F352269

General Info

Members Datasets Scaffolds Average Seq Length
239 175 476 256

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0138965|Ga0496110_0138965_941_1852
Length 303
Sequence MATHSPILMAYPGAALLRLAKYGLEPVTVQETDQGLRFQRTPFVFRQVRMARKRKTINVPAPYLKRIWLDPSRIADRKAYLFCLPLLHNDFELRFDRAITIIVGENGIGKSTLLECIAVFAGYDEAGGGKGYSPVDHSHAIEAMAGTLSSALRAAWLPKITNGWFRAESFHSVARYLDEAALDDPLGGPPPDFLSHSHGEGFLRFFRERCQKQGIFIFDEPESALSPSRQLEFLKLMARMDAIGHCQVIMATHAPMLMAYPNATLLRMTYGLEPVTVKQTDHFRVMREFCYDPKRFVEAVFEG

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
155 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
156 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
161 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
162 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
163 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
166 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
167 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
168 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
169 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
170 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
171 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
172 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
173 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
174 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
175 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.98
Metatranscriptomes 0
Isolates 5.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.62
Nodule 4.6
Rhizoplane 7.53
Rhizosphere 71.55
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0138965 3300048913 Bacteria 2196
2 rootH1_10258955 3300003323 Bacteria 2431
3 JGI25404J52841_10022004 3300003659 Bacteria 1379
4 Ga0068869_100055453 3300005334 Bacteria 2888
5 Ga0070680_100308263 3300005336 Bacteria 1343
6 Ga0068868_100356055 3300005338 Bacteria 1255
7 Ga0070689_100185427 3300005340 Bacteria 1692
8 Ga0070689_100590731 3300005340 Bacteria 961
9 Ga0070668_100012542 3300005347 Bacteria 6312
10 Ga0070668_100064429 3300005347 Bacteria 2841
11 Ga0070668_100074694 3300005347 Bacteria 2645
12 Ga0070668_100266342 3300005347 Bacteria 1427
13 Ga0070671_100450355 3300005355 Bacteria 1104
14 Ga0070659_100571899 3300005366 Bacteria 969
15 Ga0070709_10067167 3300005434 Bacteria 2302
16 Ga0070713_100642864 3300005436 Bacteria 1010
17 Ga0070711_100679111 3300005439 Bacteria 866
18 Ga0070700_100063496 3300005441 Bacteria 2336
19 Ga0070708_100162951 3300005445 Bacteria 2078
20 Ga0070663_100247556 3300005455 Bacteria 1410
21 Ga0070662_100039779 3300005457 Bacteria 3345
22 Ga0070681_10099190 3300005458 Bacteria 2859
23 Ga0070681_10239129 3300005458 Bacteria 1729
24 Ga0070707_100663012 3300005468 Bacteria 1006
25 Ga0070679_100274895 3300005530 Bacteria 1638
26 Ga0068853_100174972 3300005539 Bacteria 1944
27 Ga0070686_100393824 3300005544 Bacteria 1052
28 Ga0070665_100023170 3300005548 Bacteria 6254
29 Ga0070665_100128366 3300005548 Bacteria 2538
30 Ga0068855_100609794 3300005563 Bacteria 1176
31 Ga0068855_100844104 3300005563 Bacteria 971
32 Ga0068854_100108475 3300005578 Bacteria 2091
33 Ga0068854_100305124 3300005578 Bacteria 1289
34 Ga0068856_100094495 3300005614 Bacteria 2976
35 Ga0070702_100031893 3300005615 Bacteria 2886
36 Ga0068852_100263486 3300005616 Bacteria 1656
37 Ga0068859_100219327 3300005617 Bacteria 1989
38 Ga0068866_10113987 3300005718 Bacteria 1513
39 Ga0068861_100167213 3300005719 Bacteria 1819
40 Ga0068861_100420331 3300005719 Bacteria 1191
41 Ga0068851_10128681 3300005834 Bacteria 1367
42 Ga0068860_100000803 3300005843 Bacteria 35288
43 Ga0068860_100209716 3300005843 Bacteria 1889
44 Ga0068862_100139806 3300005844 Bacteria 2148
45 Ga0081455_10008244 3300005937 Bacteria 10862
46 Ga0081455_10013904 3300005937 Bacteria 7912
47 Ga0081540_1002737 3300005983 Bacteria 14346
48 Ga0081540_1012216 3300005983 Bacteria 5677
49 Ga0081540_1017452 3300005983 Bacteria 4444
50 Ga0081540_1157197 3300005983 Bacteria 888
51 Ga0075365_10279063 3300006038 Bacteria 1175
52 Ga0075368_10043789 3300006042 Bacteria 1764
53 Ga0075368_10054196 3300006042 Bacteria 1597
54 Ga0075363_100233791 3300006048 Bacteria 1056
55 Ga0070716_100246478 3300006173 Bacteria 1214
56 Ga0075367_10220327 3300006178 Bacteria 1187
57 Ga0097621_100269486 3300006237 Bacteria 1496
58 Ga0075370_10201052 3300006353 Bacteria 1175
59 Ga0068865_100207681 3300006881 Bacteria 1524
60 Ga0097620_100219324 3300006931 Bacteria 1989
61 Ga0099795_10026726 3300007788 Bacteria 1947
62 Ga0099795_10116188 3300007788 Bacteria 1065
63 Ga0105250_10032314 3300009092 Bacteria 2102
64 Ga0111539_10583632 3300009094 Bacteria 1302
65 Ga0105241_10038930 3300009174 Bacteria 3585
66 Ga0105237_10010436 3300009545 Bacteria 9878
67 Ga0105237_10038042 3300009545 Bacteria 4861
68 Ga0105237_10576900 3300009545 Bacteria 1132
69 Ga0105238_10386916 3300009551 Bacteria 1391
70 Ga0105249_10311042 3300009553 Bacteria 1584
71 Ga0105249_10705735 3300009553 Bacteria 1069
72 Ga0105239_10074226 3300010375 Bacteria 3740
73 Ga0105239_10141948 3300010375 Bacteria 2677
74 Ga0105239_10303386 3300010375 Bacteria 1798
75 Ga0105239_10632505 3300010375 Bacteria 1222
76 Ga0105239_11339281 3300010375 Bacteria 826
77 Ga0105246_10269478 3300011119 Bacteria 1360
78 Ga0157370_10094046 3300013104 Bacteria 2813
79 Ga0157369_10004198 3300013105 Bacteria 17054
80 Ga0163162_10774860 3300013306 Bacteria 1078
81 Ga0157372_10239855 3300013307 Bacteria 2103
82 Ga0157375_10101505 3300013308 Bacteria 2960
83 Ga0163163_10082171 3300014325 Bacteria 3225
84 Ga0157380_10055070 3300014326 Bacteria 3157
85 Ga0157380_10169261 3300014326 Bacteria 1907
86 Ga0157379_10057357 3300014968 Bacteria 3480
87 Ga0213876_10009372 3300021384 Bacteria 5272
88 Ga0207692_10301619 3300025898 Bacteria 975
89 Ga0207642_10176272 3300025899 Bacteria 1161
90 Ga0207688_10010828 3300025901 Bacteria 4963
91 Ga0207645_10117045 3300025907 Bacteria 1728
92 Ga0207643_10274659 3300025908 Bacteria 1044
93 Ga0207705_10185527 3300025909 Bacteria 1571
94 Ga0207707_10328052 3300025912 Bacteria 1320
95 Ga0207671_10017314 3300025914 Bacteria 5560
96 Ga0207671_10364885 3300025914 Bacteria 1146
97 Ga0207693_10276385 3300025915 Bacteria 1316
98 Ga0207693_10328357 3300025915 Bacteria 1197
99 Ga0207663_10267167 3300025916 Bacteria 1266
100 Ga0207662_10114622 3300025918 Bacteria 1684
101 Ga0207652_10584843 3300025921 Bacteria 1002
102 Ga0207681_10256586 3300025923 Bacteria 1367
103 Ga0207694_10207857 3300025924 Bacteria 1594
104 Ga0207687_10271869 3300025927 Bacteria 1355
105 Ga0207706_10036722 3300025933 Bacteria 4352
106 Ga0207709_10010451 3300025935 Bacteria 5109
107 Ga0207704_10041196 3300025938 Bacteria 2706
108 Ga0207704_10118217 3300025938 Bacteria 1807
109 Ga0207665_10014216 3300025939 Bacteria 5238
110 Ga0207689_10394050 3300025942 Bacteria 1154
111 Ga0207689_10509607 3300025942 Bacteria 1008
112 Ga0207667_10318043 3300025949 Bacteria 1590
113 Ga0207712_10079333 3300025961 Bacteria 2385
114 Ga0207712_10483720 3300025961 Bacteria 1056
115 Ga0207668_10014188 3300025972 Bacteria 4929
116 Ga0207668_10032579 3300025972 Bacteria 3445
117 Ga0207668_10067255 3300025972 Bacteria 2543
118 Ga0207668_10129205 3300025972 Bacteria 1926
119 Ga0207640_10052112 3300025981 Bacteria 2664
120 Ga0207640_10128425 3300025981 Bacteria 1828
121 Ga0207640_10242083 3300025981 Bacteria 1394
122 Ga0207677_10119286 3300026023 Bacteria 1981
123 Ga0207703_10068492 3300026035 Bacteria 2924
124 Ga0207639_10277993 3300026041 Bacteria 1471
125 Ga0207678_10026319 3300026067 Bacteria 5075
126 Ga0207678_10035927 3300026067 Bacteria 4313
127 Ga0207708_10082626 3300026075 Bacteria 2470
128 Ga0207708_10431313 3300026075 Bacteria 1095
129 Ga0207641_10294084 3300026088 Bacteria 1532
130 Ga0207648_10067104 3300026089 Bacteria 3128
131 Ga0207648_10258487 3300026089 Bacteria 1553
132 Ga0207675_100060434 3300026118 Bacteria 3538
133 Ga0207675_100103911 3300026118 Bacteria 2677
134 Ga0207683_10067470 3300026121 Bacteria 3156
135 Ga0209813_10024461 3300027866 Bacteria 1728
136 Ga0268266_10051205 3300028379 Bacteria 3544
137 Ga0268266_10071337 3300028379 Bacteria 3010
138 Ga0268266_10242993 3300028379 Bacteria 1662
139 Ga0268265_10018497 3300028380 Bacteria 4830
140 Ga0268265_10064517 3300028380 Bacteria 2821
141 Ga0268264_10000022 3300028381 Bacteria 476624
142 Ga0268264_10096046 3300028381 Bacteria 2566
143 Ga0268264_10114091 3300028381 Bacteria 2371
144 Ga0307517_10000139 3300028786 Bacteria 111985
145 Ga0307515_10000307 3300028794 Bacteria 121172
146 Ga0265330_10032405 3300031235 Bacteria 2342
147 Ga0307513_10088859 3300031456 Bacteria 3157
148 Ga0265314_10018473 3300031711 Bacteria 5434
149 Ga0265342_10025787 3300031712 Bacteria 3690
150 Ga0307516_10175614 3300031730 Bacteria 1879
151 Ga0373927_0413774 3300035695 Bacteria 890
152 Ga0373947_0233097 3300035725 Bacteria 1213
153 Ga0395900_0820224 3300037418 Bacteria 857
154 Ga0395905_0001921 3300037471 Bacteria 23863
155 Ga0395905_0022474 3300037471 Bacteria 5965
156 Ga0395905_0131831 3300037471 Bacteria 2350
157 Ga0436365_0639995 3300039437 Bacteria 12450
158 Ga0436365_0799459 3300039437 Bacteria 2602
159 Ga0436360_0278544 3300039438 Bacteria 2230
160 Ga0436361_0218768 3300039447 Bacteria 2524
161 Ga0439460_0010138 3300042461 Bacteria 2404
162 Ga0466969_0003744 3300044656 Bacteria 8081
163 Ga0466966_0011842 3300044684 Bacteria 5776
164 Ga0466966_0316335 3300044684 Bacteria 938
165 Ga0466961_0002881 3300044693 Bacteria 10667
166 Ga0466963_0077765 3300044694 Bacteria 2242
167 Ga0466971_0077123 3300044719 Bacteria 1517
168 Ga0466970_0004031 3300044765 Bacteria 7210
169 Ga0466957_0003290 3300044842 Bacteria 8850
170 Ga0466957_0075014 3300044842 Bacteria 2098
171 Ga0466959_0003223 3300045049 Bacteria 10612
172 Ga0466959_0139965 3300045049 Bacteria 1711
173 Ga0466958_0007199 3300045836 Bacteria 6099
174 Ga0466967_0228026 3300045976 Bacteria 1773
175 Ga0466967_0600242 3300045976 Bacteria 1086
176 Ga0495596_0105005 3300046500 Bacteria 1097
177 Ga0495656_0057838 3300046615 Bacteria 1680
178 Ga0495668_0073366 3300046616 Bacteria 1880
179 Ga0495670_0066716 3300046691 Bacteria 1816
180 Ga0495589_0097183 3300046794 Bacteria 1427
181 Ga0495672_0023345 3300047320 Bacteria 4003
182 Ga0495686_0132602 3300047472 Bacteria 1476
183 Ga0495593_0107424 3300047673 Bacteria 1427
184 Ga0496102_0080524 3300048905 Bacteria 3000
185 Ga0496102_0145837 3300048905 Bacteria 2222
186 Ga0496104_0230099 3300048907 Bacteria 1766
187 Ga0496104_0343656 3300048907 Bacteria 1405
188 Ga0496104_0426043 3300048907 Bacteria 1239
189 Ga0496105_0244606 3300048908 Bacteria 1455
190 Ga0496106_0043608 3300048909 Bacteria 3365
191 Ga0496107_0138572 3300048910 Bacteria 1798
192 Ga0496108_0003666 3300048911 Bacteria 12323
193 Ga0496108_0052794 3300048911 Bacteria 3408
194 Ga0496109_0012217 3300048912 Bacteria 7408
195 Ga0496109_0144842 3300048912 Bacteria 2222
196 Ga0496110_0500392 3300048913 Bacteria 1106
197 Ga0496111_0052139 3300048914 Bacteria 2954
198 Ga0496112_0272297 3300048915 Bacteria 1641
199 Ga0496113_0023058 3300048916 Bacteria 4411
200 Ga0496113_0150173 3300048916 Bacteria 1837
201 Ga0496117_0106975 3300048920 Bacteria 1754
202 Ga0496117_0107643 3300048920 Bacteria 1746
203 Ga0496121_0003622 3300048924 Bacteria 21784
204 Ga0496121_0282545 3300048924 Bacteria 1134
205 Ga0496126_0039048 3300048929 Bacteria 4409
206 Ga0496126_0057744 3300048929 Bacteria 3501
207 Ga0496126_0133694 3300048929 Bacteria 2141
208 Ga0501071_0224040 3300049587 Bacteria 1416
209 nmdc:mga03n38_173482_c1 3300050490 Bacteria 1100
210 nmdc:mga00v17_156445_c1 3300050491 Bacteria 1466
211 nmdc:mga0k408_236505_c1 3300050493 Bacteria 1091
212 nmdc:mga04h51_27014_c1 3300050495 Bacteria 1780
213 nmdc:mga07m45_174284_c1 3300050496 Bacteria 1250
214 nmdc:mga0n895_207372_c1 3300050512 Bacteria 1990
215 Ga0500566_0015275 3300053094 Bacteria 4506
216 Ga0500641_0010381 3300053096 Bacteria 3364
217 Ga0500641_0047450 3300053096 Bacteria 1756
218 Ga0500572_058876 3300053111 Bacteria 1163
219 Ga0500595_001340 3300053119 Bacteria 13316
220 Ga0500642_0114186 3300053130 Unclassified 1262
221 Ga0500568_0058155 3300053139 Bacteria 1503
222 Ga0500589_015499 3300053147 Bacteria 3400
223 Ga0500604_0035298 3300053151 Bacteria 1487
224 Ga0500637_0000077 3300053178 Bacteria 35359
225 Ga0500661_000100 3300055283 Bacteria 13873
226 Ga0466962_0012050 3300061719 Bacteria 4158
227 2513627920 2513237092 Bacteria 8341956
228 2513692013 2513237101 Bacteria 7952346
229 2513892872 2513237141 Bacteria 8496279
230 2524470598 2524023210 Bacteria 9029266
231 2874609793 2874604998 Bacteria 7834745
232 2922368268 2922361189 Bacteria 7436256
233 2922388266 2922386360 Bacteria 7017218
234 8006967222 8006964411 Bacteria 8966052
235 8006993305 8006984368 Bacteria 9651211
236 8006997458 8006994254 Bacteria 8309700
237 8056674334 8056673599 Bacteria 7871253
238 8056674335 8056673599 Bacteria 7871253
239 Ga0496110_0138965
240 rootH1_10258955
241 JGI25404J52841_10022004
242 Ga0068869_100055453
243 Ga0070680_100308263
244 Ga0068868_100356055
245 Ga0070689_100185427
246 Ga0070689_100590731
247 Ga0070668_100012542
248 Ga0070668_100064429
249 Ga0070668_100074694
250 Ga0070668_100266342
251 Ga0070671_100450355
252 Ga0070659_100571899
253 Ga0070709_10067167
254 Ga0070713_100642864
255 Ga0070711_100679111
256 Ga0070700_100063496
257 Ga0070708_100162951
258 Ga0070663_100247556
259 Ga0070662_100039779
260 Ga0070681_10099190
261 Ga0070681_10239129
262 Ga0070707_100663012
263 Ga0070679_100274895
264 Ga0068853_100174972
265 Ga0070686_100393824
266 Ga0070665_100023170
267 Ga0070665_100128366
268 Ga0068855_100609794
269 Ga0068855_100844104
270 Ga0068854_100108475
271 Ga0068854_100305124
272 Ga0068856_100094495
273 Ga0070702_100031893
274 Ga0068852_100263486
275 Ga0068859_100219327
276 Ga0068866_10113987
277 Ga0068861_100167213
278 Ga0068861_100420331
279 Ga0068851_10128681
280 Ga0068860_100000803
281 Ga0068860_100209716
282 Ga0068862_100139806
283 Ga0081455_10008244
284 Ga0081455_10013904
285 Ga0081540_1002737
286 Ga0081540_1012216
287 Ga0081540_1017452
288 Ga0081540_1157197
289 Ga0075365_10279063
290 Ga0075368_10043789
291 Ga0075368_10054196
292 Ga0075363_100233791
293 Ga0070716_100246478
294 Ga0075367_10220327
295 Ga0097621_100269486
296 Ga0075370_10201052
297 Ga0068865_100207681
298 Ga0097620_100219324
299 Ga0099795_10026726
300 Ga0099795_10116188
301 Ga0105250_10032314
302 Ga0111539_10583632
303 Ga0105241_10038930
304 Ga0105237_10010436
305 Ga0105237_10038042
306 Ga0105237_10576900
307 Ga0105238_10386916
308 Ga0105249_10311042
309 Ga0105249_10705735
310 Ga0105239_10074226
311 Ga0105239_10141948
312 Ga0105239_10303386
313 Ga0105239_10632505
314 Ga0105239_11339281
315 Ga0105246_10269478
316 Ga0157370_10094046
317 Ga0157369_10004198
318 Ga0163162_10774860
319 Ga0157372_10239855
320 Ga0157375_10101505
321 Ga0163163_10082171
322 Ga0157380_10055070
323 Ga0157380_10169261
324 Ga0157379_10057357
325 Ga0213876_10009372
326 Ga0207692_10301619
327 Ga0207642_10176272
328 Ga0207688_10010828
329 Ga0207645_10117045
330 Ga0207643_10274659
331 Ga0207705_10185527
332 Ga0207707_10328052
333 Ga0207671_10017314
334 Ga0207671_10364885
335 Ga0207693_10276385
336 Ga0207693_10328357
337 Ga0207663_10267167
338 Ga0207662_10114622
339 Ga0207652_10584843
340 Ga0207681_10256586
341 Ga0207694_10207857
342 Ga0207687_10271869
343 Ga0207706_10036722
344 Ga0207709_10010451
345 Ga0207704_10041196
346 Ga0207704_10118217
347 Ga0207665_10014216
348 Ga0207689_10394050
349 Ga0207689_10509607
350 Ga0207667_10318043
351 Ga0207712_10079333
352 Ga0207712_10483720
353 Ga0207668_10014188
354 Ga0207668_10032579
355 Ga0207668_10067255
356 Ga0207668_10129205
357 Ga0207640_10052112
358 Ga0207640_10128425
359 Ga0207640_10242083
360 Ga0207677_10119286
361 Ga0207703_10068492
362 Ga0207639_10277993
363 Ga0207678_10026319
364 Ga0207678_10035927
365 Ga0207708_10082626
366 Ga0207708_10431313
367 Ga0207641_10294084
368 Ga0207648_10067104
369 Ga0207648_10258487
370 Ga0207675_100060434
371 Ga0207675_100103911
372 Ga0207683_10067470
373 Ga0209813_10024461
374 Ga0268266_10051205
375 Ga0268266_10071337
376 Ga0268266_10242993
377 Ga0268265_10018497
378 Ga0268265_10064517
379 Ga0268264_10000022
380 Ga0268264_10096046
381 Ga0268264_10114091
382 Ga0307517_10000139
383 Ga0307515_10000307
384 Ga0265330_10032405
385 Ga0307513_10088859
386 Ga0265314_10018473
387 Ga0265342_10025787
388 Ga0307516_10175614
389 Ga0373927_0413774
390 Ga0373947_0233097
391 Ga0395900_0820224
392 Ga0395905_0001921
393 Ga0395905_0022474
394 Ga0395905_0131831
395 Ga0436365_0639995
396 Ga0436365_0799459
397 Ga0436360_0278544
398 Ga0436361_0218768
399 Ga0439460_0010138
400 Ga0466969_0003744
401 Ga0466966_0011842
402 Ga0466966_0316335
403 Ga0466961_0002881
404 Ga0466963_0077765
405 Ga0466971_0077123
406 Ga0466970_0004031
407 Ga0466957_0003290
408 Ga0466957_0075014
409 Ga0466959_0003223
410 Ga0466959_0139965
411 Ga0466958_0007199
412 Ga0466967_0228026
413 Ga0466967_0600242
414 Ga0495596_0105005
415 Ga0495656_0057838
416 Ga0495668_0073366
417 Ga0495670_0066716
418 Ga0495589_0097183
419 Ga0495672_0023345
420 Ga0495686_0132602
421 Ga0495593_0107424
422 Ga0496102_0080524
423 Ga0496102_0145837
424 Ga0496104_0230099
425 Ga0496104_0343656
426 Ga0496104_0426043
427 Ga0496105_0244606
428 Ga0496106_0043608
429 Ga0496107_0138572
430 Ga0496108_0003666
431 Ga0496108_0052794
432 Ga0496109_0012217
433 Ga0496109_0144842
434 Ga0496110_0500392
435 Ga0496111_0052139
436 Ga0496112_0272297
437 Ga0496113_0023058
438 Ga0496113_0150173
439 Ga0496117_0106975
440 Ga0496117_0107643
441 Ga0496121_0003622
442 Ga0496121_0282545
443 Ga0496126_0039048
444 Ga0496126_0057744
445 Ga0496126_0133694
446 Ga0501071_0224040
447 nmdc:mga03n38_173482_c1
448 nmdc:mga00v17_156445_c1
449 nmdc:mga0k408_236505_c1
450 nmdc:mga04h51_27014_c1
451 nmdc:mga07m45_174284_c1
452 nmdc:mga0n895_207372_c1
453 Ga0500566_0015275
454 Ga0500641_0010381
455 Ga0500641_0047450
456 Ga0500572_058876
457 Ga0500595_001340
458 Ga0500642_0114186
459 Ga0500568_0058155
460 Ga0500589_015499
461 Ga0500604_0035298
462 Ga0500637_0000077
463 Ga0500661_000100
464 Ga0466962_0012050
465 2513627920
466 2513692013
467 2513892872
468 2524470598
469 2874609793
470 2922368268
471 2922388266
472 8006967222
473 8006993305
474 8006997458
475 8056674334
476 8056674335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

160

259

0.86

PF13476

AAA_23

AAA domain

84

144

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.8426 162 220
6qpq-assembly2.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7557 162 230
7jr7-assembly1.cif.gz_B cryo-em structure of abcg5/g8 in complex with fab 2e10 and 11f4 0.7407 161 226
7q2y-assembly1.cif.gz_A cryo-em structure of clamped s.cerevisiae condensin-dna complex (form ii) 0.7376 162 223
6wge-assembly1.cif.gz_B cryo-em structure of human cohesin-nipbl-dna complex without stag1 0.7198 143 231
ID Description Score Start End Superfamily
af_A0A1D6DXP2_296_452_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8479 162 203 3.40.50.300
af_A0A1D6JKA3_4_149_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7997 143 220 3.40.50.300
af_A0A1D6FZ34_1_170_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7974 162 226 3.40.50.300
af_K7L3G3_8_269_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7959 161 221 3.40.50.300
af_A0A0R0KR27_3_215_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7702 162 226 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3S2HSM6-F1-model_v4 deleted 0.9854 149 232
AF-A0A529X8Y8-F1-model_v4 ATP-binding protein 0.9754 139 232 GO:0005524
GO:0005886
GO:0006811
GO:0016887
AF-A0A2N7SGZ4-F1-model_v4 deleted 0.965 46 232
AF-A0A528AD96-F1-model_v4 ATP-binding protein 0.96 10 232 GO:0005524
GO:0005886
GO:0006302
GO:0006826
GO:0016887
AF-A0A659URS1-F1-model_v4 ATP-binding protein 0.959 31 197 GO:0005524
GO:0005886
GO:0006302
GO:0006811
GO:0016887

Map