F352719

General Info

Members Datasets Scaffolds Average Seq Length
240 158 238 259

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10000098|Ga0075365_1000009819
Length 278
Sequence MIDARVYNASMEKITTPIMEVINLTGKTAIVTGGAKGIGLGIIRRIHEAGANVVVADTDDAAAQTVASELTRKRAGSALAIHVDVSQTSDVQDLMSATADGFGSVDILVNNAGIFPAKTIHDMTIEDFQKVLAINLQGVFLCTKYASEQMILQGKGGKIINITSIDALHPSMVGLSHYDASKHGMWGFTKNAALELAEHKIWVNAIAPGGIVTPGAAAMQKTASDRQGVDVDAFLSKIPMHRMGEPDEIGKVALFLASELSSYMTGSQVVVDGGALLA

Samples

Sample ID Description Type Environment
1 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
2 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
61 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
66 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
69 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
70 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
71 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
78 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
79 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
80 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
87 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
88 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
153 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.42
Nodule 0
Rhizoplane 1.25
Rhizosphere 91.67
Stem 0
Stem Tuber 0
Unclassified 1.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002736 3300001915 Bacteria 4465
2 JGI24741J21665_1005228 3300001915 Bacteria 2749
3 JGI24742J22300_10000148 3300002244 Bacteria 10462
4 Ga0070658_10009361 3300005327 Bacteria 7871
5 Ga0070658_10339499 3300005327 Bacteria 1285
6 Ga0070676_10003533 3300005328 Bacteria 8174
7 Ga0070683_100000361 3300005329 Bacteria 31452
8 Ga0070680_100013686 3300005336 Archaea 6326
9 Ga0070680_100017504 3300005336 Bacteria 5652
10 Ga0070661_100290060 3300005344 Bacteria 1271
11 Ga0070667_100006593 3300005367 Bacteria 9652
12 Ga0070714_100404415 3300005435 Bacteria 1291
13 Ga0070710_10004602 3300005437 Bacteria 6521
14 Ga0070694_100001337 3300005444 Archaea 14370
15 Ga0070707_100080728 3300005468 Unclassified 3139
16 Ga0070698_100006992 3300005471 Archaea 12217
17 Ga0070698_100090821 3300005471 Bacteria 3037
18 Ga0070679_100083676 3300005530 Unclassified 3179
19 Ga0070679_100197588 3300005530 Bacteria 1978
20 Ga0070684_100062782 3300005535 Bacteria 3255
21 Ga0068855_100022761 3300005563 Bacteria 7509
22 Ga0068857_100081149 3300005577 Bacteria 2896
23 Ga0068856_100156870 3300005614 Bacteria 2286
24 Ga0068859_100308337 3300005617 Bacteria 1676
25 Ga0068858_100000007 3300005842 Bacteria 247001
26 Ga0068860_100000012 3300005843 Bacteria 326398
27 Ga0081455_10000556 3300005937 Bacteria 48587
28 Ga0070717_10117651 3300006028 Unclassified 2273
29 Ga0075365_10000098 3300006038 Bacteria 25561
30 Ga0075365_10316390 3300006038 Bacteria 1099
31 Ga0075362_10002289 3300006177 Bacteria 6391
32 Ga0075367_10000292 3300006178 Bacteria 17583
33 Ga0075366_10000483 3300006195 Bacteria 18432
34 Ga0075366_10021896 3300006195 Unclassified 3716
35 Ga0097620_100308343 3300006931 Bacteria 1676
36 Ga0105240_10004627 3300009093 Bacteria 20860
37 Ga0105240_10009859 3300009093 Bacteria 13483
38 Ga0105240_10117737 3300009093 Bacteria 3202
39 Ga0105245_10000001 3300009098 Bacteria 939270
40 Ga0105243_10072432 3300009148 Bacteria 2789
41 Ga0105241_10640597 3300009174 Bacteria 964
42 Ga0105248_10000617 3300009177 Bacteria 40580
43 Ga0157373_10000428 3300013100 Bacteria 33489
44 Ga0157370_10032884 3300013104 Bacteria 5061
45 Ga0163163_10021622 3300014325 Bacteria 6074
46 Ga0157380_10053188 3300014326 Unclassified 3209
47 Ga0157379_10000002 3300014968 Bacteria 179727
48 Ga0157379_10000630 3300014968 Bacteria 28429
49 Ga0157379_10006636 3300014968 Bacteria 9985
50 Ga0207692_10054365 3300025898 Bacteria 2044
51 Ga0207647_10001058 3300025904 Bacteria 21201
52 Ga0207645_10006756 3300025907 Bacteria 8194
53 Ga0207684_10010259 3300025910 Bacteria 8246
54 Ga0207684_10198141 3300025910 Unclassified 1732
55 Ga0207654_10396851 3300025911 Bacteria 958
56 Ga0207695_10061898 3300025913 Bacteria 3866
57 Ga0207695_10384827 3300025913 Bacteria 1288
58 Ga0207660_10010101 3300025917 Archaea 6115
59 Ga0207660_10027090 3300025917 Unclassified 3908
60 Ga0207649_10252535 3300025920 Bacteria 1271
61 Ga0207652_10069437 3300025921 Unclassified 3059
62 Ga0207687_10000001 3300025927 Bacteria 1130810
63 Ga0207687_10000004 3300025927 Bacteria 841177
64 Ga0207664_10226697 3300025929 Bacteria 1623
65 Ga0207661_10000565 3300025944 Bacteria 23636
66 Ga0207667_10004400 3300025949 Bacteria 17261
67 Ga0207658_10004070 3300025986 Bacteria 10210
68 Ga0207703_10000001 3300026035 Bacteria 822925
69 Ga0207702_10002377 3300026078 Bacteria 17978
70 Ga0207702_10140878 3300026078 Bacteria 2182
71 Ga0207641_10377240 3300026088 Bacteria 1357
72 Ga0207674_10134512 3300026116 Bacteria 2435
73 Ga0268264_10000424 3300028381 Bacteria 58819
74 Ga0265337_1000001 3300028556 Bacteria 140973
75 Ga0265337_1000170 3300028556 Bacteria 34006
76 Ga0265337_1000323 3300028556 Bacteria 25587
77 Ga0265337_1000930 3300028556 Bacteria 15336
78 Ga0265337_1007102 3300028556 Bacteria 4230
79 Ga0265326_10004292 3300028558 Bacteria 4580
80 Ga0265326_10006971 3300028558 Bacteria 3483
81 Ga0265326_10016753 3300028558 Bacteria 2116
82 Ga0265319_1000385 3300028563 Bacteria 31986
83 Ga0265319_1000703 3300028563 Bacteria 21858
84 Ga0265319_1000940 3300028563 Bacteria 18253
85 Ga0265334_10001992 3300028573 Bacteria 9708
86 Ga0265334_10008338 3300028573 Bacteria 4407
87 Ga0265334_10037409 3300028573 Bacteria 1913
88 Ga0265318_10002170 3300028577 Bacteria 10640
89 Ga0265318_10015695 3300028577 Bacteria 3143
90 Ga0265318_10020099 3300028577 Bacteria 2699
91 Ga0265322_10009013 3300028654 Bacteria 2901
92 Ga0265322_10017353 3300028654 Bacteria 2073
93 Ga0265322_10017976 3300028654 Unclassified 2034
94 Ga0265336_10000002 3300028666 Bacteria 830172
95 Ga0265336_10000537 3300028666 Bacteria 21711
96 Ga0265336_10000652 3300028666 Bacteria 18911
97 Ga0265338_10000001 3300028800 Bacteria 1177449
98 Ga0265338_10000482 3300028800 Bacteria 71209
99 Ga0265338_10001653 3300028800 Bacteria 35528
100 Ga0265338_10003806 3300028800 Bacteria 20971
101 Ga0265338_10004049 3300028800 Bacteria 20103
102 Ga0265338_10011429 3300028800 Bacteria 10253
103 Ga0265338_10075475 3300028800 Bacteria 2860
104 Ga0265338_10221509 3300028800 Unclassified 1413
105 Ga0265338_10319132 3300028800 Bacteria 1125
106 Ga0265324_10000345 3300029957 Bacteria 33698
107 Ga0265324_10005177 3300029957 Bacteria 5691
108 Ga0265324_10020279 3300029957 Bacteria 2389
109 Ga0265324_10077541 3300029957 Unclassified 1130
110 Ga0316183_1214775 3300030742 Bacteria 10939
111 Ga0316182_1347454 3300030745 Unclassified 3632
112 Ga0265332_10055775 3300031238 Bacteria 1694
113 Ga0265320_10011129 3300031240 Bacteria 5310
114 Ga0265320_10015825 3300031240 Bacteria 4250
115 Ga0265320_10042612 3300031240 Bacteria 2250
116 Ga0265320_10163330 3300031240 Bacteria 1002
117 Ga0265340_10000001 3300031247 Bacteria 1647668
118 Ga0265327_10003550 3300031251 Bacteria 14784
119 Ga0265327_10004606 3300031251 Bacteria 12124
120 Ga0265316_10001231 3300031344 Bacteria 27541
121 Ga0265316_10006265 3300031344 Bacteria 11402
122 Ga0265316_10046757 3300031344 Bacteria 3427
123 Ga0265316_10333905 3300031344 Bacteria 1099
124 Ga0265313_10073597 3300031595 Bacteria 1568
125 Ga0373930_0011211 3300034816 Bacteria 1616
126 Ga0373939_0088138 3300035114 Bacteria 1044
127 Ga0373953_0008197 3300035117 Bacteria 3538
128 Ga0373956_0091636 3300035119 Bacteria 1403
129 Ga0373933_0326820 3300035724 Bacteria 995
130 Ga0373937_0001326 3300036401 Bacteria 20714
131 Ga0395900_0030091 3300037418 Bacteria 5573
132 Ga0395900_0114925 3300037418 Bacteria 2762
133 Ga0395900_0261491 3300037418 Unclassified 1728
134 Ga0395898_0198988 3300037466 Bacteria 1913
135 Ga0395901_0076953 3300038443 Bacteria 3482
136 Ga0395901_0466886 3300038443 Bacteria 1289
137 Ga0439431_0003789 3300041997 Bacteria 3341
138 Ga0439445_0078164 3300042004 Bacteria 922
139 Ga0450906_002578 3300042145 Bacteria 3951
140 Ga0451577_0001015 3300042876 Bacteria 40836
141 Ga0453683_0293707 3300044673 Unclassified 1039
142 Ga0453684_0000009 3300044712 Bacteria 1139914
143 Ga0453684_0000181 3300044712 Bacteria 279183
144 Ga0451576_0744856 3300045051 Bacteria 1029
145 Ga0466958_0171960 3300045836 Bacteria 1372
146 Ga0466967_0009912 3300045976 Bacteria 7109
147 Ga0466967_0035206 3300045976 Bacteria 4259
148 Ga0466967_0166491 3300045976 Bacteria 2072
149 Ga0495592_0000014 3300046454 Bacteria 148128
150 Ga0495651_0000092 3300046462 Bacteria 66143
151 Ga0495653_0008671 3300046463 Bacteria 8336
152 Ga0495653_0065815 3300046463 Bacteria 2727
153 Ga0495653_0183891 3300046463 Bacteria 1431
154 Ga0495608_0000069 3300046511 Bacteria 77626
155 Ga0495618_0000367 3300046514 Bacteria 32598
156 Ga0495628_0000021 3300046516 Bacteria 148194
157 Ga0495628_0000456 3300046516 Bacteria 37404
158 Ga0495630_0027121 3300046517 Bacteria 4246
159 Ga0495652_0000279 3300046529 Bacteria 60365
160 Ga0495587_0000057 3300046536 Bacteria 95361
161 Ga0495645_0000019 3300046543 Bacteria 147666
162 Ga0495657_0005026 3300046675 Bacteria 10508
163 Ga0495657_0026033 3300046675 Bacteria 4147
164 Ga0495657_0030773 3300046675 Bacteria 3756
165 Ga0495599_0000151 3300046678 Bacteria 45548
166 Ga0495623_0000008 3300046679 Bacteria 128380
167 Ga0495646_0000851 3300046680 Bacteria 17283
168 Ga0495600_0023381 3300046809 Bacteria 3976
169 Ga0495604_0000055 3300047317 Bacteria 100430
170 Ga0495604_0000163 3300047317 Bacteria 59031
171 Ga0495604_0001891 3300047317 Bacteria 17007
172 Ga0495680_0044953 3300047322 Bacteria 3489
173 Ga0495680_0091264 3300047322 Bacteria 2284
174 Ga0495675_0000281 3300047444 Bacteria 36890
175 Ga0495684_0006224 3300047471 Bacteria 9273
176 Ga0495602_0000262 3300048088 Bacteria 48336
177 Ga0495602_0017733 3300048088 Bacteria 7130
178 Ga0496102_0156802 3300048905 Bacteria 2140
179 Ga0496112_0014096 3300048915 Bacteria 7401
180 Ga0496113_0034211 3300048916 Bacteria 3706
181 Ga0496121_0285126 3300048924 Bacteria 1128
182 Ga0496126_0357752 3300048929 Bacteria 1193
183 Ga0501033_0043046 3300049570 Bacteria 3364
184 Ga0501033_0119433 3300049570 Bacteria 1914
185 Ga0501034_0003872 3300049571 Bacteria 16844
186 Ga0501034_0008381 3300049571 Bacteria 10927
187 Ga0501034_0271956 3300049571 Bacteria 1635
188 Ga0501034_0413369 3300049571 Bacteria 1271
189 Ga0501036_0183583 3300049572 Bacteria 1761
190 Ga0501036_0226850 3300049572 Bacteria 1568
191 Ga0501037_0106814 3300049573 Bacteria 2017
192 Ga0501039_0199306 3300049575 Bacteria 1574
193 Ga0501040_0170608 3300049576 Bacteria 1540
194 Ga0501042_0042136 3300049578 Archaea 3249
195 Ga0501043_0114491 3300049579 Bacteria 2117
196 Ga0501046_0146654 3300049580 Bacteria 1782
197 Ga0501047_0007187 3300049581 Bacteria 10466
198 Ga0501047_0032086 3300049581 Bacteria 5069
199 Ga0501048_0062038 3300049582 Bacteria 2646
200 Ga0501048_0197641 3300049582 Bacteria 1425
201 Ga0501068_0172892 3300049584 Bacteria 1364
202 Ga0501069_0000093 3300049585 Bacteria 42772
203 Ga0501069_0030963 3300049585 Bacteria 2940
204 Ga0501070_0007100 3300049586 Bacteria 9521
205 Ga0501070_0037816 3300049586 Bacteria 4028
206 Ga0501071_0027299 3300049587 Archaea 4016
207 Ga0501071_0038591 3300049587 Bacteria 3413
208 Ga0501072_0017695 3300049588 Archaea 5481
209 Ga0501074_0263418 3300049590 Bacteria 1225
210 Ga0501075_0017976 3300049591 Archaea 5110
211 Ga0501076_0082589 3300049592 Bacteria 2579
212 Ga0501079_0072900 3300049741 Bacteria 2654
213 Ga0501080_0052749 3300049742 Bacteria 3785
214 Ga0501080_0088450 3300049742 Bacteria 2878
215 Ga0501081_0158256 3300049743 Bacteria 1631
216 Ga0501083_0023564 3300049744 Bacteria 4268
217 Ga0501083_0054859 3300049744 Bacteria 2673
218 Ga0501083_0067900 3300049744 Bacteria 2373
219 Ga0501035_0000005 3300049822 Bacteria 392980
220 Ga0501044_0005141 3300049823 Bacteria 14593
221 Ga0501044_0040609 3300049823 Bacteria 4848
222 Ga0501045_0090270 3300049824 Bacteria 2264
223 Ga0501045_0370589 3300049824 Bacteria 1066
224 nmdc:mga03683_86_c3 3300050489 Bacteria 7028
225 nmdc:mga0yw44_153920_c1 3300050492 Bacteria 1501
226 nmdc:mga0yw44_8_c1 3300050492 Bacteria 237802
227 nmdc:mga0k408_16028_c1 3300050493 Bacteria 4151
228 nmdc:mga06z11_273_c1 3300050494 Bacteria 20116
229 nmdc:mga0sz30_123174_c1 3300050516 Bacteria 1140
230 Ga0495601_0000167 3300053077 Bacteria 35185
231 Ga0495612_0001505 3300053078 Bacteria 9601
232 Ga0495595_0031440 3300053084 Bacteria 2386
233 Ga0495619_0000104 3300053085 Bacteria 63725
234 Ga0500568_0008028 3300053139 Bacteria 5123
235 Ga0501084_0008097 3300054114 Archaea 8659
236 Ga0501084_0115681 3300054114 Bacteria 2254
237 Ga0501082_0179698 3300060353 Bacteria 1840
238 Ga0530510_0001089 3300061734 Archaea 18001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0030091 Ga0395900_0030091_1488_2297 220
2 3300037466 Ga0395898_0198988 Ga0395898_0198988_646_1455 220
3 3300038443 Ga0395901_0466886 Ga0395901_0466886_415_1224 220
4 3300044673 Ga0453683_0293707 Ga0453683_0293707_343_1029 227
5 3300048905 Ga0496102_0156802 Ga0496102_0156802_111_911 229
6 3300005327 Ga0070658_10009361 Ga0070658_100093613 231
7 3300005577 Ga0068857_100081149 Ga0068857_1000811493 231
8 3300026116 Ga0207674_10134512 Ga0207674_101345121 231
9 3300036401 Ga0373937_0001326 Ga0373937_0001326_19620_20438 232
10 3300046454 Ga0495592_0000014 Ga0495592_0000014_72280_73098 232
11 3300046462 Ga0495651_0000092 Ga0495651_0000092_20314_21132 232
12 3300046463 Ga0495653_0008671 Ga0495653_0008671_2889_3707 232
13 3300046511 Ga0495608_0000069 Ga0495608_0000069_51985_52803 232
14 3300046514 Ga0495618_0000367 Ga0495618_0000367_16507_17325 232
15 3300046516 Ga0495628_0000021 Ga0495628_0000021_75017_75835 232
16 3300046529 Ga0495652_0000279 Ga0495652_0000279_12351_13169 232
17 3300046536 Ga0495587_0000057 Ga0495587_0000057_81055_81873 232
18 3300046543 Ga0495645_0000019 Ga0495645_0000019_75035_75853 232
19 3300046675 Ga0495657_0005026 Ga0495657_0005026_6201_7019 232
20 3300046678 Ga0495599_0000151 Ga0495599_0000151_44537_45355 232
21 3300046679 Ga0495623_0000008 Ga0495623_0000008_52541_53359 232
22 3300046680 Ga0495646_0000851 Ga0495646_0000851_3574_4392 232
23 3300046809 Ga0495600_0023381 Ga0495600_0023381_2253_3071 232
24 3300047317 Ga0495604_0001891 Ga0495604_0001891_13617_14435 232
25 3300047322 Ga0495680_0044953 Ga0495680_0044953_605_1423 232
26 3300047444 Ga0495675_0000281 Ga0495675_0000281_1015_1833 232
27 3300048088 Ga0495602_0000262 Ga0495602_0000262_194_1012 232
28 3300053077 Ga0495601_0000167 Ga0495601_0000167_31176_31994 232
29 3300053084 Ga0495595_0031440 Ga0495595_0031440_530_1348 232
30 3300053085 Ga0495619_0000104 Ga0495619_0000104_29152_29970 232
31 3300005437 Ga0070710_10004602 Ga0070710_100046022 236
32 3300025898 Ga0207692_10054365 Ga0207692_100543652 236
33 3300049571 Ga0501034_0271956 Ga0501034_0271956_99_896 237
34 3300049571 Ga0501034_0413369 Ga0501034_0413369_100_900 237
35 3300049579 Ga0501043_0114491 Ga0501043_0114491_767_1564 237
36 3300049581 Ga0501047_0032086 Ga0501047_0032086_1146_1943 237
37 3300049585 Ga0501069_0030963 Ga0501069_0030963_148_945 237
38 3300049587 Ga0501071_0038591 Ga0501071_0038591_1537_2334 237
39 3300049741 Ga0501079_0072900 Ga0501079_0072900_204_1001 237
40 3300049742 Ga0501080_0052749 Ga0501080_0052749_1298_2095 237
41 3300049744 Ga0501083_0054859 Ga0501083_0054859_990_1787 237
42 3300049823 Ga0501044_0005141 Ga0501044_0005141_13689_14486 237
43 3300002244 JGI24742J22300_10000148 JGI24742J22300_100001482 238
44 3300005328 Ga0070676_10003533 Ga0070676_100035333 238
45 3300025907 Ga0207645_10006756 Ga0207645_100067566 238
46 3300014968 Ga0157379_10000630 Ga0157379_1000063030 239
47 3300049585 Ga0501069_0000093 Ga0501069_0000093_29128_29928 239
48 3300049586 Ga0501070_0007100 Ga0501070_0007100_1947_2747 239
49 3300049742 Ga0501080_0088450 Ga0501080_0088450_835_1635 239
50 3300005336 Ga0070680_100017504 Ga0070680_1000175046 243
51 3300005530 Ga0070679_100083676 Ga0070679_1000836765 243
52 3300025917 Ga0207660_10027090 Ga0207660_100270904 243
53 3300025921 Ga0207652_10069437 Ga0207652_100694372 243
54 3300029957 Ga0265324_10000345 Ga0265324_1000034526 248
55 3300035117 Ga0373953_0008197 Ga0373953_0008197_476_1318 249
56 3300035119 Ga0373956_0091636 Ga0373956_0091636_520_1362 249
57 3300035724 Ga0373933_0326820 Ga0373933_0326820_22_864 249
58 3300005563 Ga0068855_100022761 Ga0068855_1000227613 250
59 3300025949 Ga0207667_10004400 Ga0207667_1000440013 250
60 3300046463 Ga0495653_0065815 Ga0495653_0065815_1935_2699 252
61 3300050492 nmdc:mga0yw44_153920_c1 nmdc:mga0yw44_153920_c1_120_884 252
62 3300005937 Ga0081455_10000556 Ga0081455_100005568 253
63 3300005843 Ga0068860_100000012 Ga0068860_100000012128 254
64 3300006038 Ga0075365_10316390 Ga0075365_103163901 254
65 3300028381 Ga0268264_10000424 Ga0268264_1000042423 254
66 3300048915 Ga0496112_0014096 Ga0496112_0014096_2084_2878 256
67 3300048916 Ga0496113_0034211 Ga0496113_0034211_1482_2276 256
68 3300048924 Ga0496121_0285126 Ga0496121_0285126_114_905 256
69 3300053078 Ga0495612_0001505 Ga0495612_0001505_4553_5347 256
70 3300046463 Ga0495653_0183891 Ga0495653_0183891_104_901 257
71 3300046516 Ga0495628_0000456 Ga0495628_0000456_10055_10855 257
72 3300046517 Ga0495630_0027121 Ga0495630_0027121_3264_4061 257
73 3300046675 Ga0495657_0026033 Ga0495657_0026033_3264_4061 257
74 3300046675 Ga0495657_0030773 Ga0495657_0030773_225_1025 257
75 3300047317 Ga0495604_0000055 Ga0495604_0000055_80053_80889 257
76 3300047317 Ga0495604_0000163 Ga0495604_0000163_21095_21895 257
77 3300047322 Ga0495680_0091264 Ga0495680_0091264_1217_2017 257
78 3300047471 Ga0495684_0006224 Ga0495684_0006224_3792_4574 257
79 3300048088 Ga0495602_0017733 Ga0495602_0017733_811_1611 257
80 3300048929 Ga0496126_0357752 Ga0496126_0357752_19_819 257
81 3300049572 Ga0501036_0226850 Ga0501036_0226850_177_974 257
82 3300049586 Ga0501070_0037816 Ga0501070_0037816_2862_3662 257
83 3300005471 Ga0070698_100090821 Ga0070698_1000908212 258
84 3300028556 Ga0265337_1000930 Ga0265337_10009308 258
85 3300028558 Ga0265326_10006971 Ga0265326_100069711 258
86 3300028563 Ga0265319_1000940 Ga0265319_10009405 258
87 3300028577 Ga0265318_10015695 Ga0265318_100156953 258
88 3300028654 Ga0265322_10009013 Ga0265322_100090132 258
89 3300028666 Ga0265336_10000002 Ga0265336_10000002192 258
90 3300028800 Ga0265338_10000001 Ga0265338_10000001621 258
91 3300029957 Ga0265324_10020279 Ga0265324_100202793 258
92 3300031240 Ga0265320_10042612 Ga0265320_100426123 258
93 3300031247 Ga0265340_10000001 Ga0265340_10000001620 258
94 3300031251 Ga0265327_10003550 Ga0265327_1000355012 258
95 3300031344 Ga0265316_10006265 Ga0265316_100062654 258
96 3300037418 Ga0395900_0261491 Ga0395900_0261491_659_1450 258
97 3300005435 Ga0070714_100404415 Ga0070714_1004044152 260
98 3300006177 Ga0075362_10002289 Ga0075362_100022894 260
99 3300025929 Ga0207664_10226697 Ga0207664_102266972 260
100 3300045051 Ga0451576_0744856 Ga0451576_0744856_191_976 260
101 3300050489 nmdc:mga03683_86_c3 nmdc:mga03683_86_c3_2663_3454 260
102 3300005367 Ga0070667_100006593 Ga0070667_1000065934 261
103 3300009093 Ga0105240_10117737 Ga0105240_101177372 261
104 3300025913 Ga0207695_10384827 Ga0207695_103848272 261
105 3300025986 Ga0207658_10004070 Ga0207658_100040708 261
106 3300042145 Ga0450906_002578 Ga0450906_002578_1993_2781 261
107 3300045836 Ga0466958_0171960 Ga0466958_0171960_192_980 261
108 3300045976 Ga0466967_0166491 Ga0466967_0166491_288_1076 261
109 3300053139 Ga0500568_0008028 Ga0500568_0008028_3021_3809 261
110 3300054114 Ga0501084_0115681 Ga0501084_0115681_938_1726 261
111 3300005468 Ga0070707_100080728 Ga0070707_1000807282 262
112 3300006028 Ga0070717_10117651 Ga0070717_101176511 262
113 3300025910 Ga0207684_10010259 Ga0207684_100102598 262
114 3300025910 Ga0207684_10198141 Ga0207684_101981412 262
115 3300028556 Ga0265337_1007102 Ga0265337_10071023 262
116 3300028558 Ga0265326_10004292 Ga0265326_100042924 262
117 3300028563 Ga0265319_1000385 Ga0265319_100038539 262
118 3300028573 Ga0265334_10037409 Ga0265334_100374092 262
119 3300028577 Ga0265318_10002170 Ga0265318_1000217011 262
120 3300028800 Ga0265338_10003806 Ga0265338_1000380616 262
121 3300031240 Ga0265320_10163330 Ga0265320_101633301 262
122 3300049744 Ga0501083_0023564 Ga0501083_0023564_1716_2504 262
123 3300005530 Ga0070679_100197588 Ga0070679_1001975885 263
124 3300005617 Ga0068859_100308337 Ga0068859_1003083373 263
125 3300006178 Ga0075367_10000292 Ga0075367_1000029221 263
126 3300006195 Ga0075366_10000483 Ga0075366_100004834 263
127 3300006931 Ga0097620_100308343 Ga0097620_1003083432 263
128 3300009093 Ga0105240_10004627 Ga0105240_100046276 263
129 3300009098 Ga0105245_10000001 Ga0105245_10000001754 263
130 3300009174 Ga0105241_10640597 Ga0105241_106405971 263
131 3300014325 Ga0163163_10021622 Ga0163163_100216227 263
132 3300014968 Ga0157379_10006636 Ga0157379_100066365 263
133 3300025911 Ga0207654_10396851 Ga0207654_103968511 263
134 3300025927 Ga0207687_10000001 Ga0207687_10000001315 263
135 3300025927 Ga0207687_10000004 Ga0207687_10000004517 263
136 3300028556 Ga0265337_1000170 Ga0265337_100017012 263
137 3300028556 Ga0265337_1000323 Ga0265337_100032314 263
138 3300028558 Ga0265326_10016753 Ga0265326_100167532 263
139 3300028563 Ga0265319_1000703 Ga0265319_10007039 263
140 3300028573 Ga0265334_10001992 Ga0265334_100019927 263
141 3300028573 Ga0265334_10008338 Ga0265334_100083382 263
142 3300028577 Ga0265318_10020099 Ga0265318_100200991 263
143 3300028654 Ga0265322_10017353 Ga0265322_100173531 263
144 3300028654 Ga0265322_10017976 Ga0265322_100179761 263
145 3300028666 Ga0265336_10000537 Ga0265336_100005376 263
146 3300028666 Ga0265336_10000652 Ga0265336_1000065216 263
147 3300028800 Ga0265338_10000482 Ga0265338_1000048269 263
148 3300028800 Ga0265338_10001653 Ga0265338_1000165314 263
149 3300028800 Ga0265338_10004049 Ga0265338_1000404910 263
150 3300028800 Ga0265338_10011429 Ga0265338_100114291 263
151 3300028800 Ga0265338_10075475 Ga0265338_100754752 263
152 3300028800 Ga0265338_10221509 Ga0265338_102215091 263
153 3300028800 Ga0265338_10319132 Ga0265338_103191322 263
154 3300029957 Ga0265324_10005177 Ga0265324_100051773 263
155 3300029957 Ga0265324_10077541 Ga0265324_100775411 263
156 3300030742 Ga0316183_1214775 Ga0316183_12147759 263
157 3300030745 Ga0316182_1347454 Ga0316182_13474542 263
158 3300031238 Ga0265332_10055775 Ga0265332_100557751 263
159 3300031240 Ga0265320_10011129 Ga0265320_100111293 263
160 3300031251 Ga0265327_10004606 Ga0265327_100046069 263
161 3300031344 Ga0265316_10001231 Ga0265316_100012312 263
162 3300031344 Ga0265316_10046757 Ga0265316_100467572 263
163 3300031344 Ga0265316_10333905 Ga0265316_103339051 263
164 3300031595 Ga0265313_10073597 Ga0265313_100735972 263
165 3300034816 Ga0373930_0011211 Ga0373930_0011211_595_1389 263
166 3300035114 Ga0373939_0088138 Ga0373939_0088138_74_868 263
167 3300044712 Ga0453684_0000181 Ga0453684_0000181_115916_116716 263
168 3300045976 Ga0466967_0035206 Ga0466967_0035206_2532_3326 263
169 3300049570 Ga0501033_0043046 Ga0501033_0043046_1305_2096 263
170 3300049570 Ga0501033_0119433 Ga0501033_0119433_795_1586 263
171 3300049571 Ga0501034_0003872 Ga0501034_0003872_369_1160 263
172 3300049571 Ga0501034_0008381 Ga0501034_0008381_4614_5405 263
173 3300049573 Ga0501037_0106814 Ga0501037_0106814_1045_1836 263
174 3300049581 Ga0501047_0007187 Ga0501047_0007187_4296_5087 263
175 3300049582 Ga0501048_0062038 Ga0501048_0062038_1078_1869 263
176 3300049744 Ga0501083_0067900 Ga0501083_0067900_1030_1821 263
177 3300049822 Ga0501035_0000005 Ga0501035_0000005_238682_239473 263
178 3300049823 Ga0501044_0040609 Ga0501044_0040609_3653_4444 263
179 3300050493 nmdc:mga0k408_16028_c1 nmdc:mga0k408_16028_c1_3310_4101 263
180 3300050494 nmdc:mga06z11_273_c1 nmdc:mga06z11_273_c1_4131_4922 263
181 3300005614 Ga0068856_100156870 Ga0068856_1001568702 264
182 3300005842 Ga0068858_100000007 Ga0068858_100000007220 264
183 3300006038 Ga0075365_10000098 Ga0075365_1000009819 264
184 3300009177 Ga0105248_10000617 Ga0105248_100006178 264
185 3300014968 Ga0157379_10000002 Ga0157379_10000002160 264
186 3300026035 Ga0207703_10000001 Ga0207703_1000000126 264
187 3300026078 Ga0207702_10140878 Ga0207702_101408783 264
188 3300042876 Ga0451577_0001015 Ga0451577_0001015_33571_34374 264
189 3300044712 Ga0453684_0000009 Ga0453684_0000009_511545_512348 264
190 3300049572 Ga0501036_0183583 Ga0501036_0183583_535_1341 264
191 3300049575 Ga0501039_0199306 Ga0501039_0199306_11_817 264
192 3300050492 nmdc:mga0yw44_8_c1 nmdc:mga0yw44_8_c1_212900_213736 264
193 3300050516 nmdc:mga0sz30_123174_c1 nmdc:mga0sz30_123174_c1_262_1098 264
194 iso_pu_bacteria 2811994874 2812332992 264
195 3300001915 JGI24741J21665_1005228 JGI24741J21665_10052281 265
196 3300005329 Ga0070683_100000361 Ga0070683_10000036133 265
197 3300005535 Ga0070684_100062782 Ga0070684_1000627821 265
198 3300009093 Ga0105240_10009859 Ga0105240_1000985918 265
199 3300009148 Ga0105243_10072432 Ga0105243_100724323 265
200 3300013100 Ga0157373_10000428 Ga0157373_1000042835 265
201 3300013104 Ga0157370_10032884 Ga0157370_100328846 265
202 3300025913 Ga0207695_10061898 Ga0207695_100618982 265
203 3300025944 Ga0207661_10000565 Ga0207661_1000056528 265
204 3300026078 Ga0207702_10002377 Ga0207702_100023779 265
205 3300026088 Ga0207641_10377240 Ga0207641_103772403 265
206 3300028556 Ga0265337_1000001 Ga0265337_100000122 265
207 3300045976 Ga0466967_0009912 Ga0466967_0009912_4406_5230 265
208 3300014326 Ga0157380_10053188 Ga0157380_100531882 266
209 3300025904 Ga0207647_10001058 Ga0207647_1000105818 266
210 3300037418 Ga0395900_0114925 Ga0395900_0114925_1506_2315 266
211 3300038443 Ga0395901_0076953 Ga0395901_0076953_2508_3317 266
212 3300041997 Ga0439431_0003789 Ga0439431_0003789_419_1228 266
213 3300042004 Ga0439445_0078164 Ga0439445_0078164_51_860 266
214 3300049824 Ga0501045_0370589 Ga0501045_0370589_78_881 266
215 iso_pu_bacteria 2891968417 2891971403 266
216 3300005327 Ga0070658_10339499 Ga0070658_103394992 267
217 3300005336 Ga0070680_100013686 Ga0070680_1000136863 267
218 3300005344 Ga0070661_100290060 Ga0070661_1002900602 267
219 3300005444 Ga0070694_100001337 Ga0070694_1000013378 267
220 3300005471 Ga0070698_100006992 Ga0070698_10000699212 267
221 3300025917 Ga0207660_10010101 Ga0207660_100101013 267
222 3300025920 Ga0207649_10252535 Ga0207649_102525351 267
223 3300049576 Ga0501040_0170608 Ga0501040_0170608_337_1143 267
224 3300049578 Ga0501042_0042136 Ga0501042_0042136_1682_2488 267
225 3300049580 Ga0501046_0146654 Ga0501046_0146654_269_1075 267
226 3300049582 Ga0501048_0197641 Ga0501048_0197641_291_1097 267
227 3300049584 Ga0501068_0172892 Ga0501068_0172892_268_1086 267
228 3300049587 Ga0501071_0027299 Ga0501071_0027299_269_1075 267
229 3300049588 Ga0501072_0017695 Ga0501072_0017695_2461_3267 267
230 3300049590 Ga0501074_0263418 Ga0501074_0263418_398_1204 267
231 3300049591 Ga0501075_0017976 Ga0501075_0017976_2331_3137 267
232 3300049592 Ga0501076_0082589 Ga0501076_0082589_1137_1943 267
233 3300049743 Ga0501081_0158256 Ga0501081_0158256_742_1548 267
234 3300049824 Ga0501045_0090270 Ga0501045_0090270_588_1394 267
235 3300054114 Ga0501084_0008097 Ga0501084_0008097_151_957 267
236 3300060353 Ga0501082_0179698 Ga0501082_0179698_502_1308 267
237 3300061734 Ga0530510_0001089 Ga0530510_0001089_3929_4735 267
238 3300001915 JGI24741J21665_1002736 JGI24741J21665_10027366 268
239 3300006195 Ga0075366_10021896 Ga0075366_100218965 268
240 3300031240 Ga0265320_10015825 Ga0265320_100158253 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

27

224

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

33

275

0.89

PF08659

KR

KR domain

27

177

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d1y-assembly1.cif.gz_B crystal structure of tt0321 from thermus thermophilus hb8 0.9693 10 268
2d1y-assembly1.cif.gz_C crystal structure of tt0321 from thermus thermophilus hb8 0.9679 13 268
4rzh-assembly1.cif.gz_B crystal structure of fabg from synechocystis sp. pcc 6803 0.9677 14 265
3edm-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9674 13 260
2d1y-assembly1.cif.gz_A crystal structure of tt0321 from thermus thermophilus hb8 0.967 13 268
ID Description Score Start End Superfamily
2d1yC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9679 13 268 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9643 15 267 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9639 12 268 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9614 9 268 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9599 12 191 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A523QGL2-F1-model_v4 SDR family oxidoreductase 0.9777 11 204 GO:0016616
AF-A0A7C4SBD1-F1-model_v4 SDR family oxidoreductase 0.9771 11 196 GO:0016616
GO:0030497
AF-A0A0F9CCH8-F1-model_v4 Uncharacterized protein 0.9765 11 204 GO:0016491
AF-A0A0S7ZNZ1-F1-model_v4 3-oxoacyl-ACP reductase 0.9752 11 260 GO:0006633
GO:0016616
GO:0048038
AF-A0A2V9RAL4-F1-model_v4 Short-chain dehydrogenase 0.9746 11 268

Feature Viewer

pLDDT pTM Quality
93.75 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map