F351943

General Info

Members Datasets Scaffolds Average Seq Length
239 155 232 139

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_11333447|Ga0163162_113334471
Length 149
Sequence MTFGGFNDNKQPAPMADINVTPMVDVMLVLLVIFILAAPLFTQSIKLDLPTAQATPAQAEPTTISLSINANGELFWDQVPVTQDQMNERFVVAGKQQPQPQLELRADKGTRYEVIAQVMGAAQANGLTKLGFVTEAPAADSATKTTVKK

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2738541297 Duganella sp. GV083 Isolate Unclassified
3 2738541357 Duganella sp. GV053 Isolate Unclassified
4 2738543003 Duganella sp. GV066 Isolate Unclassified
5 2738543026 Duganella sp. GV089 Isolate Unclassified
6 2738543029 Duganella sp. GV039 Isolate Unclassified
7 2904424332 Duganella sp. 1411 Isolate Rhizosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
40 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
41 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
42 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
43 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
51 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
52 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
53 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
54 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
82 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
93 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
96 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
100 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
101 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
109 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
110 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
145 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
146 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
147 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
152 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
153 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
154 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.4
Metatranscriptomes 1.67
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.3
Nodule 1.26
Rhizoplane 6.28
Rhizosphere 73.22
Stem 0
Stem Tuber 0
Unclassified 7.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1004078 3300002738 Bacteria 2759
2 JGI25151J46595_10088659 3300003187 Bacteria 869
3 JGI25153J46596_10083052 3300003215 Bacteria 793
4 rootH1_10135833 3300003316 Bacteria 1076
5 rootL2_10100368 3300003322 Bacteria 1126
6 Ga0007409J51694_1066324 3300003575 Bacteria 1631
7 Ga0007416J51690_1064343 3300003577 Bacteria 1841
8 Ga0032354_1077203 3300003693 Bacteria 2654
9 Ga0055538_1000010 3300003751 Bacteria 376599
10 Ga0055539_1000015 3300003752 Bacteria 376599
11 Ga0055533_1000018 3300003756 Bacteria 376599
12 Ga0055525_1000020 3300003759 Bacteria 376599
13 Ga0055526_1000230 3300003771 Bacteria 46917
14 Ga0055526_1000258 3300003771 Bacteria 44725
15 Ga0055541_1000011 3300003841 Bacteria 376599
16 Ga0065704_10296094 3300005289 Bacteria 894
17 Ga0070670_100690920 3300005331 Bacteria 917
18 Ga0070661_101418346 3300005344 Bacteria 584
19 Ga0075362_10003441 3300006177 Bacteria 5531
20 Ga0079104_1013601 3300006946 Bacteria 2497
21 Ga0105244_10001359 3300009036 Bacteria 19896
22 Ga0105244_10010031 3300009036 Bacteria 5769
23 Ga0105243_11130878 3300009148 Bacteria 793
24 Ga0105241_11554070 3300009174 Bacteria 638
25 Ga0163162_11333447 3300013306 Bacteria 816
26 Ga0163162_12998577 3300013306 Bacteria 543
27 Ga0157376_10587141 3300014969 Bacteria 1107
28 Ga0182007_10066004 3300015262 Bacteria 1185
29 Ga0163161_10046143 3300017792 Bacteria 3143
30 Ga0213872_10000063 3300021361 Bacteria 97755
31 Ga0213872_10000223 3300021361 Bacteria 50255
32 Ga0213872_10002757 3300021361 Bacteria 10078
33 Ga0213872_10007501 3300021361 Bacteria 5360
34 Ga0213872_10009997 3300021361 Bacteria 4529
35 Ga0213872_10069062 3300021361 Bacteria 1594
36 Ga0209784_100025 3300025224 Bacteria 376681
37 Ga0209566_100025 3300025225 Bacteria 376681
38 Ga0209674_100042 3300025226 Bacteria 376681
39 Ga0209563_100046 3300025230 Bacteria 376681
40 Ga0209437_115718 3300025233 Bacteria 1028
41 Ga0207425_1000360 3300025245 Bacteria 31520
42 Ga0209646_1000114 3300025246 Bacteria 152958
43 Ga0209026_1002196 3300025250 Bacteria 7552
44 Ga0209677_100027 3300025253 Bacteria 376681
45 Ga0209233_1015824 3300025261 Bacteria 2091
46 Ga0209025_1003724 3300025294 Bacteria 14000
47 Ga0209564_1000006 3300025295 Bacteria 1100927
48 Ga0209564_1000026 3300025295 Bacteria 519154
49 Ga0209758_1000372 3300025297 Bacteria 78825
50 Ga0207655_1001536 3300025728 Bacteria 20891
51 Ga0207655_1004984 3300025728 Bacteria 9197
52 Ga0207649_11097566 3300025920 Bacteria 628
53 Ga0209281_1034645 3300027111 Bacteria 881
54 Ga0209281_1055604 3300027111 Bacteria 618
55 Ga0316177_1199479 3300030731 Bacteria 4852
56 Ga0316180_1100970 3300030736 Bacteria 1277
57 Ga0316181_1090622 3300030744 Bacteria 3470
58 Ga0316182_1018216 3300030745 Bacteria 776
59 Ga0316182_1406091 3300030745 Bacteria 1377
60 Ga0307408_100177572 3300031548 Bacteria 1705
61 Ga0265314_10041423 3300031711 Bacteria 3297
62 Ga0265314_10249688 3300031711 Bacteria 1019
63 Ga0307518_10027105 3300031838 Bacteria 4132
64 Ga0307406_11277607 3300031901 Bacteria 640
65 Ga0307406_11978299 3300031901 Bacteria 521
66 Ga0307412_11198160 3300031911 Bacteria 680
67 Ga0307409_101907159 3300031995 Bacteria 624
68 Ga0307416_103201130 3300032002 Bacteria 548
69 Ga0373939_0353744 3300035114 Bacteria 598
70 Ga0395899_0004059 3300037312 Bacteria 11542
71 Ga0395899_0011304 3300037312 Bacteria 6836
72 Ga0395899_0024139 3300037312 Bacteria 4599
73 Ga0395900_0020019 3300037418 Bacteria 6823
74 Ga0395900_0048814 3300037418 Bacteria 4359
75 Ga0395898_0325653 3300037466 Bacteria 1465
76 Ga0395905_0008627 3300037471 Bacteria 10041
77 Ga0395905_0015499 3300037471 Bacteria 7246
78 Ga0395905_0358027 3300037471 Bacteria 1352
79 Ga0395905_1062419 3300037471 Bacteria 713
80 Ga0395905_1507756 3300037471 Bacteria 577
81 Ga0395901_0001293 3300038443 Bacteria 26456
82 Ga0395901_0015288 3300038443 Bacteria 7809
83 Ga0395901_0263068 3300038443 Bacteria 1795
84 Ga0395901_0816632 3300038443 Bacteria 920
85 Ga0436361_0014164 3300039447 Bacteria 11920
86 Ga0436361_0118137 3300039447 Bacteria 3767
87 Ga0436361_0168473 3300039447 Bacteria 40970
88 Ga0436361_0214417 3300039447 Bacteria 1374
89 Ga0436361_0222997 3300039447 Bacteria 4642
90 Ga0436361_0285930 3300039447 Bacteria 532
91 Ga0436361_0320570 3300039447 Bacteria 2693
92 Ga0436361_0375170 3300039447 Bacteria 7026
93 Ga0436361_0811061 3300039447 Bacteria 135576
94 Ga0436361_0993682 3300039447 Bacteria 3444
95 Ga0451577_0362791 3300042876 Bacteria 1314
96 Ga0466969_0097118 3300044656 Bacteria 1390
97 Ga0466972_0209539 3300044658 Bacteria 912
98 Ga0466981_0646479 3300044669 Bacteria 555
99 Ga0466965_0144378 3300044683 Bacteria 1241
100 Ga0466965_0201641 3300044683 Bacteria 1055
101 Ga0466966_0148479 3300044684 Bacteria 1431
102 Ga0466961_0633850 3300044693 Bacteria 642
103 Ga0466971_0062094 3300044719 Bacteria 1690
104 Ga0466968_0289286 3300044735 Bacteria 786
105 Ga0466970_0002753 3300044765 Bacteria 8489
106 Ga0466970_0475974 3300044765 Bacteria 718
107 Ga0466957_0179786 3300044842 Bacteria 1381
108 Ga0466959_0046291 3300045049 Bacteria 3202
109 Ga0466959_0229567 3300045049 Bacteria 1285
110 Ga0495617_000048 3300046452 Bacteria 113357
111 Ga0495617_003612 3300046452 Bacteria 5776
112 Ga0495590_0000030 3300046457 Bacteria 146237
113 Ga0495638_0000105 3300046460 Bacteria 134384
114 Ga0495638_0064721 3300046460 Bacteria 2252
115 Ga0495638_0324031 3300046460 Bacteria 822
116 Ga0495653_0000018 3300046463 Bacteria 185787
117 Ga0495650_0000099 3300046471 Bacteria 215347
118 Ga0495650_0000212 3300046471 Bacteria 124622
119 Ga0495650_0000227 3300046471 Bacteria 114662
120 Ga0495650_0002015 3300046471 Bacteria 17807
121 Ga0495650_0016023 3300046471 Bacteria 3817
122 Ga0495585_0001802 3300046492 Bacteria 16285
123 Ga0495607_0008312 3300046501 Bacteria 7097
124 Ga0495607_0052458 3300046501 Bacteria 2362
125 Ga0495607_0251947 3300046501 Bacteria 849
126 Ga0495583_0008863 3300046506 Bacteria 6083
127 Ga0495606_0000158 3300046507 Bacteria 118616
128 Ga0495606_0000547 3300046507 Bacteria 60321
129 Ga0495606_0001026 3300046507 Bacteria 40508
130 Ga0495606_0001932 3300046507 Bacteria 25689
131 Ga0495606_0009625 3300046507 Bacteria 8142
132 Ga0495606_0026012 3300046507 Bacteria 4176
133 Ga0495610_0002677 3300046512 Bacteria 14688
134 Ga0495610_0012580 3300046512 Bacteria 5082
135 Ga0495628_0115634 3300046516 Bacteria 2060
136 Ga0495632_0111638 3300046519 Bacteria 1283
137 Ga0495637_0000057 3300046520 Bacteria 97433
138 Ga0495637_0006210 3300046520 Bacteria 6011
139 Ga0495643_0005852 3300046522 Bacteria 8224
140 Ga0495648_0000008 3300046524 Bacteria 336584
141 Ga0495648_0003617 3300046524 Bacteria 13534
142 Ga0495648_0010048 3300046524 Bacteria 7253
143 Ga0495648_0034770 3300046524 Bacteria 3275
144 Ga0495642_0004701 3300046528 Bacteria 5289
145 Ga0495642_0112385 3300046528 Bacteria 1165
146 Ga0495652_0331843 3300046529 Bacteria 1095
147 Ga0495654_0000005 3300046530 Bacteria 491381
148 Ga0495654_0012289 3300046530 Bacteria 4602
149 Ga0495598_0106689 3300046537 Bacteria 934
150 Ga0495609_0028803 3300046538 Bacteria 2532
151 Ga0495597_0003757 3300046542 Bacteria 8652
152 Ga0495645_0017467 3300046543 Bacteria 5140
153 Ga0495622_0000415 3300046557 Bacteria 28325
154 Ga0495622_0000534 3300046557 Bacteria 22878
155 Ga0495633_0000238 3300046558 Bacteria 66595
156 Ga0495633_0039399 3300046558 Bacteria 2255
157 Ga0495633_0060509 3300046558 Bacteria 1774
158 Ga0495656_0600008 3300046615 Bacteria 589
159 Ga0495668_0000482 3300046616 Bacteria 50037
160 Ga0495668_0001995 3300046616 Bacteria 17851
161 Ga0495668_0005088 3300046616 Bacteria 9045
162 Ga0495668_0014900 3300046616 Bacteria 4548
163 Ga0495625_0001573 3300046660 Bacteria 27145
164 Ga0495659_0153109 3300046664 Bacteria 927
165 Ga0495661_0005648 3300046665 Bacteria 8868
166 Ga0495588_0149204 3300046674 Bacteria 1236
167 Ga0495646_0005083 3300046680 Bacteria 8289
168 Ga0495671_0000343 3300046692 Bacteria 38705
169 Ga0495671_0046237 3300046692 Bacteria 2176
170 Ga0495671_0394714 3300046692 Bacteria 662
171 Ga0495671_0410219 3300046692 Bacteria 648
172 Ga0495660_0003276 3300046810 Bacteria 10049
173 Ga0495660_0024315 3300046810 Bacteria 3451
174 Ga0495660_0041125 3300046810 Bacteria 2561
175 Ga0495672_0000014 3300047320 Bacteria 505636
176 Ga0495683_0004583 3300047323 Bacteria 7805
177 Ga0495687_002805 3300047443 Bacteria 13446
178 Ga0495687_003597 3300047443 Bacteria 11100
179 Ga0495687_043262 3300047443 Bacteria 1963
180 Ga0495677_0023871 3300047445 Bacteria 2219
181 Ga0495679_013334 3300047446 Bacteria 3091
182 Ga0495673_0000034 3300047469 Bacteria 326920
183 Ga0495673_0000150 3300047469 Bacteria 122768
184 Ga0495686_0001141 3300047472 Bacteria 31302
185 Ga0495686_0012032 3300047472 Bacteria 6080
186 Ga0495615_0010879 3300048090 Bacteria 1833
187 Ga0496100_0115486 3300048903 Bacteria 1872
188 Ga0496101_0435514 3300048904 Bacteria 1034
189 Ga0496102_0404344 3300048905 Bacteria 1283
190 Ga0496102_0528516 3300048905 Bacteria 1102
191 Ga0496103_0019423 3300048906 Bacteria 4081
192 Ga0496105_0278445 3300048908 Bacteria 1349
193 Ga0496107_0120826 3300048910 Bacteria 1930
194 Ga0496108_0179432 3300048911 Bacteria 1833
195 Ga0496109_0038160 3300048912 Bacteria 4342
196 Ga0496110_0121818 3300048913 Bacteria 2350
197 Ga0496110_0167321 3300048913 Bacteria 1994
198 Ga0496111_0102864 3300048914 Bacteria 2100
199 Ga0496114_0035890 3300048917 Bacteria 4096
200 Ga0496114_0414813 3300048917 Bacteria 1192
201 Ga0496114_0643865 3300048917 Bacteria 933
202 Ga0496116_0029969 3300048919 Bacteria 3916
203 Ga0496121_0562587 3300048924 Bacteria 711
204 Ga0496123_0117282 3300048926 Bacteria 1506
205 Ga0496124_0161414 3300048927 Bacteria 1746
206 Ga0496124_0292924 3300048927 Bacteria 1180
207 Ga0496124_0334127 3300048927 Bacteria 1079
208 Ga0496124_0461477 3300048927 Bacteria 863
209 Ga0495678_037581 3300049459 Bacteria 1965
210 Ga0495678_170584 3300049459 Bacteria 689
211 Ga0501033_0005021 3300049570 Bacteria 10534
212 Ga0501034_0346098 3300049571 Bacteria 1416
213 Ga0501039_0145544 3300049575 Bacteria 1862
214 Ga0501043_0110633 3300049579 Bacteria 2157
215 Ga0501046_0272038 3300049580 Bacteria 1242
216 Ga0501047_0010634 3300049581 Bacteria 8699
217 Ga0501227_109006 3300049665 Bacteria 741
218 Ga0501249_004484 3300049679 Bacteria 2835
219 Ga0501241_153480 3300049758 Bacteria 532
220 Ga0501269_000137 3300049766 Bacteria 23021
221 Ga0501269_050608 3300049766 Bacteria 571
222 Ga0501035_0003042 3300049822 Bacteria 16084
223 Ga0501035_0133207 3300049822 Bacteria 2165
224 Ga0501044_0034033 3300049823 Bacteria 5348
225 Ga0501044_0131861 3300049823 Bacteria 2493
226 nmdc:mga03683_10149_c1 3300050489 Bacteria 3371
227 Ga0500618_000767 3300053125 Bacteria 18143
228 Ga0500618_002777 3300053125 Bacteria 6359
229 Ga0500621_190621 3300053126 Bacteria 735
230 Ga0500586_002702 3300053145 Bacteria 4062
231 Ga0587090_032493 3300059510 Bacteria 880
232 Ga0466962_0089036 3300061719 Bacteria 1478

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0362791 Ga0451577_0362791_144_563 108
2 3300046463 Ga0495653_0000018 Ga0495653_0000018_42850_43284 115
3 3300031838 Ga0307518_10027105 Ga0307518_100271056 118
4 3300044765 Ga0466970_0475974 Ga0466970_0475974_15_377 118
5 3300006946 Ga0079104_1013601 Ga0079104_10136013 119
6 3300027111 Ga0209281_1034645 Ga0209281_10346452 119
7 3300025261 Ga0209233_1015824 Ga0209233_10158242 120
8 3300049570 Ga0501033_0005021 Ga0501033_0005021_7213_7692 121
9 3300049575 Ga0501039_0145544 Ga0501039_0145544_582_1061 121
10 3300049579 Ga0501043_0110633 Ga0501043_0110633_973_1452 121
11 3300049580 Ga0501046_0272038 Ga0501046_0272038_119_598 121
12 3300049581 Ga0501047_0010634 Ga0501047_0010634_4881_5360 121
13 3300049822 Ga0501035_0003042 Ga0501035_0003042_949_1428 121
14 3300049823 Ga0501044_0034033 Ga0501044_0034033_215_694 121
15 3300003322 rootL2_10100368 rootL2_101003683 122
16 3300021361 Ga0213872_10069062 Ga0213872_100690623 122
17 3300039447 Ga0436361_0375170 Ga0436361_0375170_1255_1692 122
18 3300044683 Ga0466965_0144378 Ga0466965_0144378_485_931 122
19 3300044842 Ga0466957_0179786 Ga0466957_0179786_138_584 122
20 3300049822 Ga0501035_0133207 Ga0501035_0133207_674_1105 122
21 3300031548 Ga0307408_100177572 Ga0307408_1001775722 124
22 3300044693 Ga0466961_0633850 Ga0466961_0633850_12_398 126
23 3300046512 Ga0495610_0012580 Ga0495610_0012580_13_396 126
24 3300046501 Ga0495607_0251947 Ga0495607_0251947_450_833 127
25 3300046507 Ga0495606_0026012 Ga0495606_0026012_18_419 127
26 3300017792 Ga0163161_10046143 Ga0163161_100461434 129
27 3300005331 Ga0070670_100690920 Ga0070670_1006909201 130
28 3300009036 Ga0105244_10001359 Ga0105244_1000135916 130
29 3300013306 Ga0163162_12998577 Ga0163162_129985771 130
30 3300025728 Ga0207655_1001536 Ga0207655_100153616 130
31 3300032002 Ga0307416_103201130 Ga0307416_1032011302 130
32 3300046537 Ga0495598_0106689 Ga0495598_0106689_443_874 130
33 3300046674 Ga0495588_0149204 Ga0495588_0149204_145_576 130
34 3300048904 Ga0496101_0435514 Ga0496101_0435514_11_442 130
35 3300048905 Ga0496102_0528516 Ga0496102_0528516_568_999 130
36 3300048908 Ga0496105_0278445 Ga0496105_0278445_420_851 130
37 3300048911 Ga0496108_0179432 Ga0496108_0179432_305_736 130
38 3300048912 Ga0496109_0038160 Ga0496109_0038160_3823_4254 130
39 3300048913 Ga0496110_0121818 Ga0496110_0121818_574_1005 130
40 3300048914 Ga0496111_0102864 Ga0496111_0102864_1125_1556 130
41 3300048917 Ga0496114_0414813 Ga0496114_0414813_459_890 130
42 3300048927 Ga0496124_0461477 Ga0496124_0461477_19_450 130
43 3300049679 Ga0501249_004484 Ga0501249_004484_92_526 130
44 3300049766 Ga0501269_000137 Ga0501269_000137_19673_20107 130
45 3300031995 Ga0307409_101907159 Ga0307409_1019071592 131
46 3300044765 Ga0466970_0002753 Ga0466970_0002753_7555_7998 131
47 3300045049 Ga0466959_0046291 Ga0466959_0046291_1981_2424 131
48 3300048905 Ga0496102_0404344 Ga0496102_0404344_749_1180 131
49 3300049571 Ga0501034_0346098 Ga0501034_0346098_420_851 133
50 3300003771 Ga0055526_1000258 Ga0055526_10002587 134
51 3300009174 Ga0105241_11554070 Ga0105241_115540701 134
52 3300025295 Ga0209564_1000026 Ga0209564_1000026371 134
53 3300046471 Ga0495650_0016023 Ga0495650_0016023_870_1313 134
54 3300046520 Ga0495637_0000057 Ga0495637_0000057_89799_90224 134
55 3300046530 Ga0495654_0000005 Ga0495654_0000005_103306_103731 134
56 3300046692 Ga0495671_0410219 Ga0495671_0410219_208_633 134
57 3300049665 Ga0501227_109006 Ga0501227_109006_199_636 135
58 iso_pu_bacteria 2511231026 2511387108 135
59 3300031901 Ga0307406_11978299 Ga0307406_119782991 136
60 3300047443 Ga0495687_043262 Ga0495687_043262_1259_1702 136
61 3300048917 Ga0496114_0643865 Ga0496114_0643865_95_517 137
62 iso_pu_bacteria 2738541297 2738825907 137
63 iso_pu_bacteria 2738541357 2739149704 137
64 iso_pu_bacteria 2738543003 2739191623 137
65 iso_pu_bacteria 2738543026 2739318100 137
66 iso_pu_bacteria 2738543029 2739336341 137
67 iso_pu_bacteria 2904424332 2904429970 137
68 3300027111 Ga0209281_1055604 Ga0209281_10556041 139
69 3300031911 Ga0307412_11198160 Ga0307412_111981601 139
70 3300046519 Ga0495632_0111638 Ga0495632_0111638_555_974 139
71 3300046810 Ga0495660_0041125 Ga0495660_0041125_701_1120 139
72 3300053125 Ga0500618_000767 Ga0500618_000767_7424_7843 139
73 3300003187 JGI25151J46595_10088659 JGI25151J46595_100886592 140
74 3300003215 JGI25153J46596_10083052 JGI25153J46596_100830521 140
75 3300003316 rootH1_10135833 rootH1_101358332 140
76 3300003575 Ga0007409J51694_1066324 Ga0007409J51694_10663243 140
77 3300003577 Ga0007416J51690_1064343 Ga0007416J51690_10643432 140
78 3300003693 Ga0032354_1077203 Ga0032354_10772034 140
79 3300003751 Ga0055538_1000010 Ga0055538_1000010320 140
80 3300003752 Ga0055539_1000015 Ga0055539_1000015320 140
81 3300003756 Ga0055533_1000018 Ga0055533_1000018320 140
82 3300003759 Ga0055525_1000020 Ga0055525_1000020320 140
83 3300003841 Ga0055541_1000011 Ga0055541_1000011320 140
84 3300005289 Ga0065704_10296094 Ga0065704_102960941 140
85 3300005344 Ga0070661_101418346 Ga0070661_1014183461 140
86 3300006177 Ga0075362_10003441 Ga0075362_100034413 140
87 3300009036 Ga0105244_10010031 Ga0105244_100100313 140
88 3300014969 Ga0157376_10587141 Ga0157376_105871412 140
89 3300021361 Ga0213872_10002757 Ga0213872_100027578 140
90 3300021361 Ga0213872_10007501 Ga0213872_100075013 140
91 3300025224 Ga0209784_100025 Ga0209784_100025317 140
92 3300025225 Ga0209566_100025 Ga0209566_100025317 140
93 3300025226 Ga0209674_100042 Ga0209674_100042317 140
94 3300025230 Ga0209563_100046 Ga0209563_100046317 140
95 3300025245 Ga0207425_1000360 Ga0207425_10003606 140
96 3300025253 Ga0209677_100027 Ga0209677_100027317 140
97 3300025294 Ga0209025_1003724 Ga0209025_100372414 140
98 3300025297 Ga0209758_1000372 Ga0209758_100037231 140
99 3300025728 Ga0207655_1004984 Ga0207655_10049843 140
100 3300025920 Ga0207649_11097566 Ga0207649_110975662 140
101 3300031901 Ga0307406_11277607 Ga0307406_112776072 140
102 3300035114 Ga0373939_0353744 Ga0373939_0353744_48_473 140
103 3300037312 Ga0395899_0004059 Ga0395899_0004059_5157_5585 140
104 3300037312 Ga0395899_0011304 Ga0395899_0011304_1099_1530 140
105 3300037312 Ga0395899_0024139 Ga0395899_0024139_2899_3330 140
106 3300037418 Ga0395900_0020019 Ga0395900_0020019_2824_3252 140
107 3300037418 Ga0395900_0048814 Ga0395900_0048814_209_640 140
108 3300037466 Ga0395898_0325653 Ga0395898_0325653_772_1203 140
109 3300037471 Ga0395905_0008627 Ga0395905_0008627_922_1353 140
110 3300037471 Ga0395905_0015499 Ga0395905_0015499_1952_2380 140
111 3300037471 Ga0395905_0358027 Ga0395905_0358027_799_1227 140
112 3300037471 Ga0395905_1507756 Ga0395905_1507756_110_535 140
113 3300038443 Ga0395901_0001293 Ga0395901_0001293_19313_19744 140
114 3300038443 Ga0395901_0015288 Ga0395901_0015288_1853_2284 140
115 3300038443 Ga0395901_0263068 Ga0395901_0263068_958_1386 140
116 3300038443 Ga0395901_0816632 Ga0395901_0816632_244_672 140
117 3300039447 Ga0436361_0168473 Ga0436361_0168473_15240_15671 140
118 3300039447 Ga0436361_0214417 Ga0436361_0214417_589_1020 140
119 3300039447 Ga0436361_0222997 Ga0436361_0222997_3358_3783 140
120 3300044656 Ga0466969_0097118 Ga0466969_0097118_642_1070 140
121 3300044658 Ga0466972_0209539 Ga0466972_0209539_432_860 140
122 3300044669 Ga0466981_0646479 Ga0466981_0646479_103_525 140
123 3300044683 Ga0466965_0201641 Ga0466965_0201641_160_588 140
124 3300044684 Ga0466966_0148479 Ga0466966_0148479_534_962 140
125 3300044719 Ga0466971_0062094 Ga0466971_0062094_999_1427 140
126 3300044735 Ga0466968_0289286 Ga0466968_0289286_159_581 140
127 3300045049 Ga0466959_0229567 Ga0466959_0229567_172_600 140
128 3300046452 Ga0495617_003612 Ga0495617_003612_2833_3258 140
129 3300046460 Ga0495638_0324031 Ga0495638_0324031_223_660 140
130 3300046471 Ga0495650_0000212 Ga0495650_0000212_4609_5034 140
131 3300046501 Ga0495607_0052458 Ga0495607_0052458_1112_1537 140
132 3300046507 Ga0495606_0000158 Ga0495606_0000158_3959_4384 140
133 3300046507 Ga0495606_0000547 Ga0495606_0000547_15178_15603 140
134 3300046512 Ga0495610_0002677 Ga0495610_0002677_13474_13899 140
135 3300046516 Ga0495628_0115634 Ga0495628_0115634_1488_1919 140
136 3300046524 Ga0495648_0010048 Ga0495648_0010048_2872_3297 140
137 3300046529 Ga0495652_0331843 Ga0495652_0331843_539_970 140
138 3300046543 Ga0495645_0017467 Ga0495645_0017467_1936_2367 140
139 3300046616 Ga0495668_0000482 Ga0495668_0000482_31783_32208 140
140 3300046616 Ga0495668_0014900 Ga0495668_0014900_1030_1455 140
141 3300046680 Ga0495646_0005083 Ga0495646_0005083_432_863 140
142 3300046692 Ga0495671_0046237 Ga0495671_0046237_1188_1613 140
143 3300047320 Ga0495672_0000014 Ga0495672_0000014_153869_154291 140
144 3300047469 Ga0495673_0000034 Ga0495673_0000034_207569_207994 140
145 3300047472 Ga0495686_0012032 Ga0495686_0012032_2894_3319 140
146 3300048903 Ga0496100_0115486 Ga0496100_0115486_925_1365 140
147 3300048910 Ga0496107_0120826 Ga0496107_0120826_582_1007 140
148 3300048913 Ga0496110_0167321 Ga0496110_0167321_544_969 140
149 3300048919 Ga0496116_0029969 Ga0496116_0029969_3306_3731 140
150 3300048927 Ga0496124_0161414 Ga0496124_0161414_77_502 140
151 3300048927 Ga0496124_0292924 Ga0496124_0292924_44_481 140
152 3300048927 Ga0496124_0334127 Ga0496124_0334127_34_459 140
153 3300049459 Ga0495678_170584 Ga0495678_170584_55_477 140
154 3300049758 Ga0501241_153480 Ga0501241_153480_49_480 140
155 3300049766 Ga0501269_050608 Ga0501269_050608_37_459 140
156 3300049823 Ga0501044_0131861 Ga0501044_0131861_366_797 140
157 3300050489 nmdc:mga03683_10149_c1 nmdc:mga03683_10149_c1_1490_1918 140
158 3300053125 Ga0500618_002777 Ga0500618_002777_3065_3490 140
159 3300053126 Ga0500621_190621 Ga0500621_190621_197_628 140
160 3300059510 Ga0587090_032493 Ga0587090_032493_288_713 140
161 3300061719 Ga0466962_0089036 Ga0466962_0089036_575_1003 140
162 3300002738 JGI25154J39366_1004078 JGI25154J39366_10040785 141
163 3300003771 Ga0055526_1000230 Ga0055526_10002306 141
164 3300009148 Ga0105243_11130878 Ga0105243_111308782 141
165 3300013306 Ga0163162_11333447 Ga0163162_113334471 141
166 3300015262 Ga0182007_10066004 Ga0182007_100660041 141
167 3300021361 Ga0213872_10000063 Ga0213872_1000006359 141
168 3300021361 Ga0213872_10000223 Ga0213872_1000022325 141
169 3300021361 Ga0213872_10009997 Ga0213872_100099976 141
170 3300025233 Ga0209437_115718 Ga0209437_1157182 141
171 3300025246 Ga0209646_1000114 Ga0209646_1000114118 141
172 3300025250 Ga0209026_1002196 Ga0209026_10021966 141
173 3300025295 Ga0209564_1000006 Ga0209564_1000006896 141
174 3300030731 Ga0316177_1199479 Ga0316177_11994793 141
175 3300030736 Ga0316180_1100970 Ga0316180_11009702 141
176 3300030744 Ga0316181_1090622 Ga0316181_10906225 141
177 3300030745 Ga0316182_1018216 Ga0316182_10182162 141
178 3300030745 Ga0316182_1406091 Ga0316182_14060913 141
179 3300031711 Ga0265314_10041423 Ga0265314_100414235 141
180 3300031711 Ga0265314_10249688 Ga0265314_102496883 141
181 3300037471 Ga0395905_1062419 Ga0395905_1062419_196_639 141
182 3300039447 Ga0436361_0014164 Ga0436361_0014164_8493_8924 141
183 3300039447 Ga0436361_0118137 Ga0436361_0118137_861_1292 141
184 3300039447 Ga0436361_0285930 Ga0436361_0285930_19_480 141
185 3300039447 Ga0436361_0320570 Ga0436361_0320570_126_557 141
186 3300039447 Ga0436361_0811061 Ga0436361_0811061_98743_99177 141
187 3300039447 Ga0436361_0993682 Ga0436361_0993682_1904_2335 141
188 3300046452 Ga0495617_000048 Ga0495617_000048_110485_110913 141
189 3300046457 Ga0495590_0000030 Ga0495590_0000030_29103_29528 141
190 3300046460 Ga0495638_0000105 Ga0495638_0000105_44572_44997 141
191 3300046460 Ga0495638_0064721 Ga0495638_0064721_1208_1636 141
192 3300046471 Ga0495650_0000099 Ga0495650_0000099_131279_131704 141
193 3300046471 Ga0495650_0000227 Ga0495650_0000227_111591_112019 141
194 3300046471 Ga0495650_0002015 Ga0495650_0002015_14676_15101 141
195 3300046492 Ga0495585_0001802 Ga0495585_0001802_6167_6595 141
196 3300046501 Ga0495607_0008312 Ga0495607_0008312_2921_3364 141
197 3300046506 Ga0495583_0008863 Ga0495583_0008863_2785_3210 141
198 3300046507 Ga0495606_0001026 Ga0495606_0001026_16504_16932 141
199 3300046507 Ga0495606_0001932 Ga0495606_0001932_531_956 141
200 3300046507 Ga0495606_0009625 Ga0495606_0009625_5078_5506 141
201 3300046520 Ga0495637_0006210 Ga0495637_0006210_2694_3122 141
202 3300046522 Ga0495643_0005852 Ga0495643_0005852_2880_3305 141
203 3300046524 Ga0495648_0000008 Ga0495648_0000008_277052_277477 141
204 3300046524 Ga0495648_0003617 Ga0495648_0003617_8485_8913 141
205 3300046524 Ga0495648_0034770 Ga0495648_0034770_2816_3244 141
206 3300046528 Ga0495642_0004701 Ga0495642_0004701_1932_2357 141
207 3300046528 Ga0495642_0112385 Ga0495642_0112385_25_462 141
208 3300046530 Ga0495654_0012289 Ga0495654_0012289_1311_1739 141
209 3300046538 Ga0495609_0028803 Ga0495609_0028803_1209_1634 141
210 3300046542 Ga0495597_0003757 Ga0495597_0003757_2955_3380 141
211 3300046557 Ga0495622_0000415 Ga0495622_0000415_4317_4742 141
212 3300046557 Ga0495622_0000534 Ga0495622_0000534_20214_20639 141
213 3300046558 Ga0495633_0000238 Ga0495633_0000238_46717_47142 141
214 3300046558 Ga0495633_0039399 Ga0495633_0039399_1124_1552 141
215 3300046558 Ga0495633_0060509 Ga0495633_0060509_70_501 141
216 3300046615 Ga0495656_0600008 Ga0495656_0600008_77_502 141
217 3300046616 Ga0495668_0001995 Ga0495668_0001995_8005_8430 141
218 3300046616 Ga0495668_0005088 Ga0495668_0005088_2437_2865 141
219 3300046660 Ga0495625_0001573 Ga0495625_0001573_2968_3393 141
220 3300046664 Ga0495659_0153109 Ga0495659_0153109_182_607 141
221 3300046665 Ga0495661_0005648 Ga0495661_0005648_2840_3268 141
222 3300046692 Ga0495671_0000343 Ga0495671_0000343_27854_28282 141
223 3300046692 Ga0495671_0394714 Ga0495671_0394714_10_438 141
224 3300046810 Ga0495660_0003276 Ga0495660_0003276_2386_2814 141
225 3300046810 Ga0495660_0024315 Ga0495660_0024315_2861_3286 141
226 3300047323 Ga0495683_0004583 Ga0495683_0004583_2441_2869 141
227 3300047443 Ga0495687_002805 Ga0495687_002805_9547_9972 141
228 3300047443 Ga0495687_003597 Ga0495687_003597_1307_1732 141
229 3300047445 Ga0495677_0023871 Ga0495677_0023871_438_881 141
230 3300047446 Ga0495679_013334 Ga0495679_013334_1883_2311 141
231 3300047469 Ga0495673_0000150 Ga0495673_0000150_4151_4579 141
232 3300047472 Ga0495686_0001141 Ga0495686_0001141_1452_1892 141
233 3300048090 Ga0495615_0010879 Ga0495615_0010879_186_611 141
234 3300048906 Ga0496103_0019423 Ga0496103_0019423_838_1272 141
235 3300048917 Ga0496114_0035890 Ga0496114_0035890_1517_1951 141
236 3300048924 Ga0496121_0562587 Ga0496121_0562587_161_610 141
237 3300048926 Ga0496123_0117282 Ga0496123_0117282_644_1072 141
238 3300049459 Ga0495678_037581 Ga0495678_037581_989_1414 141
239 3300053145 Ga0500586_002702 Ga0500586_002702_1230_1658 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

11

137

0.98

Feature Viewer

pLDDT pTM Quality
69.22 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map