
174 3300039437 Ga0436365_0389162 Ga0436365_0389162_85_477 130
175 3300039437 Ga0436365_0821011 Ga0436365_0821011_562_954 130
176 3300039437 Ga0436365_1398412 Ga0436365_1398412_3147_3539 130
177 3300039438 Ga0436360_0493657 Ga0436360_0493657_380_772 130
178 3300039447 Ga0436361_0666354 Ga0436361_0666354_2020_2412 130
179 3300039450 Ga0436363_0252156 Ga0436363_0252156_119_511 130
180 3300039450 Ga0436363_0505036 Ga0436363_0505036_305_697 130
181 3300039450 Ga0436363_0592184 Ga0436363_0592184_36344_36736 130
182 3300039450 Ga0436363_0931432 Ga0436363_0931432_1080_1472 130
183 3300039450 Ga0436363_1651254 Ga0436363_1651254_744_1136 130
184 3300039453 Ga0436362_0075962 Ga0436362_0075962_71_463 130
185 3300044683 Ga0466965_0311568 Ga0466965_0311568_314_706 130
186 3300044684 Ga0466966_0077520 Ga0466966_0077520_650_1042 130
187 3300044684 Ga0466966_0394828 Ga0466966_0394828_253_645 130
188 3300044684 Ga0466966_0702067 Ga0466966_0702067_67_459 130
189 3300044693 Ga0466961_0265516 Ga0466961_0265516_160_552 130
190 3300044693 Ga0466961_0610988 Ga0466961_0610988_93_485 130
191 3300044694 Ga0466963_0028816 Ga0466963_0028816_2101_2493 130
192 3300044694 Ga0466963_0179042 Ga0466963_0179042_783_1175 130
193 3300044694 Ga0466963_0268848 Ga0466963_0268848_111_506 130
194 3300044694 Ga0466963_0804937 Ga0466963_0804937_57_449 130
195 3300044706 Ga0466964_0784035 Ga0466964_0784035_131_523 130
196 3300044719 Ga0466971_0045808 Ga0466971_0045808_1501_1893 130
197 3300044735 Ga0466968_0075316 Ga0466968_0075316_358_750 130
198 3300044765 Ga0466970_0009666 Ga0466970_0009666_4054_4446 130
199 3300044765 Ga0466970_0193050 Ga0466970_0193050_77_469 130
200 3300044765 Ga0466970_0328008 Ga0466970_0328008_347_739 130
201 3300044765 Ga0466970_0558536 Ga0466970_0558536_182_574 130
202 3300044842 Ga0466957_0542734 Ga0466957_0542734_335_727 130
203 3300045049 Ga0466959_0025378 Ga0466959_0025378_651_1043 130
204 3300045049 Ga0466959_0089847 Ga0466959_0089847_916_1308 130
205 3300045049 Ga0466959_0111747 Ga0466959_0111747_317_709 130
206 3300045049 Ga0466959_0288222 Ga0466959_0288222_500_892 130
207 3300045049 Ga0466959_0494308 Ga0466959_0494308_287_679 130
208 3300045836 Ga0466958_0148720 Ga0466958_0148720_791_1183 130
209 3300045836 Ga0466958_0152730 Ga0466958_0152730_128_520 130
210 3300045836 Ga0466958_0267343 Ga0466958_0267343_10_402 130
211 3300045836 Ga0466958_0399628 Ga0466958_0399628_275_667 130
212 3300045976 Ga0466967_0055589 Ga0466967_0055589_1593_1985 130
213 3300045976 Ga0466967_0214899 Ga0466967_0214899_1343_1735 130
214 3300045976 Ga0466967_0528098 Ga0466967_0528098_220_636 130
215 3300045976 Ga0466967_1092073 Ga0466967_1092073_310_702 130
216 3300046462 Ga0495651_0307264 Ga0495651_0307264_284_676 130
217 3300046463 Ga0495653_0031241 Ga0495653_0031241_3131_3523 130
218 3300046463 Ga0495653_0226462 Ga0495653_0226462_539_931 130
219 3300046477 Ga0495664_0633275 Ga0495664_0633275_116_508 130
220 3300046511 Ga0495608_0108454 Ga0495608_0108454_913_1305 130
221 3300046516 Ga0495628_0202930 Ga0495628_0202930_160_621 130
222 3300046529 Ga0495652_0047093 Ga0495652_0047093_1099_1491 130
223 3300046531 Ga0495665_0165577 Ga0495665_0165577_646_1107 130
224 3300046533 Ga0495640_0248674 Ga0495640_0248674_154_615 130
225 3300046675 Ga0495657_0001991 Ga0495657_0001991_2088_2480 130
226 3300046678 Ga0495599_0049975 Ga0495599_0049975_2146_2538 130
227 3300047317 Ga0495604_0011283 Ga0495604_0011283_2083_2475 130
228 3300047673 Ga0495593_0068760 Ga0495593_0068760_124_585 130
229 3300048911 Ga0496108_0996580 Ga0496108_0996580_313_705 130
230 3300048915 Ga0496112_0000463 Ga0496112_0000463_16833_17225 130
231 3300048916 Ga0496113_0047278 Ga0496113_0047278_1405_1800 130
232 3300048927 Ga0496124_0135726 Ga0496124_0135726_593_985 130
233 3300050508 nmdc:mga09592_2020_c1 nmdc:mga09592_2020_c1_5485_5877 130
234 3300050513 nmdc:mga0rr50_724255_c1 nmdc:mga0rr50_724255_c1_90_485 130
235 3300050514 nmdc:mga08x19_212134_c1 nmdc:mga08x19_212134_c1_662_1054 130
236 3300050515 nmdc:mga0a205_393462_c1 nmdc:mga0a205_393462_c1_165_557 130
237 3300053077 Ga0495601_0577788 Ga0495601_0577788_117_509 130
238 3300053084 Ga0495595_0519460 Ga0495595_0519460_29_421 130
239 3300053085 Ga0495619_0270257 Ga0495619_0270257_326_718 130
240 3300061719 Ga0466962_0028748 Ga0466962_0028748_1069_1461 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

33

151

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jd1-assembly1.cif.gz_F crystal structure of yeo7_yeast 0.9681 4 129
6l8p-assembly1.cif.gz_B crystal structure of rida from antarctic bacterium psychrobacter sp. pamc 21119 0.9671 5 128
6tcc-assembly1.cif.gz_A crystal structure of salmo salar rida-1 0.9636 4 129
3l7q-assembly2.cif.gz_E crystal structure of aldr from streptococcus mutans 0.9616 6 129
1jd1-assembly1.cif.gz_F crystal structure of yeo7_yeast 0.9606 4 129
ID Description Score Start End Superfamily
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9686 4 129 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9681 4 129 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9606 4 129 3.30.1330.40
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9556 4 129 3.30.1330.40
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9544 3 128 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A538L5A0-F1-model_v4 RidA family protein 0.9856 4 130 GO:0005829
GO:0019239
AF-A0A257B2K1-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9805 2 130 GO:0004833
GO:0005829
GO:0019239
GO:0019441
GO:0020037
GO:0046872
AF-A0A3E0NXD2-F1-model_v4 Reactive intermediate/imine deaminase 0.9795 3 127 GO:0005829
GO:0019239
AF-A0A4P5VUU6-F1-model_v4 Reactive intermediate/imine deaminase 0.9787 6 130 GO:0005829
GO:0019239
AF-A0A0A2HVI5-F1-model_v4 Endoribonuclease L-PSP 0.9779 4 130 GO:0005829
GO:0019239

Feature Viewer

pLDDT pTM Quality
94.6 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map