F351989

General Info

Members Datasets Scaffolds Average Seq Length
239 180 215 256

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1001836|Ga0209025_100183612
Length 284
Sequence MATAPEFEPLSVAGHNPASQQEGGQETMTQEIILETKNLTKEFKGFTAVSDVNLRVRRGSIHALIGPNGAGKTTCFNLLTKFLEPTTGTILFNGIDITREKPAQIARRGVIRSFQISAVFPHLTVRENVRIGLQRQLGTAFQFWRSERSLDVLDARAMDLLDQVGLTEFAETVTVNLPYGRKRALEIATTLAMEPELMLLDEPTQGMGHEDVDRVTQLIKKVSAGRTILMVEHNMNVVSSIADKITVLQRGAILAEGPYAEVSKDPRVMEAYMGTADAELQGAH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2643221556 Massilia sp. Root1485 Isolate Unclassified
5 2643221570 Acidovorax sp. Root568 Isolate Unclassified
6 2643221596 Acidovorax sp. Root70 Isolate Unclassified
7 2643221609 Acidovorax sp. Root217 Isolate Unclassified
8 2643221611 Acidovorax sp. Root219 Isolate Unclassified
9 2643221652 Acidovorax sp. Root402 Isolate Unclassified
10 2643221684 Massilia sp. Root133 Isolate Unclassified
11 2721755523 Delftia sp. HK171 Isolate Unclassified
12 2738543012 Acidovorax sp. CF301 Isolate Unclassified
13 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
14 2816332133 Acidovorax radicis 2721A Isolate Unclassified
15 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
16 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
17 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
18 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
19 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
20 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
21 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
90 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
147 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
152 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
153 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
177 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
178 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
179 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
180 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.96
Metatranscriptomes 0
Isolates 10.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.06
Nodule 2.93
Rhizoplane 3.77
Rhizosphere 70.29
Stem 0
Stem Tuber 0
Unclassified 7.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2303082 2162886007 Bacteria 1884
2 JGI25151J46595_10004420 3300003187 Bacteria 7443
3 JGI25151J46595_10008171 3300003187 Bacteria 5059
4 JGI25151J46595_10009846 3300003187 Bacteria 4494
5 rootL2_10211459 3300003322 Bacteria 1160
6 Ga0055526_1004481 3300003771 Bacteria 8371
7 Ga0055526_1050991 3300003771 Bacteria 944
8 Ga0055537_1009529 3300003773 Bacteria 2132
9 Ga0055524_1003119 3300003775 Bacteria 8181
10 Ga0055534_1001872 3300003784 Bacteria 7808
11 Ga0055534_1003092 3300003784 Bacteria 5414
12 Ga0065714_10122081 3300005288 Bacteria 1330
13 Ga0065704_10073789 3300005289 Bacteria 6786
14 Ga0065704_10104407 3300005289 Bacteria 2141
15 Ga0070680_100598930 3300005336 Bacteria 946
16 Ga0070689_100350158 3300005340 Bacteria 1239
17 Ga0070689_100486726 3300005340 Bacteria 1055
18 Ga0070713_100052638 3300005436 Bacteria 3371
19 Ga0070694_100286295 3300005444 Bacteria 1258
20 Ga0070678_100315144 3300005456 Bacteria 1334
21 Ga0070678_100537833 3300005456 Bacteria 1036
22 Ga0070686_100050887 3300005544 Bacteria 2635
23 Ga0070686_100250282 3300005544 Bacteria 1294
24 Ga0070693_100005586 3300005547 Bacteria 6057
25 Ga0070665_100032288 3300005548 Bacteria 5270
26 Ga0068852_100020618 3300005616 Bacteria 5243
27 Ga0068852_100113382 3300005616 Bacteria 2469
28 Ga0068852_100243164 3300005616 Bacteria 1721
29 Ga0068859_100019359 3300005617 Bacteria 6839
30 Ga0068851_10001590 3300005834 Bacteria 9966
31 Ga0070712_100070812 3300006175 Bacteria 2493
32 Ga0075366_10029072 3300006195 Bacteria 3246
33 Ga0075366_10054579 3300006195 Bacteria 2373
34 Ga0097621_100005061 3300006237 Bacteria 9263
35 Ga0097621_100153768 3300006237 Bacteria 1974
36 Ga0068871_100039596 3300006358 Bacteria 3772
37 Ga0075428_100000657 3300006844 Bacteria 35530
38 Ga0075428_100050357 3300006844 Bacteria 4569
39 Ga0075428_100198433 3300006844 Bacteria 2170
40 Ga0075431_100004543 3300006847 Bacteria 13627
41 Ga0075429_100002859 3300006880 Bacteria 14609
42 Ga0075429_100625625 3300006880 Bacteria 943
43 Ga0068865_100231971 3300006881 Bacteria 1449
44 Ga0097620_100019361 3300006931 Bacteria 6839
45 Ga0079104_1000002 3300006946 Bacteria 514469
46 Ga0105251_10025861 3300009011 Bacteria 2996
47 Ga0105240_10164620 3300009093 Bacteria 2631
48 Ga0111539_10001999 3300009094 Bacteria 27198
49 Ga0111539_10024344 3300009094 Bacteria 7431
50 Ga0114129_10017494 3300009147 Bacteria 10207
51 Ga0105243_10003115 3300009148 Bacteria 13624
52 Ga0105243_10417691 3300009148 Bacteria 1250
53 Ga0105248_10034018 3300009177 Bacteria 5697
54 Ga0157374_10001238 3300013296 Bacteria 21798
55 Ga0163162_10460037 3300013306 Bacteria 1404
56 Ga0157380_11047419 3300014326 Bacteria 852
57 Ga0157376_10019323 3300014969 Bacteria 5248
58 Ga0207425_1005417 3300025245 Bacteria 3641
59 Ga0209565_1000232 3300025263 Bacteria 61159
60 Ga0209565_1001533 3300025263 Bacteria 9951
61 Ga0209565_1011844 3300025263 Bacteria 2105
62 Ga0209673_1018697 3300025273 Bacteria 2510
63 Ga0209675_1000090 3300025291 Bacteria 146665
64 Ga0209675_1000174 3300025291 Bacteria 74594
65 Ga0209675_1025576 3300025291 Bacteria 1485
66 Ga0209025_1000672 3300025294 Bacteria 58988
67 Ga0209025_1001836 3300025294 Bacteria 24946
68 Ga0209025_1003150 3300025294 Bacteria 16088
69 Ga0209025_1019629 3300025294 Bacteria 3747
70 Ga0209564_1000119 3300025295 Bacteria 204926
71 Ga0209564_1000145 3300025295 Bacteria 175251
72 Ga0209564_1000616 3300025295 Bacteria 54693
73 Ga0209564_1001240 3300025295 Bacteria 28664
74 Ga0209758_1001537 3300025297 Bacteria 26529
75 Ga0209050_1037095 3300025298 Bacteria 1411
76 Ga0209256_1000871 3300025299 Bacteria 37393
77 Ga0209051_1052548 3300025303 Bacteria 1345
78 Ga0209051_1061240 3300025303 Bacteria 1183
79 Ga0207713_1028062 3300025735 Bacteria 2544
80 Ga0207695_10066452 3300025913 Bacteria 3703
81 Ga0207693_10144193 3300025915 Bacteria 1873
82 Ga0207660_10159264 3300025917 Bacteria 1740
83 Ga0207700_10041741 3300025928 Bacteria 3359
84 Ga0207664_10278861 3300025929 Bacteria 1466
85 Ga0207686_10507232 3300025934 Bacteria 937
86 Ga0207709_10000015 3300025935 Bacteria 493221
87 Ga0207670_10058340 3300025936 Bacteria 2622
88 Ga0207665_10229330 3300025939 Bacteria 1364
89 Ga0207689_10033368 3300025942 Bacteria 4278
90 Ga0207667_10508390 3300025949 Bacteria 1221
91 Ga0207640_10385700 3300025981 Bacteria 1137
92 Ga0207677_10192539 3300026023 Bacteria 1614
93 Ga0207677_10595127 3300026023 Bacteria 970
94 Ga0207639_10346932 3300026041 Bacteria 1325
95 Ga0207708_10095039 3300026075 Bacteria 2302
96 Ga0207674_10593130 3300026116 Bacteria 1070
97 Ga0207683_10322499 3300026121 Bacteria 1415
98 Ga0207698_10149272 3300026142 Bacteria 2026
99 Ga0209281_1000007 3300027111 Bacteria 938265
100 Ga0209969_1000738 3300027360 Bacteria 4388
101 Ga0209967_1010454 3300027364 Bacteria 1294
102 Ga0209981_1004638 3300027378 Bacteria 1808
103 Ga0209984_1005803 3300027424 Bacteria 1496
104 Ga0209995_1000160 3300027471 Bacteria 10708
105 Ga0209968_1005349 3300027526 Bacteria 1932
106 Ga0209999_1003134 3300027543 Bacteria 2948
107 Ga0209974_10003807 3300027876 Bacteria 5407
108 Ga0207428_10001254 3300027907 Bacteria 27170
109 Ga0207428_10109580 3300027907 Bacteria 2126
110 Ga0268266_10621698 3300028379 Bacteria 1038
111 Ga0268265_10687591 3300028380 Bacteria 987
112 Ga0265332_10000001 3300031238 Bacteria 863783
113 Ga0265340_10072083 3300031247 Bacteria 1636
114 Ga0265314_10000022 3300031711 Bacteria 297299
115 Ga0307516_10021030 3300031730 Bacteria 6728
116 Ga0307412_10327756 3300031911 Bacteria 1221
117 Ga0307416_100483109 3300032002 Bacteria 1299
118 Ga0307411_10339687 3300032005 Bacteria 1220
119 Ga0373927_0066824 3300035695 Bacteria 2326
120 Ga0373925_0069285 3300037068 Bacteria 2664
121 Ga0395899_0000222 3300037312 Bacteria 78186
122 Ga0395900_0001135 3300037418 Bacteria 33640
123 Ga0395898_0001446 3300037466 Bacteria 33640
124 Ga0395905_0000252 3300037471 Bacteria 80112
125 Ga0395905_0003802 3300037471 Bacteria 15967
126 Ga0395905_0014728 3300037471 Bacteria 7456
127 Ga0395905_0106383 3300037471 Bacteria 2634
128 Ga0395901_0000848 3300038443 Bacteria 33640
129 Ga0436365_0142298 3300039437 Bacteria 2575
130 Ga0436361_0855795 3300039447 Bacteria 2521
131 Ga0451577_0001624 3300042876 Bacteria 29180
132 Ga0453683_0000034 3300044673 Bacteria 235218
133 Ga0453683_0000062 3300044673 Bacteria 179392
134 Ga0453683_0002436 3300044673 Bacteria 14413
135 Ga0453683_0037397 3300044673 Bacteria 3054
136 Ga0453683_0108682 3300044673 Bacteria 1743
137 Ga0466964_0010786 3300044706 Bacteria 3449
138 Ga0453684_0000176 3300044712 Bacteria 283097
139 Ga0453684_0001504 3300044712 Bacteria 65595
140 Ga0453684_0245774 3300044712 Bacteria 2058
141 Ga0453684_0413907 3300044712 Bacteria 1507
142 Ga0466968_0035235 3300044735 Bacteria 2093
143 Ga0466960_0152921 3300044901 Bacteria 1234
144 Ga0451576_0015534 3300045051 Bacteria 8428
145 Ga0451576_0084925 3300045051 Bacteria 3293
146 Ga0451576_0086382 3300045051 Bacteria 3263
147 Ga0495592_0001331 3300046454 Bacteria 17151
148 Ga0495605_0001125 3300046474 Bacteria 17767
149 Ga0495605_0010858 3300046474 Bacteria 5087
150 Ga0495605_0040645 3300046474 Bacteria 2320
151 Ga0495639_0032176 3300046475 Bacteria 2338
152 Ga0495585_0066301 3300046492 Bacteria 1976
153 Ga0495596_0013017 3300046500 Bacteria 3543
154 Ga0495596_0016163 3300046500 Bacteria 3105
155 Ga0495583_0000926 3300046506 Bacteria 34454
156 Ga0495606_0031105 3300046507 Bacteria 3716
157 Ga0495616_0006551 3300046513 Bacteria 7033
158 Ga0495616_0008282 3300046513 Bacteria 6169
159 Ga0495628_0005510 3300046516 Bacteria 11076
160 Ga0495632_0013398 3300046519 Bacteria 4680
161 Ga0495640_0370544 3300046533 Bacteria 882
162 Ga0495586_0033151 3300046535 Bacteria 2771
163 Ga0495609_0006898 3300046538 Bacteria 5735
164 Ga0495597_0000268 3300046542 Bacteria 47622
165 Ga0495597_0010171 3300046542 Bacteria 4609
166 Ga0495633_0043330 3300046558 Bacteria 2135
167 Ga0495667_0015443 3300046559 Bacteria 5159
168 Ga0495656_0054132 3300046615 Bacteria 1726
169 Ga0495668_0018914 3300046616 Bacteria 3978
170 Ga0495661_0047451 3300046665 Bacteria 2615
171 Ga0495669_0054124 3300046684 Bacteria 1806
172 Ga0495649_0031401 3300046694 Bacteria 2929
173 Ga0495649_0046815 3300046694 Bacteria 2354
174 Ga0495589_0022768 3300046794 Bacteria 3195
175 Ga0495660_0012014 3300046810 Bacteria 5023
176 Ga0495660_0101770 3300046810 Bacteria 1478
177 Ga0495636_0011405 3300047318 Bacteria 3517
178 Ga0495672_0033998 3300047320 Bacteria 3154
179 Ga0495683_0033270 3300047323 Bacteria 2624
180 Ga0495687_000772 3300047443 Bacteria 34667
181 Ga0495677_0004856 3300047445 Bacteria 5127
182 Ga0495679_004828 3300047446 Bacteria 6092
183 Ga0495685_028537 3300047447 Bacteria 1919
184 Ga0495673_0042055 3300047469 Bacteria 2054
185 Ga0495681_0000936 3300047470 Bacteria 22511
186 Ga0495626_0010832 3300048091 Bacteria 4843
187 Ga0495626_0034136 3300048091 Bacteria 2435
188 Ga0496100_0064859 3300048903 Bacteria 2418
189 Ga0496101_0077992 3300048904 Bacteria 2442
190 Ga0496102_0005918 3300048905 Bacteria 10413
191 Ga0496104_0005531 3300048907 Bacteria 11069
192 Ga0496104_0034865 3300048907 Bacteria 4694
193 Ga0496105_0004700 3300048908 Bacteria 10297
194 Ga0496110_0045387 3300048913 Bacteria 3841
195 Ga0496110_0481052 3300048913 Bacteria 1131
196 Ga0496111_0065536 3300048914 Bacteria 2637
197 Ga0496116_0002454 3300048919 Bacteria 19457
198 Ga0496116_0054760 3300048919 Bacteria 2625
199 Ga0496123_0040853 3300048926 Bacteria 3224
200 Ga0496125_0196457 3300048928 Bacteria 1326
201 Ga0495678_007303 3300049459 Bacteria 5746
202 Ga0501034_0000067 3300049571 Bacteria 184398
203 Ga0501283_028749 3300049779 Bacteria 924
204 nmdc:mga0k408_186568_c1 3300050493 Bacteria 1237
205 nmdc:mga0k408_25082_c1 3300050493 Bacteria 3374
206 nmdc:mga0k408_87070_c2 3300050493 Bacteria 1482
207 nmdc:mga05p37_44326_c1 3300050507 Bacteria 5473
208 nmdc:mga09592_1561_c1 3300050508 Bacteria 18441
209 nmdc:mga09592_622_c1 3300050508 Bacteria 27059
210 nmdc:mga06r32_126784_c1 3300050510 Bacteria 2522
211 nmdc:mga08y16_244837_c1 3300050511 Bacteria 1853
212 nmdc:mga08y16_3447_c1 3300050511 Bacteria 16415
213 nmdc:mga08y16_6264_c1 3300050511 Bacteria 12472
214 Ga0495601_0000453 3300053077 Bacteria 21492
215 Ga0500561_0102938 3300053137 Bacteria 857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003784 Ga0055534_1001872 Ga0055534_10018726 236
2 3300005436 Ga0070713_100052638 Ga0070713_1000526384 243
3 3300025928 Ga0207700_10041741 Ga0207700_100417414 243
4 3300025917 Ga0207660_10159264 Ga0207660_101592642 247
5 3300025929 Ga0207664_10278861 Ga0207664_102788612 247
6 3300025949 Ga0207667_10508390 Ga0207667_105083901 247
7 3300026075 Ga0207708_10095039 Ga0207708_100950392 248
8 3300028380 Ga0268265_10687591 Ga0268265_106875911 248
9 3300005336 Ga0070680_100598930 Ga0070680_1005989302 249
10 3300005340 Ga0070689_100350158 Ga0070689_1003501582 249
11 3300005340 Ga0070689_100486726 Ga0070689_1004867261 249
12 3300005444 Ga0070694_100286295 Ga0070694_1002862952 249
13 3300005544 Ga0070686_100050887 Ga0070686_1000508872 249
14 3300005544 Ga0070686_100250282 Ga0070686_1002502822 249
15 3300005547 Ga0070693_100005586 Ga0070693_1000055865 249
16 3300005548 Ga0070665_100032288 Ga0070665_1000322882 249
17 3300005616 Ga0068852_100243164 Ga0068852_1002431642 249
18 3300005617 Ga0068859_100019359 Ga0068859_1000193592 249
19 3300006195 Ga0075366_10029072 Ga0075366_100290722 249
20 3300006195 Ga0075366_10054579 Ga0075366_100545793 249
21 3300006237 Ga0097621_100005061 Ga0097621_1000050616 249
22 3300006844 Ga0075428_100000657 Ga0075428_10000065718 249
23 3300006844 Ga0075428_100050357 Ga0075428_1000503574 249
24 3300006844 Ga0075428_100198433 Ga0075428_1001984332 249
25 3300006847 Ga0075431_100004543 Ga0075431_1000045438 249
26 3300006880 Ga0075429_100002859 Ga0075429_1000028594 249
27 3300006880 Ga0075429_100625625 Ga0075429_1006256251 249
28 3300006881 Ga0068865_100231971 Ga0068865_1002319712 249
29 3300006931 Ga0097620_100019361 Ga0097620_1000193612 249
30 3300009094 Ga0111539_10001999 Ga0111539_1000199924 249
31 3300009094 Ga0111539_10024344 Ga0111539_100243443 249
32 3300009147 Ga0114129_10017494 Ga0114129_100174948 249
33 3300009148 Ga0105243_10417691 Ga0105243_104176912 249
34 3300013296 Ga0157374_10001238 Ga0157374_1000123810 249
35 3300014326 Ga0157380_11047419 Ga0157380_110474191 249
36 3300014969 Ga0157376_10019323 Ga0157376_100193233 249
37 3300025263 Ga0209565_1001533 Ga0209565_10015332 249
38 3300025934 Ga0207686_10507232 Ga0207686_105072321 249
39 3300025936 Ga0207670_10058340 Ga0207670_100583403 249
40 3300025942 Ga0207689_10033368 Ga0207689_100333684 249
41 3300026041 Ga0207639_10346932 Ga0207639_103469322 249
42 3300026116 Ga0207674_10593130 Ga0207674_105931302 249
43 3300027360 Ga0209969_1000738 Ga0209969_10007382 249
44 3300027364 Ga0209967_1010454 Ga0209967_10104542 249
45 3300027378 Ga0209981_1004638 Ga0209981_10046382 249
46 3300027424 Ga0209984_1005803 Ga0209984_10058032 249
47 3300027471 Ga0209995_1000160 Ga0209995_10001607 249
48 3300027526 Ga0209968_1005349 Ga0209968_10053492 249
49 3300027543 Ga0209999_1003134 Ga0209999_10031343 249
50 3300027876 Ga0209974_10003807 Ga0209974_100038075 249
51 3300027907 Ga0207428_10001254 Ga0207428_100012542 249
52 3300027907 Ga0207428_10109580 Ga0207428_101095801 249
53 3300028379 Ga0268266_10621698 Ga0268266_106216982 249
54 3300031911 Ga0307412_10327756 Ga0307412_103277562 249
55 3300035695 Ga0373927_0066824 Ga0373927_0066824_612_1391 249
56 3300037068 Ga0373925_0069285 Ga0373925_0069285_1401_2180 249
57 3300037471 Ga0395905_0003802 Ga0395905_0003802_4179_4946 249
58 3300039437 Ga0436365_0142298 Ga0436365_0142298_1120_1881 249
59 3300042876 Ga0451577_0001624 Ga0451577_0001624_8909_9661 249
60 3300044673 Ga0453683_0000034 Ga0453683_0000034_177792_178544 249
61 3300044673 Ga0453683_0000062 Ga0453683_0000062_39519_40271 249
62 3300044673 Ga0453683_0037397 Ga0453683_0037397_464_1216 249
63 3300044673 Ga0453683_0108682 Ga0453683_0108682_563_1315 249
64 3300044712 Ga0453684_0000176 Ga0453684_0000176_199050_199802 249
65 3300044712 Ga0453684_0001504 Ga0453684_0001504_32076_32828 249
66 3300044712 Ga0453684_0245774 Ga0453684_0245774_167_919 249
67 3300044712 Ga0453684_0413907 Ga0453684_0413907_183_935 249
68 3300045051 Ga0451576_0015534 Ga0451576_0015534_2566_3318 249
69 3300045051 Ga0451576_0084925 Ga0451576_0084925_1880_2632 249
70 3300045051 Ga0451576_0086382 Ga0451576_0086382_854_1606 249
71 3300046454 Ga0495592_0001331 Ga0495592_0001331_11111_11863 249
72 3300046516 Ga0495628_0005510 Ga0495628_0005510_8067_8819 249
73 3300046533 Ga0495640_0370544 Ga0495640_0370544_70_822 249
74 3300046535 Ga0495586_0033151 Ga0495586_0033151_746_1498 249
75 3300046559 Ga0495667_0015443 Ga0495667_0015443_2768_3520 249
76 3300049779 Ga0501283_028749 Ga0501283_028749_14_769 249
77 3300050493 nmdc:mga0k408_186568_c1 nmdc:mga0k408_186568_c1_10_768 249
78 3300050493 nmdc:mga0k408_25082_c1 nmdc:mga0k408_25082_c1_1821_2576 249
79 3300050493 nmdc:mga0k408_87070_c2 nmdc:mga0k408_87070_c2_191_946 249
80 3300050507 nmdc:mga05p37_44326_c1 nmdc:mga05p37_44326_c1_1585_2340 249
81 3300050508 nmdc:mga09592_1561_c1 nmdc:mga09592_1561_c1_15626_16384 249
82 3300050508 nmdc:mga09592_622_c1 nmdc:mga09592_622_c1_11084_11839 249
83 3300050510 nmdc:mga06r32_126784_c1 nmdc:mga06r32_126784_c1_852_1607 249
84 3300050511 nmdc:mga08y16_244837_c1 nmdc:mga08y16_244837_c1_129_884 249
85 3300050511 nmdc:mga08y16_3447_c1 nmdc:mga08y16_3447_c1_1143_1901 249
86 3300050511 nmdc:mga08y16_6264_c1 nmdc:mga08y16_6264_c1_1220_1975 249
87 3300053077 Ga0495601_0000453 Ga0495601_0000453_6942_7694 249
88 3300025297 Ga0209758_1001537 Ga0209758_10015372 250
89 3300026023 Ga0207677_10595127 Ga0207677_105951271 250
90 3300032002 Ga0307416_100483109 Ga0307416_1004831092 250
91 3300005288 Ga0065714_10122081 Ga0065714_101220812 251
92 3300005456 Ga0070678_100315144 Ga0070678_1003151442 251
93 3300013306 Ga0163162_10460037 Ga0163162_104600373 251
94 3300026121 Ga0207683_10322499 Ga0207683_103224992 251
95 3300037471 Ga0395905_0014728 Ga0395905_0014728_3927_4688 251
96 3300046475 Ga0495639_0032176 Ga0495639_0032176_1166_1921 251
97 3300048903 Ga0496100_0064859 Ga0496100_0064859_1136_1891 251
98 3300048904 Ga0496101_0077992 Ga0496101_0077992_588_1343 251
99 3300048905 Ga0496102_0005918 Ga0496102_0005918_315_1070 251
100 3300048907 Ga0496104_0034865 Ga0496104_0034865_1241_1996 251
101 3300048908 Ga0496105_0004700 Ga0496105_0004700_2411_3166 251
102 3300048913 Ga0496110_0045387 Ga0496110_0045387_1609_2364 251
103 3300048913 Ga0496110_0481052 Ga0496110_0481052_275_1030 251
104 iso_pu_bacteria 2643221556 2643801885 252
105 iso_pu_bacteria 2643221570 2643868270 252
106 iso_pu_bacteria 2643221596 2643993737 252
107 iso_pu_bacteria 2643221609 2644059843 252
108 iso_pu_bacteria 2643221611 2644074132 252
109 iso_pu_bacteria 2643221652 2644293874 252
110 iso_pu_bacteria 2643221684 2644474321 252
111 iso_pu_bacteria 2721755523 2722882328 252
112 iso_pu_bacteria 2738543012 2739241376 252
113 iso_pu_bacteria 2816332133 2816473541 252
114 iso_pu_bacteria 2839138175 2839139925 252
115 iso_pu_bacteria 2904479285 2904480488 252
116 iso_pu_bacteria 2932422444 2932424551 252
117 iso_pu_bacteria 2990710928 2990711663 252
118 iso_pu_bacteria 8047673197 8047674479 252
119 iso_pu_bacteria 8055301274 8055308070 252
120 3300046519 Ga0495632_0013398 Ga0495632_0013398_1396_2268 253
121 3300047470 Ga0495681_0000936 Ga0495681_0000936_731_1498 253
122 iso_pu_bacteria 2513237150 2513952709 253
123 3300037312 Ga0395899_0000222 Ga0395899_0000222_54490_55269 254
124 3300037418 Ga0395900_0001135 Ga0395900_0001135_22968_23747 254
125 3300037466 Ga0395898_0001446 Ga0395898_0001446_9894_10673 254
126 3300037471 Ga0395905_0000252 Ga0395905_0000252_56371_57150 254
127 3300038443 Ga0395901_0000848 Ga0395901_0000848_22968_23747 254
128 iso_pu_bacteria 2513237150 2513957051 254
129 iso_pu_bacteria 2513237165 2514042788 254
130 iso_pu_bacteria 2808606418 2809146226 254
131 iso_pu_bacteria 2834641062 2834643924 254
132 iso_pu_bacteria 2858688981 2858692311 254
133 iso_pu_bacteria 644736347 644749442 254
134 iso_pu_bacteria 8003400568 8003404879 254
135 3300003187 JGI25151J46595_10008171 JGI25151J46595_100081712 255
136 3300003771 Ga0055526_1004481 Ga0055526_10044816 255
137 3300003771 Ga0055526_1050991 Ga0055526_10509911 255
138 3300003775 Ga0055524_1003119 Ga0055524_10031193 255
139 3300005616 Ga0068852_100113382 Ga0068852_1001133823 255
140 3300006175 Ga0070712_100070812 Ga0070712_1000708122 255
141 3300025245 Ga0207425_1005417 Ga0207425_10054172 255
142 3300025263 Ga0209565_1000232 Ga0209565_10002322 255
143 3300025263 Ga0209565_1011844 Ga0209565_10118443 255
144 3300025291 Ga0209675_1000090 Ga0209675_100009045 255
145 3300025295 Ga0209564_1000119 Ga0209564_1000119210 255
146 3300025295 Ga0209564_1000145 Ga0209564_100014517 255
147 3300025295 Ga0209564_1001240 Ga0209564_100124022 255
148 3300025303 Ga0209051_1052548 Ga0209051_10525481 255
149 3300025303 Ga0209051_1061240 Ga0209051_10612401 255
150 3300025915 Ga0207693_10144193 Ga0207693_101441933 255
151 3300025981 Ga0207640_10385700 Ga0207640_103857002 255
152 3300046513 Ga0495616_0006551 Ga0495616_0006551_586_1356 255
153 3300047443 Ga0495687_000772 Ga0495687_000772_20336_21103 255
154 3300048091 Ga0495626_0034136 Ga0495626_0034136_483_1295 255
155 3300049571 Ga0501034_0000067 Ga0501034_0000067_173774_174547 255
156 2162886007 SwRhRL2b_contig_2303082 SwRhRL2b_0047.00007620 256
157 3300003187 JGI25151J46595_10004420 JGI25151J46595_100044202 256
158 3300003187 JGI25151J46595_10009846 JGI25151J46595_100098463 256
159 3300003322 rootL2_10211459 rootL2_102114591 256
160 3300003773 Ga0055537_1009529 Ga0055537_10095292 256
161 3300003784 Ga0055534_1003092 Ga0055534_10030922 256
162 3300005289 Ga0065704_10073789 Ga0065704_100737896 256
163 3300005289 Ga0065704_10104407 Ga0065704_101044072 256
164 3300005456 Ga0070678_100537833 Ga0070678_1005378332 256
165 3300005616 Ga0068852_100020618 Ga0068852_1000206182 256
166 3300005834 Ga0068851_10001590 Ga0068851_100015905 256
167 3300006237 Ga0097621_100153768 Ga0097621_1001537682 256
168 3300006358 Ga0068871_100039596 Ga0068871_1000395962 256
169 3300006946 Ga0079104_1000002 Ga0079104_1000002225 256
170 3300009011 Ga0105251_10025861 Ga0105251_100258613 256
171 3300009093 Ga0105240_10164620 Ga0105240_101646202 256
172 3300009148 Ga0105243_10003115 Ga0105243_1000311513 256
173 3300009177 Ga0105248_10034018 Ga0105248_100340183 256
174 3300025273 Ga0209673_1018697 Ga0209673_10186972 256
175 3300025291 Ga0209675_1000174 Ga0209675_100017434 256
176 3300025291 Ga0209675_1025576 Ga0209675_10255762 256
177 3300025294 Ga0209025_1000672 Ga0209025_100067245 256
178 3300025294 Ga0209025_1001836 Ga0209025_100183612 256
179 3300025294 Ga0209025_1003150 Ga0209025_10031502 256
180 3300025294 Ga0209025_1019629 Ga0209025_10196293 256
181 3300025295 Ga0209564_1000616 Ga0209564_10006161 256
182 3300025298 Ga0209050_1037095 Ga0209050_10370952 256
183 3300025299 Ga0209256_1000871 Ga0209256_100087125 256
184 3300025735 Ga0207713_1028062 Ga0207713_10280622 256
185 3300025913 Ga0207695_10066452 Ga0207695_100664523 256
186 3300025935 Ga0207709_10000015 Ga0207709_10000015220 256
187 3300025939 Ga0207665_10229330 Ga0207665_102293302 256
188 3300026023 Ga0207677_10192539 Ga0207677_101925392 256
189 3300026142 Ga0207698_10149272 Ga0207698_101492722 256
190 3300027111 Ga0209281_1000007 Ga0209281_1000007443 256
191 3300031238 Ga0265332_10000001 Ga0265332_10000001219 256
192 3300031247 Ga0265340_10072083 Ga0265340_100720832 256
193 3300031711 Ga0265314_10000022 Ga0265314_10000022224 256
194 3300031730 Ga0307516_10021030 Ga0307516_100210305 256
195 3300032005 Ga0307411_10339687 Ga0307411_103396871 256
196 3300037471 Ga0395905_0106383 Ga0395905_0106383_56_832 256
197 3300039447 Ga0436361_0855795 Ga0436361_0855795_1019_1789 256
198 3300044673 Ga0453683_0002436 Ga0453683_0002436_7124_7900 256
199 3300044706 Ga0466964_0010786 Ga0466964_0010786_469_1239 256
200 3300044735 Ga0466968_0035235 Ga0466968_0035235_314_1084 256
201 3300044901 Ga0466960_0152921 Ga0466960_0152921_89_859 256
202 3300046474 Ga0495605_0001125 Ga0495605_0001125_3977_4750 256
203 3300046474 Ga0495605_0010858 Ga0495605_0010858_601_1398 256
204 3300046474 Ga0495605_0040645 Ga0495605_0040645_589_1401 256
205 3300046492 Ga0495585_0066301 Ga0495585_0066301_241_1038 256
206 3300046500 Ga0495596_0013017 Ga0495596_0013017_1209_1982 256
207 3300046500 Ga0495596_0016163 Ga0495596_0016163_240_1052 256
208 3300046506 Ga0495583_0000926 Ga0495583_0000926_14323_15120 256
209 3300046507 Ga0495606_0031105 Ga0495606_0031105_2653_3423 256
210 3300046513 Ga0495616_0008282 Ga0495616_0008282_3492_4304 256
211 3300046538 Ga0495609_0006898 Ga0495609_0006898_1159_1932 256
212 3300046542 Ga0495597_0000268 Ga0495597_0000268_10916_11686 256
213 3300046542 Ga0495597_0010171 Ga0495597_0010171_337_1107 256
214 3300046558 Ga0495633_0043330 Ga0495633_0043330_270_1082 256
215 3300046615 Ga0495656_0054132 Ga0495656_0054132_40_813 256
216 3300046616 Ga0495668_0018914 Ga0495668_0018914_3143_3955 256
217 3300046665 Ga0495661_0047451 Ga0495661_0047451_1541_2353 256
218 3300046684 Ga0495669_0054124 Ga0495669_0054124_87_884 256
219 3300046694 Ga0495649_0031401 Ga0495649_0031401_709_1557 256
220 3300046694 Ga0495649_0046815 Ga0495649_0046815_190_963 256
221 3300046794 Ga0495589_0022768 Ga0495589_0022768_1159_1971 256
222 3300046810 Ga0495660_0012014 Ga0495660_0012014_710_1522 256
223 3300046810 Ga0495660_0101770 Ga0495660_0101770_398_1171 256
224 3300047318 Ga0495636_0011405 Ga0495636_0011405_2704_3480 256
225 3300047320 Ga0495672_0033998 Ga0495672_0033998_2321_3094 256
226 3300047323 Ga0495683_0033270 Ga0495683_0033270_445_1257 256
227 3300047445 Ga0495677_0004856 Ga0495677_0004856_1145_1951 256
228 3300047446 Ga0495679_004828 Ga0495679_004828_2226_3038 256
229 3300047447 Ga0495685_028537 Ga0495685_028537_1135_1908 256
230 3300047469 Ga0495673_0042055 Ga0495673_0042055_932_1705 256
231 3300048091 Ga0495626_0010832 Ga0495626_0010832_440_1252 256
232 3300048907 Ga0496104_0005531 Ga0496104_0005531_1945_2727 256
233 3300048914 Ga0496111_0065536 Ga0496111_0065536_1557_2339 256
234 3300048919 Ga0496116_0002454 Ga0496116_0002454_9354_10130 256
235 3300048919 Ga0496116_0054760 Ga0496116_0054760_920_1696 256
236 3300048926 Ga0496123_0040853 Ga0496123_0040853_1814_2584 256
237 3300048928 Ga0496125_0196457 Ga0496125_0196457_143_916 256
238 3300049459 Ga0495678_007303 Ga0495678_007303_1126_1938 256
239 3300053137 Ga0500561_0102938 Ga0500561_0102938_19_792 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

49

205

0.97

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

252

278

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9316 6 234
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9235 5 234
6mjp-assembly1.cif.gz_B lptb(e163q)fgc from vibrio cholerae 0.9184 5 248
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9141 6 233
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9109 4 234
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.929 6 229 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9187 5 246 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9134 4 228 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.913 2 235 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9103 6 229 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538JJF5-F1-model_v4 ABC transporter ATP-binding protein 0.9313 5 248 GO:0005524
GO:0005886
GO:0016887
AF-A0A4P7CGL7-F1-model_v4 deleted 0.9254 3 234
AF-A0A5M6I481-F1-model_v4 LPS export ABC transporter ATP-binding protein 0.925 2 248 GO:0005524
GO:0016887
GO:0043190
GO:0055085
AF-A0A3N6MLS5-F1-model_v4 ABC transporter ATP-binding protein 0.9217 4 246 GO:0005524
GO:0005886
GO:0016887
AF-A0A257UMR1-F1-model_v4 deleted 0.9209 4 247

Feature Viewer

pLDDT pTM Quality
88.06 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map