F352517

General Info

Members Datasets Scaffolds Average Seq Length
240 166 480 103

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10002837|Ga0070658_1000283718
Length 118
Sequence VIRVVLPAHLKNLAHVTGEVTLEVTGPEDAADDACGAGASQRLTAGQVTQRQVLDVLEARYPMLLGTIRDRHSGKRRAFVRFYACEEDLSNESPDSPLPQEVCSGKEPYIILGAMAGG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
159 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
162 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
163 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
164 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
165 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
166 2996221748 Micromonospora veneta CAP181 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.42
Metatranscriptomes 2.08
Isolates 2.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0
Rhizoplane 12.08
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10002837 3300005327 Bacteria 14399
2 Ga0058859_11686586 3300004798 Bacteria 688
3 Ga0070683_100142973 3300005329 Bacteria 2266
4 Ga0070683_101510987 3300005329 Bacteria 645
5 Ga0070680_100399839 3300005336 Bacteria 1171
6 Ga0070682_101075467 3300005337 Bacteria 672
7 Ga0068868_100765133 3300005338 Bacteria 869
8 Ga0070661_100748337 3300005344 Bacteria 799
9 Ga0070671_102035115 3300005355 Bacteria 511
10 Ga0070659_100015803 3300005366 Bacteria 5658
11 Ga0070709_10084535 3300005434 Bacteria 2079
12 Ga0070714_100028197 3300005435 Bacteria 4656
13 Ga0070713_100248140 3300005436 Bacteria 1623
14 Ga0070713_100265936 3300005436 Bacteria 1569
15 Ga0070713_100296380 3300005436 Bacteria 1488
16 Ga0070713_102257812 3300005436 Bacteria 527
17 Ga0070711_100692083 3300005439 Bacteria 858
18 Ga0070681_10075727 3300005458 Bacteria 3325
19 Ga0070681_10956969 3300005458 Bacteria 775
20 Ga0070681_11178719 3300005458 Bacteria 688
21 Ga0068867_101880861 3300005459 Bacteria 564
22 Ga0070685_10588826 3300005466 Bacteria 799
23 Ga0070706_100000022 3300005467 Bacteria 160479
24 Ga0070707_100000036 3300005468 Bacteria 116282
25 Ga0070699_100000186 3300005518 Bacteria 60505
26 Ga0070679_100052259 3300005530 Bacteria 4071
27 Ga0070684_100214364 3300005535 Bacteria 1755
28 Ga0070684_100608162 3300005535 Bacteria 1016
29 Ga0070684_100971882 3300005535 Bacteria 797
30 Ga0070665_100954645 3300005548 Bacteria 870
31 Ga0068855_100627466 3300005563 Bacteria 1157
32 Ga0070664_100089467 3300005564 Bacteria 2664
33 Ga0070664_100233084 3300005564 Bacteria 1651
34 Ga0068857_100300866 3300005577 Bacteria 1479
35 Ga0068856_100740743 3300005614 Bacteria 1003
36 Ga0068856_102382560 3300005614 Bacteria 537
37 Ga0070702_101150127 3300005615 Bacteria 623
38 Ga0068852_100350640 3300005616 Bacteria 1441
39 Ga0068859_101414967 3300005617 Bacteria 767
40 Ga0068864_100001227 3300005618 Bacteria 21309
41 Ga0068864_100448183 3300005618 Bacteria 1234
42 Ga0068864_100514803 3300005618 Bacteria 1153
43 Ga0068863_100010885 3300005841 Bacteria 8820
44 Ga0068863_101296346 3300005841 Bacteria 735
45 Ga0068858_101590640 3300005842 Bacteria 645
46 Ga0068858_102541303 3300005842 Bacteria 506
47 Ga0068860_102526769 3300005843 Bacteria 533
48 Ga0081455_10001674 3300005937 Bacteria 26876
49 Ga0081540_1004080 3300005983 Bacteria 11305
50 Ga0081540_1059515 3300005983 Bacteria 1833
51 Ga0081539_10003884 3300005985 Bacteria 17441
52 Ga0081539_10026682 3300005985 Bacteria 3678
53 Ga0081539_10027453 3300005985 Bacteria 3606
54 Ga0075368_10263227 3300006042 Bacteria 739
55 Ga0070715_10850494 3300006163 Bacteria 558
56 Ga0070716_100000038 3300006173 Bacteria 52024
57 Ga0097621_102020277 3300006237 Unclassified 551
58 Ga0068871_101206082 3300006358 Bacteria 710
59 Ga0075428_100009297 3300006844 Bacteria 10897
60 Ga0075430_100049805 3300006846 Bacteria 3534
61 Ga0075430_100074539 3300006846 Bacteria 2845
62 Ga0075431_100060431 3300006847 Bacteria 3910
63 Ga0075431_100531500 3300006847 Bacteria 1165
64 Ga0075429_100024561 3300006880 Bacteria 5229
65 Ga0075429_100052837 3300006880 Bacteria 3534
66 Ga0075429_101107651 3300006880 Bacteria 691
67 Ga0075436_100259482 3300006914 Bacteria 1239
68 Ga0099795_10347701 3300007788 Bacteria 662
69 Ga0105245_11095188 3300009098 Bacteria 843
70 Ga0105245_12421723 3300009098 Bacteria 578
71 Ga0114129_10007647 3300009147 Bacteria 15384
72 Ga0114129_10077276 3300009147 Bacteria 4631
73 Ga0114129_11286560 3300009147 Bacteria 907
74 Ga0105241_11326446 3300009174 Bacteria 686
75 Ga0105242_10781725 3300009176 Bacteria 943
76 Ga0105248_10035489 3300009177 Bacteria 5578
77 Ga0105248_10195112 3300009177 Bacteria 2281
78 Ga0105237_10502477 3300009545 Bacteria 1219
79 Ga0105238_10585224 3300009551 Bacteria 1123
80 Ga0105249_11066603 3300009553 Bacteria 878
81 Ga0105249_11827824 3300009553 Bacteria 680
82 Ga0105239_10709706 3300010375 Bacteria 1150
83 Ga0105246_11514748 3300011119 Bacteria 630
84 Ga0157369_10239924 3300013105 Bacteria 1893
85 Ga0157374_12693518 3300013296 Bacteria 525
86 Ga0163162_10157008 3300013306 Unclassified 2395
87 Ga0157372_10208048 3300013307 Bacteria 2267
88 Ga0157372_10291401 3300013307 Bacteria 1898
89 Ga0157375_10053506 3300013308 Bacteria 3972
90 Ga0157375_12798408 3300013308 Bacteria 583
91 Ga0163163_10120361 3300014325 Bacteria 2659
92 Ga0163163_11277095 3300014325 Bacteria 796
93 Ga0163163_11591542 3300014325 Bacteria 714
94 Ga0163163_12920682 3300014325 Bacteria 533
95 Ga0157379_10102874 3300014968 Bacteria 2563
96 Ga0157379_10568825 3300014968 Bacteria 1056
97 Ga0197907_10285912 3300020069 Bacteria 595
98 Ga0206352_11212051 3300020078 Bacteria 536
99 Ga0206354_10421390 3300020081 Bacteria 2052
100 Ga0206353_10227342 3300020082 Bacteria 3013
101 Ga0207699_10105355 3300025906 Bacteria 1798
102 Ga0207699_10208558 3300025906 Bacteria 1328
103 Ga0207684_10000092 3300025910 Bacteria 169174
104 Ga0207707_10179752 3300025912 Bacteria 1847
105 Ga0207693_10041184 3300025915 Bacteria 3636
106 Ga0207660_10349631 3300025917 Bacteria 1185
107 Ga0207652_10039060 3300025921 Bacteria 4027
108 Ga0207646_10000013 3300025922 Bacteria 364371
109 Ga0207700_10180353 3300025928 Bacteria 1768
110 Ga0207700_10193662 3300025928 Bacteria 1709
111 Ga0207700_10262499 3300025928 Bacteria 1479
112 Ga0207664_10002892 3300025929 Bacteria 11415
113 Ga0207664_11170960 3300025929 Bacteria 686
114 Ga0207644_10898400 3300025931 Bacteria 742
115 Ga0207690_10065409 3300025932 Bacteria 2487
116 Ga0207670_11757040 3300025936 Bacteria 527
117 Ga0207704_11297217 3300025938 Bacteria 622
118 Ga0207711_10104438 3300025941 Bacteria 2511
119 Ga0207711_10118099 3300025941 Bacteria 2366
120 Ga0207661_10002884 3300025944 Bacteria 11893
121 Ga0207679_10025494 3300025945 Bacteria 4068
122 Ga0207679_10069033 3300025945 Bacteria 2658
123 Ga0207667_10826104 3300025949 Bacteria 922
124 Ga0207712_10488226 3300025961 Bacteria 1051
125 Ga0207712_11038406 3300025961 Bacteria 728
126 Ga0207640_12023150 3300025981 Bacteria 522
127 Ga0207658_11804672 3300025986 Unclassified 558
128 Ga0207703_12040727 3300026035 Bacteria 550
129 Ga0207702_10851038 3300026078 Bacteria 903
130 Ga0207641_10202877 3300026088 Bacteria 1829
131 Ga0207641_10952265 3300026088 Bacteria 854
132 Ga0207676_10180594 3300026095 Bacteria 1847
133 Ga0207676_10342558 3300026095 Bacteria 1380
134 Ga0207676_10437512 3300026095 Bacteria 1230
135 Ga0207676_10540933 3300026095 Bacteria 1111
136 Ga0207676_11386651 3300026095 Bacteria 699
137 Ga0207674_10015798 3300026116 Bacteria 8280
138 Ga0207674_10089614 3300026116 Bacteria 3069
139 Ga0207674_10397692 3300026116 Bacteria 1332
140 Ga0207698_10383018 3300026142 Bacteria 1338
141 Ga0268266_11173081 3300028379 Bacteria 743
142 Ga0307405_11577067 3300031731 Bacteria 579
143 Ga0307413_11577399 3300031824 Bacteria 582
144 Ga0307410_10551975 3300031852 Bacteria 955
145 Ga0307409_100080036 3300031995 Bacteria 2635
146 Ga0307409_100108385 3300031995 Bacteria 2323
147 Ga0307409_100763802 3300031995 Bacteria 971
148 Ga0307409_102377365 3300031995 Bacteria 559
149 Ga0307416_101701036 3300032002 Bacteria 736
150 Ga0307414_10717935 3300032004 Bacteria 906
151 Ga0307411_10278877 3300032005 Bacteria 1329
152 Ga0307411_10285036 3300032005 Bacteria 1317
153 Ga0307415_100229197 3300032126 Bacteria 1495
154 Ga0373943_0156497 3300035170 Bacteria 1238
155 Ga0373946_0204822 3300035171 Bacteria 946
156 Ga0373946_0512765 3300035171 Unclassified 616
157 Ga0373955_0072098 3300035172 Bacteria 1934
158 Ga0373942_0221614 3300035207 Bacteria 634
159 Ga0373925_0007606 3300037068 Bacteria 7893
160 Ga0395899_0021428 3300037312 Bacteria 4902
161 Ga0395900_0006613 3300037418 Bacteria 12061
162 Ga0395898_0002825 3300037466 Bacteria 19904
163 Ga0395905_0011043 3300037471 Bacteria 8741
164 Ga0466960_0013105 3300044901 Bacteria 3514
165 Ga0495653_0126873 3300046463 Bacteria 1811
166 Ga0495582_0389203 3300046473 Bacteria 804
167 Ga0495662_0065327 3300046476 Bacteria 1759
168 Ga0495618_0200058 3300046514 Bacteria 1265
169 Ga0495663_0251448 3300046525 Bacteria 628
170 Ga0495642_0471572 3300046528 Bacteria 555
171 Ga0495609_0452919 3300046538 Bacteria 510
172 Ga0495634_0314160 3300046642 Bacteria 945
173 Ga0495680_0131607 3300047322 Bacteria 1838
174 Ga0495602_0338822 3300048088 Bacteria 1088
175 Ga0496102_0160279 3300048905 Bacteria 2116
176 Ga0496102_1346203 3300048905 Bacteria 633
177 Ga0496102_1443156 3300048905 Bacteria 607
178 Ga0496104_0007312 3300048907 Bacteria 9746
179 Ga0496104_0056789 3300048907 Bacteria 3703
180 Ga0496104_1247364 3300048907 Bacteria 647
181 Ga0496105_0034377 3300048908 Bacteria 4168
182 Ga0496105_0735563 3300048908 Bacteria 754
183 Ga0496106_0390662 3300048909 Bacteria 1118
184 Ga0496106_1128935 3300048909 Bacteria 613
185 Ga0496108_0021920 3300048911 Bacteria 5251
186 Ga0496108_0118690 3300048911 Bacteria 2267
187 Ga0496109_0043043 3300048912 Bacteria 4092
188 Ga0496109_0079545 3300048912 Bacteria 3020
189 Ga0496110_0024203 3300048913 Bacteria 5172
190 Ga0496110_0180754 3300048913 Bacteria 1915
191 Ga0496110_0430768 3300048913 Bacteria 1202
192 Ga0496110_1224924 3300048913 Bacteria 659
193 Ga0496111_0075337 3300048914 Bacteria 2458
194 Ga0496111_0218092 3300048914 Bacteria 1417
195 Ga0496111_0391378 3300048914 Bacteria 1027
196 Ga0496112_0009919 3300048915 Bacteria 8615
197 Ga0496112_0027511 3300048915 Bacteria 5483
198 Ga0496112_0655349 3300048915 Bacteria 979
199 Ga0496112_0877912 3300048915 Bacteria 819
200 Ga0496113_0067804 3300048916 Bacteria 2706
201 Ga0496113_1556613 3300048916 Bacteria 509
202 Ga0496114_0001126 3300048917 Bacteria 20197
203 Ga0496114_0699231 3300048917 Bacteria 889
204 Ga0501034_0008653 3300049571 Bacteria 10736
205 Ga0501036_1183464 3300049572 Bacteria 623
206 Ga0501047_1062347 3300049581 Unclassified 623
207 Ga0501069_0009299 3300049585 Bacteria 5186
208 Ga0501070_0052380 3300049586 Bacteria 3387
209 Ga0501071_0014357 3300049587 Bacteria 5415
210 Ga0501072_0023092 3300049588 Bacteria 4829
211 Ga0501074_1151937 3300049590 Bacteria 544
212 Ga0501076_1084005 3300049592 Bacteria 660
213 Ga0501225_0166649 3300049705 Bacteria 681
214 Ga0501081_1195010 3300049743 Bacteria 576
215 Ga0501083_0003972 3300049744 Bacteria 10385
216 Ga0501045_1090379 3300049824 Bacteria 584
217 nmdc:mga04h51_288685_c1 3300050495 Bacteria 666
218 nmdc:mga05p37_118394_c1 3300050507 Bacteria 3255
219 nmdc:mga05p37_1441244_c1 3300050507 Bacteria 690
220 nmdc:mga05p37_89333_c1 3300050507 Bacteria 3797
221 nmdc:mga09592_503466_c1 3300050508 Bacteria 1043
222 nmdc:mga09592_90_c1 3300050508 Bacteria 54292
223 nmdc:mga0qj67_22_c2 3300050509 Bacteria 21020
224 nmdc:mga0qj67_244384_c1 3300050509 Bacteria 1456
225 nmdc:mga06r32_792_c1 3300050510 Bacteria 25359
226 nmdc:mga08y16_1069105_c1 3300050511 Bacteria 783
227 nmdc:mga08x19_336506_c1 3300050514 Bacteria 1052
228 nmdc:mga0a205_1374599_c1 3300050515 Bacteria 554
229 Ga0495612_0100354 3300053078 Bacteria 1232
230 Ga0495595_0290996 3300053084 Bacteria 821
231 Ga0500583_0292158 3300053092 Bacteria 798
232 Ga0500588_0009167 3300053146 Bacteria 2343
233 Ga0501082_1118516 3300060353 Bacteria 689
234 Ga0501082_1759668 3300060353 Bacteria 541
235 2832008373 2832004796 Bacteria 6538017
236 2866067350 2866065130 Bacteria 6518152
237 2867305749 2867302475 Bacteria 7087181
238 2867314957 2867312974 Bacteria 7058875
239 2867320045 2867319477 Bacteria 7069771
240 2996228343 2996221748 Bacteria 6799777
241 Ga0070658_10002837
242 Ga0058859_11686586
243 Ga0070683_100142973
244 Ga0070683_101510987
245 Ga0070680_100399839
246 Ga0070682_101075467
247 Ga0068868_100765133
248 Ga0070661_100748337
249 Ga0070671_102035115
250 Ga0070659_100015803
251 Ga0070709_10084535
252 Ga0070714_100028197
253 Ga0070713_100248140
254 Ga0070713_100265936
255 Ga0070713_100296380
256 Ga0070713_102257812
257 Ga0070711_100692083
258 Ga0070681_10075727
259 Ga0070681_10956969
260 Ga0070681_11178719
261 Ga0068867_101880861
262 Ga0070685_10588826
263 Ga0070706_100000022
264 Ga0070707_100000036
265 Ga0070699_100000186
266 Ga0070679_100052259
267 Ga0070684_100214364
268 Ga0070684_100608162
269 Ga0070684_100971882
270 Ga0070665_100954645
271 Ga0068855_100627466
272 Ga0070664_100089467
273 Ga0070664_100233084
274 Ga0068857_100300866
275 Ga0068856_100740743
276 Ga0068856_102382560
277 Ga0070702_101150127
278 Ga0068852_100350640
279 Ga0068859_101414967
280 Ga0068864_100001227
281 Ga0068864_100448183
282 Ga0068864_100514803
283 Ga0068863_100010885
284 Ga0068863_101296346
285 Ga0068858_101590640
286 Ga0068858_102541303
287 Ga0068860_102526769
288 Ga0081455_10001674
289 Ga0081540_1004080
290 Ga0081540_1059515
291 Ga0081539_10003884
292 Ga0081539_10026682
293 Ga0081539_10027453
294 Ga0075368_10263227
295 Ga0070715_10850494
296 Ga0070716_100000038
297 Ga0097621_102020277
298 Ga0068871_101206082
299 Ga0075428_100009297
300 Ga0075430_100049805
301 Ga0075430_100074539
302 Ga0075431_100060431
303 Ga0075431_100531500
304 Ga0075429_100024561
305 Ga0075429_100052837
306 Ga0075429_101107651
307 Ga0075436_100259482
308 Ga0099795_10347701
309 Ga0105245_11095188
310 Ga0105245_12421723
311 Ga0114129_10007647
312 Ga0114129_10077276
313 Ga0114129_11286560
314 Ga0105241_11326446
315 Ga0105242_10781725
316 Ga0105248_10035489
317 Ga0105248_10195112
318 Ga0105237_10502477
319 Ga0105238_10585224
320 Ga0105249_11066603
321 Ga0105249_11827824
322 Ga0105239_10709706
323 Ga0105246_11514748
324 Ga0157369_10239924
325 Ga0157374_12693518
326 Ga0163162_10157008
327 Ga0157372_10208048
328 Ga0157372_10291401
329 Ga0157375_10053506
330 Ga0157375_12798408
331 Ga0163163_10120361
332 Ga0163163_11277095
333 Ga0163163_11591542
334 Ga0163163_12920682
335 Ga0157379_10102874
336 Ga0157379_10568825
337 Ga0197907_10285912
338 Ga0206352_11212051
339 Ga0206354_10421390
340 Ga0206353_10227342
341 Ga0207699_10105355
342 Ga0207699_10208558
343 Ga0207684_10000092
344 Ga0207707_10179752
345 Ga0207693_10041184
346 Ga0207660_10349631
347 Ga0207652_10039060
348 Ga0207646_10000013
349 Ga0207700_10180353
350 Ga0207700_10193662
351 Ga0207700_10262499
352 Ga0207664_10002892
353 Ga0207664_11170960
354 Ga0207644_10898400
355 Ga0207690_10065409
356 Ga0207670_11757040
357 Ga0207704_11297217
358 Ga0207711_10104438
359 Ga0207711_10118099
360 Ga0207661_10002884
361 Ga0207679_10025494
362 Ga0207679_10069033
363 Ga0207667_10826104
364 Ga0207712_10488226
365 Ga0207712_11038406
366 Ga0207640_12023150
367 Ga0207658_11804672
368 Ga0207703_12040727
369 Ga0207702_10851038
370 Ga0207641_10202877
371 Ga0207641_10952265
372 Ga0207676_10180594
373 Ga0207676_10342558
374 Ga0207676_10437512
375 Ga0207676_10540933
376 Ga0207676_11386651
377 Ga0207674_10015798
378 Ga0207674_10089614
379 Ga0207674_10397692
380 Ga0207698_10383018
381 Ga0268266_11173081
382 Ga0307405_11577067
383 Ga0307413_11577399
384 Ga0307410_10551975
385 Ga0307409_100080036
386 Ga0307409_100108385
387 Ga0307409_100763802
388 Ga0307409_102377365
389 Ga0307416_101701036
390 Ga0307414_10717935
391 Ga0307411_10278877
392 Ga0307411_10285036
393 Ga0307415_100229197
394 Ga0373943_0156497
395 Ga0373946_0204822
396 Ga0373946_0512765
397 Ga0373955_0072098
398 Ga0373942_0221614
399 Ga0373925_0007606
400 Ga0395899_0021428
401 Ga0395900_0006613
402 Ga0395898_0002825
403 Ga0395905_0011043
404 Ga0466960_0013105
405 Ga0495653_0126873
406 Ga0495582_0389203
407 Ga0495662_0065327
408 Ga0495618_0200058
409 Ga0495663_0251448
410 Ga0495642_0471572
411 Ga0495609_0452919
412 Ga0495634_0314160
413 Ga0495680_0131607
414 Ga0495602_0338822
415 Ga0496102_0160279
416 Ga0496102_1346203
417 Ga0496102_1443156
418 Ga0496104_0007312
419 Ga0496104_0056789
420 Ga0496104_1247364
421 Ga0496105_0034377
422 Ga0496105_0735563
423 Ga0496106_0390662
424 Ga0496106_1128935
425 Ga0496108_0021920
426 Ga0496108_0118690
427 Ga0496109_0043043
428 Ga0496109_0079545
429 Ga0496110_0024203
430 Ga0496110_0180754
431 Ga0496110_0430768
432 Ga0496110_1224924
433 Ga0496111_0075337
434 Ga0496111_0218092
435 Ga0496111_0391378
436 Ga0496112_0009919
437 Ga0496112_0027511
438 Ga0496112_0655349
439 Ga0496112_0877912
440 Ga0496113_0067804
441 Ga0496113_1556613
442 Ga0496114_0001126
443 Ga0496114_0699231
444 Ga0501034_0008653
445 Ga0501036_1183464
446 Ga0501047_1062347
447 Ga0501069_0009299
448 Ga0501070_0052380
449 Ga0501071_0014357
450 Ga0501072_0023092
451 Ga0501074_1151937
452 Ga0501076_1084005
453 Ga0501225_0166649
454 Ga0501081_1195010
455 Ga0501083_0003972
456 Ga0501045_1090379
457 nmdc:mga04h51_288685_c1
458 nmdc:mga05p37_118394_c1
459 nmdc:mga05p37_1441244_c1
460 nmdc:mga05p37_89333_c1
461 nmdc:mga09592_503466_c1
462 nmdc:mga09592_90_c1
463 nmdc:mga0qj67_22_c2
464 nmdc:mga0qj67_244384_c1
465 nmdc:mga06r32_792_c1
466 nmdc:mga08y16_1069105_c1
467 nmdc:mga08x19_336506_c1
468 nmdc:mga0a205_1374599_c1
469 Ga0495612_0100354
470 Ga0495595_0290996
471 Ga0500583_0292158
472 Ga0500588_0009167
473 Ga0501082_1118516
474 Ga0501082_1759668
475 2832008373
476 2866067350
477 2867305749
478 2867314957
479 2867320045
480 2996228343

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8582 3 95
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8325 3 98
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.8234 3 93
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.815 3 95
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.8115 3 98
ID Description Score Start End Superfamily
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8583 3 95 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8234 3 93 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8151 3 95 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7978 3 93 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7831 2 93 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A535NE45-F1-model_v4 MoaD/ThiS family protein 0.9881 1 47
AF-A0A534ZY62-F1-model_v4 MoaD/ThiS family protein 0.9859 1 84
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9837 2 94
AF-A0A1G0SXB6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9808 2 86
AF-A0A3N5W3B6-F1-model_v4 MoaD/ThiS family protein 0.9806 1 67

Map