F351868
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 239 | 172 | 234 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300009011|Ga0105251_10064084|Ga0105251_100640842 |
| Length | 223 |
| Sequence | MVPYPQHIVQGHVEACVRGLSMYEYYDSTRSALMSPVLLAPRRFEDKRGWFSETWNERRVKDAGIDARFCQDNQSLSRETGTLRGLHFQAPPHAQAKLVRCLRGRILDVAVDIRRASPTFGKWLSVELSAANGLQLFIPRGYAHGFLTLEDDCEIAYKVDDFYSAEADGGVAWDDPAIGIDWHLGGRTPLLSDKDAALAPLSSLTVEFPYDGSPLEALRQVQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 2 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 3 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 4 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 54 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 62 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 112 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 113 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 114 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 115 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 116 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 117 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 118 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 121 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 122 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 123 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 124 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 125 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 129 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 130 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 131 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 132 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 133 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 134 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 135 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 149 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 150 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 151 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 152 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 153 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 155 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 156 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 157 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 158 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 159 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 160 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 161 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 163 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 164 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 165 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 166 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 167 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 168 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 169 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 170 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 171 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.49 |
| Metatranscriptomes | 0.42 |
| Isolates | 2.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.28 |
| Nodule | 0.84 |
| Rhizoplane | 2.09 |
| Rhizosphere | 86.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1008045 | 3300001978 | Bacteria | 1024 |
| 2 | JGI24739J22299_10012725 | 3300001989 | Bacteria | 3085 |
| 3 | JGI24737J22298_10035985 | 3300001990 | Bacteria | 1530 |
| 4 | JGI24743J22301_10041086 | 3300001991 | Bacteria | 929 |
| 5 | JGI24749J21850_1000051 | 3300002076 | Bacteria | 22278 |
| 6 | JGI24744J21845_10010078 | 3300002077 | Bacteria | 1937 |
| 7 | JGI24751J29686_10000156 | 3300002459 | Bacteria | 32856 |
| 8 | JGI25153J46596_10020657 | 3300003215 | Bacteria | 2483 |
| 9 | Ga0055536_1000309 | 3300003781 | Bacteria | 36801 |
| 10 | Ga0065707_10119297 | 3300005295 | Bacteria | 2163 |
| 11 | Ga0070658_10360231 | 3300005327 | Bacteria | 1245 |
| 12 | Ga0070683_101017740 | 3300005329 | Bacteria | 795 |
| 13 | Ga0070690_100777859 | 3300005330 | Bacteria | 741 |
| 14 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 15 | Ga0070670_100001680 | 3300005331 | Bacteria | 17968 |
| 16 | Ga0070670_100027849 | 3300005331 | Bacteria | 4862 |
| 17 | Ga0070670_100168380 | 3300005331 | Bacteria | 1900 |
| 18 | Ga0070677_10023247 | 3300005333 | Bacteria | 2293 |
| 19 | Ga0070666_10046231 | 3300005335 | Bacteria | 2919 |
| 20 | Ga0070682_100120607 | 3300005337 | Bacteria | 1760 |
| 21 | Ga0070682_100707087 | 3300005337 | Bacteria | 809 |
| 22 | Ga0068868_100132132 | 3300005338 | Bacteria | 2043 |
| 23 | Ga0070660_100047673 | 3300005339 | Bacteria | 3289 |
| 24 | Ga0070660_100165032 | 3300005339 | Bacteria | 1786 |
| 25 | Ga0070691_10201352 | 3300005341 | Bacteria | 1046 |
| 26 | Ga0070661_100021586 | 3300005344 | Bacteria | 4600 |
| 27 | Ga0070668_100000024 | 3300005347 | Bacteria | 94452 |
| 28 | Ga0070668_100007397 | 3300005347 | Bacteria | 8150 |
| 29 | Ga0070668_100382766 | 3300005347 | Bacteria | 1198 |
| 30 | Ga0070669_100000044 | 3300005353 | Bacteria | 121087 |
| 31 | Ga0070669_100135025 | 3300005353 | Bacteria | 1897 |
| 32 | Ga0070671_100000021 | 3300005355 | Bacteria | 127093 |
| 33 | Ga0070671_100120417 | 3300005355 | Bacteria | 2208 |
| 34 | Ga0070659_100009724 | 3300005366 | Bacteria | 7063 |
| 35 | Ga0070667_100000009 | 3300005367 | Bacteria | 281488 |
| 36 | Ga0070667_100000122 | 3300005367 | Bacteria | 99820 |
| 37 | Ga0070667_100004145 | 3300005367 | Bacteria | 12254 |
| 38 | Ga0070667_100196750 | 3300005367 | Bacteria | 1787 |
| 39 | Ga0070667_100623565 | 3300005367 | Bacteria | 994 |
| 40 | Ga0070662_100195286 | 3300005457 | Bacteria | 1603 |
| 41 | Ga0068853_100857086 | 3300005539 | Bacteria | 872 |
| 42 | Ga0070693_100032061 | 3300005547 | Bacteria | 2886 |
| 43 | Ga0070665_100223426 | 3300005548 | Bacteria | 1884 |
| 44 | Ga0068855_100296441 | 3300005563 | Bacteria | 1792 |
| 45 | Ga0070664_100553662 | 3300005564 | Bacteria | 1064 |
| 46 | Ga0070664_101074981 | 3300005564 | Bacteria | 757 |
| 47 | Ga0068857_100189736 | 3300005577 | Bacteria | 1872 |
| 48 | Ga0068854_100044839 | 3300005578 | Bacteria | 3141 |
| 49 | Ga0068852_100176116 | 3300005616 | Bacteria | 2008 |
| 50 | Ga0068852_100359983 | 3300005616 | Bacteria | 1423 |
| 51 | Ga0068859_100016533 | 3300005617 | Bacteria | 7407 |
| 52 | Ga0068859_100028678 | 3300005617 | Bacteria | 5581 |
| 53 | Ga0068864_100000148 | 3300005618 | Bacteria | 66302 |
| 54 | Ga0068864_100003428 | 3300005618 | Bacteria | 13118 |
| 55 | Ga0068866_10191837 | 3300005718 | Bacteria | 1215 |
| 56 | Ga0068851_10168566 | 3300005834 | Bacteria | 1207 |
| 57 | Ga0068863_100011232 | 3300005841 | Bacteria | 8679 |
| 58 | Ga0068863_100016233 | 3300005841 | Bacteria | 7144 |
| 59 | Ga0068858_100001651 | 3300005842 | Bacteria | 22784 |
| 60 | Ga0068858_100885037 | 3300005842 | Bacteria | 873 |
| 61 | Ga0068860_100000036 | 3300005843 | Bacteria | 234917 |
| 62 | Ga0068860_100000152 | 3300005843 | Bacteria | 112187 |
| 63 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 64 | Ga0068862_100000031 | 3300005844 | Bacteria | 180203 |
| 65 | Ga0068862_100004137 | 3300005844 | Bacteria | 12298 |
| 66 | Ga0068862_100207778 | 3300005844 | Bacteria | 1768 |
| 67 | Ga0075366_10219384 | 3300006195 | Bacteria | 1158 |
| 68 | Ga0075370_10086696 | 3300006353 | Bacteria | 1803 |
| 69 | Ga0068871_100268304 | 3300006358 | Bacteria | 1490 |
| 70 | Ga0068865_100111470 | 3300006881 | Bacteria | 2019 |
| 71 | Ga0097620_100016533 | 3300006931 | Bacteria | 7407 |
| 72 | Ga0097620_100028675 | 3300006931 | Bacteria | 5581 |
| 73 | Ga0075435_100761977 | 3300007076 | Bacteria | 842 |
| 74 | Ga0105251_10064084 | 3300009011 | Bacteria | 1723 |
| 75 | Ga0105247_10008857 | 3300009101 | Bacteria | 6135 |
| 76 | Ga0105243_10194385 | 3300009148 | Bacteria | 1775 |
| 77 | Ga0105242_10268504 | 3300009176 | Bacteria | 1544 |
| 78 | Ga0105248_10000359 | 3300009177 | Bacteria | 53184 |
| 79 | Ga0105248_10782696 | 3300009177 | Bacteria | 1077 |
| 80 | Ga0105238_10593676 | 3300009551 | Bacteria | 1115 |
| 81 | Ga0105249_10226952 | 3300009553 | Bacteria | 1840 |
| 82 | Ga0123340_1073879 | 3300009763 | Bacteria | 766 |
| 83 | Ga0123342_1032876 | 3300009766 | Unclassified | 2400 |
| 84 | Ga0105239_11570387 | 3300010375 | Bacteria | 761 |
| 85 | Ga0157373_10028484 | 3300013100 | Bacteria | 4030 |
| 86 | Ga0157371_10000746 | 3300013102 | Bacteria | 37817 |
| 87 | Ga0157369_10009601 | 3300013105 | Bacteria | 11065 |
| 88 | Ga0157374_10911645 | 3300013296 | Bacteria | 897 |
| 89 | Ga0157378_10134691 | 3300013297 | Bacteria | 2290 |
| 90 | Ga0157375_10078273 | 3300013308 | Bacteria | 3339 |
| 91 | Ga0163163_10504902 | 3300014325 | Bacteria | 1271 |
| 92 | Ga0157380_10000199 | 3300014326 | Bacteria | 35164 |
| 93 | Ga0157379_10214914 | 3300014968 | Bacteria | 1741 |
| 94 | Ga0163161_10190793 | 3300017792 | Bacteria | 1575 |
| 95 | Ga0209676_1000070 | 3300025292 | Bacteria | 312074 |
| 96 | Ga0209050_1024416 | 3300025298 | Bacteria | 2092 |
| 97 | Ga0209050_1027952 | 3300025298 | Bacteria | 1843 |
| 98 | Ga0207697_10012265 | 3300025315 | Bacteria | 3598 |
| 99 | Ga0207656_10145807 | 3300025321 | Bacteria | 1118 |
| 100 | Ga0207682_10011433 | 3300025893 | Bacteria | 3465 |
| 101 | Ga0207688_10074592 | 3300025901 | Bacteria | 1929 |
| 102 | Ga0207680_10038378 | 3300025903 | Bacteria | 2772 |
| 103 | Ga0207647_10044818 | 3300025904 | Bacteria | 2762 |
| 104 | Ga0207657_10009896 | 3300025919 | Bacteria | 9545 |
| 105 | Ga0207657_10036882 | 3300025919 | Bacteria | 4373 |
| 106 | Ga0207649_10046092 | 3300025920 | Bacteria | 2676 |
| 107 | Ga0207649_10090759 | 3300025920 | Bacteria | 2000 |
| 108 | Ga0207681_10000041 | 3300025923 | Bacteria | 140201 |
| 109 | Ga0207681_10011298 | 3300025923 | Bacteria | 5485 |
| 110 | Ga0207681_11081908 | 3300025923 | Bacteria | 673 |
| 111 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 112 | Ga0207650_10040331 | 3300025925 | Bacteria | 3416 |
| 113 | Ga0207650_10145468 | 3300025925 | Bacteria | 1866 |
| 114 | Ga0207659_10066022 | 3300025926 | Bacteria | 2624 |
| 115 | Ga0207687_10142670 | 3300025927 | Bacteria | 1819 |
| 116 | Ga0207644_10000054 | 3300025931 | Bacteria | 86116 |
| 117 | Ga0207690_10052655 | 3300025932 | Bacteria | 2727 |
| 118 | Ga0207706_10140060 | 3300025933 | Bacteria | 2128 |
| 119 | Ga0207709_10121523 | 3300025935 | Bacteria | 1764 |
| 120 | Ga0207669_10058877 | 3300025937 | Bacteria | 2346 |
| 121 | Ga0207704_10065534 | 3300025938 | Bacteria | 2275 |
| 122 | Ga0207711_10000507 | 3300025941 | Bacteria | 40167 |
| 123 | Ga0207689_10444050 | 3300025942 | Bacteria | 1084 |
| 124 | Ga0207679_10449296 | 3300025945 | Bacteria | 1143 |
| 125 | Ga0207668_10000031 | 3300025972 | Bacteria | 122168 |
| 126 | Ga0207668_10428610 | 3300025972 | Bacteria | 1124 |
| 127 | Ga0207640_10060234 | 3300025981 | Bacteria | 2508 |
| 128 | Ga0207640_10805236 | 3300025981 | Bacteria | 814 |
| 129 | Ga0207658_10000009 | 3300025986 | Bacteria | 264118 |
| 130 | Ga0207658_10000092 | 3300025986 | Bacteria | 99965 |
| 131 | Ga0207658_10163644 | 3300025986 | Bacteria | 1825 |
| 132 | Ga0207658_10335957 | 3300025986 | Bacteria | 1312 |
| 133 | Ga0207703_10001733 | 3300026035 | Bacteria | 19622 |
| 134 | Ga0207639_10265729 | 3300026041 | Bacteria | 1503 |
| 135 | Ga0207639_10640905 | 3300026041 | Bacteria | 982 |
| 136 | Ga0207678_10013180 | 3300026067 | Bacteria | 7254 |
| 137 | Ga0207678_10317866 | 3300026067 | Bacteria | 1339 |
| 138 | Ga0207641_10000306 | 3300026088 | Bacteria | 61172 |
| 139 | Ga0207641_10000742 | 3300026088 | Bacteria | 35060 |
| 140 | Ga0207641_10007702 | 3300026088 | Bacteria | 8955 |
| 141 | Ga0207648_10005246 | 3300026089 | Bacteria | 13102 |
| 142 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 143 | Ga0207676_10009952 | 3300026095 | Bacteria | 6763 |
| 144 | Ga0207674_10396339 | 3300026116 | Bacteria | 1334 |
| 145 | Ga0207675_100305781 | 3300026118 | Bacteria | 1550 |
| 146 | Ga0207698_10023402 | 3300026142 | Bacteria | 4315 |
| 147 | Ga0207698_11685829 | 3300026142 | Bacteria | 649 |
| 148 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 149 | Ga0268265_10000118 | 3300028380 | Bacteria | 99496 |
| 150 | Ga0268265_10012864 | 3300028380 | Bacteria | 5680 |
| 151 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 152 | Ga0268264_10000111 | 3300028381 | Bacteria | 204718 |
| 153 | Ga0307408_100011145 | 3300031548 | Bacteria | 5938 |
| 154 | Ga0316576_10290860 | 3300031727 | Bacteria | 1222 |
| 155 | Ga0307405_10011098 | 3300031731 | Bacteria | 4703 |
| 156 | Ga0307405_10073993 | 3300031731 | Bacteria | 2201 |
| 157 | Ga0307413_10004342 | 3300031824 | Bacteria | 6154 |
| 158 | Ga0307413_10388620 | 3300031824 | Bacteria | 1089 |
| 159 | Ga0307413_10401137 | 3300031824 | Bacteria | 1074 |
| 160 | Ga0307410_10036032 | 3300031852 | Bacteria | 3218 |
| 161 | Ga0307410_10204570 | 3300031852 | Bacteria | 1509 |
| 162 | Ga0307406_10051324 | 3300031901 | Bacteria | 2618 |
| 163 | Ga0307406_10328164 | 3300031901 | Bacteria | 1186 |
| 164 | Ga0307407_10078062 | 3300031903 | Bacteria | 1993 |
| 165 | Ga0307412_10008702 | 3300031911 | Bacteria | 5806 |
| 166 | Ga0307412_10088360 | 3300031911 | Bacteria | 2162 |
| 167 | Ga0307412_10123990 | 3300031911 | Bacteria | 1865 |
| 168 | Ga0307412_10137829 | 3300031911 | Bacteria | 1783 |
| 169 | Ga0307412_10152190 | 3300031911 | Bacteria | 1708 |
| 170 | Ga0307412_10741186 | 3300031911 | Bacteria | 847 |
| 171 | Ga0307409_100084197 | 3300031995 | Bacteria | 2581 |
| 172 | Ga0307409_100561878 | 3300031995 | Bacteria | 1122 |
| 173 | Ga0307416_100044363 | 3300032002 | Bacteria | 3490 |
| 174 | Ga0307416_100045891 | 3300032002 | Bacteria | 3444 |
| 175 | Ga0307416_100250071 | 3300032002 | Bacteria | 1725 |
| 176 | Ga0307414_10010035 | 3300032004 | Bacteria | 5472 |
| 177 | Ga0307414_10494706 | 3300032004 | Bacteria | 1081 |
| 178 | Ga0307414_10519439 | 3300032004 | Bacteria | 1056 |
| 179 | Ga0307414_10828921 | 3300032004 | Bacteria | 845 |
| 180 | Ga0307411_10006780 | 3300032005 | Bacteria | 5765 |
| 181 | Ga0307411_10090493 | 3300032005 | Bacteria | 2134 |
| 182 | Ga0307415_100008640 | 3300032126 | Bacteria | 5659 |
| 183 | Ga0316584_0260878 | 3300036712 | Bacteria | 1264 |
| 184 | Ga0395900_0288871 | 3300037418 | Bacteria | 1629 |
| 185 | Ga0395905_0227219 | 3300037471 | Bacteria | 1746 |
| 186 | Ga0395901_0015051 | 3300038443 | Bacteria | 7867 |
| 187 | Ga0395901_0216710 | 3300038443 | Bacteria | 2002 |
| 188 | Ga0400483_021923 | 3300039062 | Bacteria | 1069 |
| 189 | Ga0400483_232920 | 3300039062 | Bacteria | 1349 |
| 190 | Ga0436361_0547178 | 3300039447 | Bacteria | 17760 |
| 191 | Ga0451807_2189743 | 3300041486 | Bacteria | 833 |
| 192 | Ga0451853_0051956 | 3300041512 | Bacteria | 807 |
| 193 | Ga0439441_005745 | 3300042001 | Bacteria | 1940 |
| 194 | Ga0439459_0083983 | 3300042438 | Bacteria | 756 |
| 195 | Ga0466973_0422730 | 3300044659 | Bacteria | 801 |
| 196 | Ga0495638_0007795 | 3300046460 | Bacteria | 7646 |
| 197 | Ga0495607_0088189 | 3300046501 | Bacteria | 1687 |
| 198 | Ga0495616_0000016 | 3300046513 | Bacteria | 182686 |
| 199 | Ga0495632_0000597 | 3300046519 | Bacteria | 33515 |
| 200 | Ga0495632_0058593 | 3300046519 | Bacteria | 1876 |
| 201 | Ga0495648_0216705 | 3300046524 | Bacteria | 947 |
| 202 | Ga0495654_0056642 | 3300046530 | Bacteria | 1894 |
| 203 | Ga0495668_0009308 | 3300046616 | Bacteria | 6039 |
| 204 | Ga0495659_0021533 | 3300046664 | Bacteria | 2173 |
| 205 | Ga0495671_0048850 | 3300046692 | Bacteria | 2110 |
| 206 | Ga0495660_0140125 | 3300046810 | Bacteria | 1204 |
| 207 | Ga0495686_0069767 | 3300047472 | Bacteria | 2166 |
| 208 | Ga0496103_0126531 | 3300048906 | Bacteria | 1630 |
| 209 | Ga0496112_0323160 | 3300048915 | Bacteria | 1487 |
| 210 | Ga0496113_0668311 | 3300048916 | Bacteria | 830 |
| 211 | Ga0496114_0000023 | 3300048917 | Bacteria | 219092 |
| 212 | Ga0496122_0008897 | 3300048925 | Bacteria | 10700 |
| 213 | Ga0496123_0005801 | 3300048926 | Bacteria | 12262 |
| 214 | Ga0496125_0032260 | 3300048928 | Bacteria | 4655 |
| 215 | Ga0501034_1019062 | 3300049571 | Bacteria | 711 |
| 216 | Ga0501227_014370 | 3300049665 | Bacteria | 1757 |
| 217 | Ga0501242_003417 | 3300049674 | Bacteria | 1718 |
| 218 | Ga0501249_000241 | 3300049679 | Bacteria | 16238 |
| 219 | Ga0501250_024159 | 3300049680 | Bacteria | 808 |
| 220 | Ga0501260_003692 | 3300049689 | Bacteria | 1386 |
| 221 | Ga0501241_018564 | 3300049758 | Bacteria | 1274 |
| 222 | Ga0501268_002932 | 3300049765 | Bacteria | 2294 |
| 223 | Ga0501044_0110765 | 3300049823 | Bacteria | 2754 |
| 224 | Ga0501204_000645 | 3300049850 | Bacteria | 3123 |
| 225 | Ga0501226_016140 | 3300049853 | Bacteria | 822 |
| 226 | nmdc:mga00v17_320425_c1 | 3300050491 | Bacteria | 1007 |
| 227 | nmdc:mga0k408_75837_c1 | 3300050493 | Bacteria | 1965 |
| 228 | Ga0500643_015469 | 3300053087 | Bacteria | 2616 |
| 229 | Ga0500618_000014 | 3300053125 | Bacteria | 177186 |
| 230 | Ga0500658_0203638 | 3300053134 | Bacteria | 905 |
| 231 | Ga0500559_0000068 | 3300053136 | Bacteria | 82896 |
| 232 | Ga0500559_0004761 | 3300053136 | Bacteria | 6361 |
| 233 | Ga0500609_001541 | 3300053731 | Bacteria | 3365 |
| 234 | Ga0587073_0107869 | 3300059492 | Bacteria | 733 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031911 | Ga0307412_10123990 | Ga0307412_101239902 | 167 |
| 2 | 3300005844 | Ga0068862_100207778 | Ga0068862_1002077782 | 175 |
| 3 | 3300014968 | Ga0157379_10214914 | Ga0157379_102149142 | 175 |
| 4 | 3300005367 | Ga0070667_100196750 | Ga0070667_1001967502 | 176 |
| 5 | 3300025986 | Ga0207658_10163644 | Ga0207658_101636442 | 176 |
| 6 | iso_pu_bacteria | 2995392953 | 2995393992 | 177 |
| 7 | 3300003781 | Ga0055536_1000309 | Ga0055536_10003098 | 178 |
| 8 | 3300025292 | Ga0209676_1000070 | Ga0209676_100007097 | 178 |
| 9 | 3300025298 | Ga0209050_1027952 | Ga0209050_10279522 | 178 |
| 10 | 3300031727 | Ga0316576_10290860 | Ga0316576_102908602 | 178 |
| 11 | 3300032004 | Ga0307414_10828921 | Ga0307414_108289212 | 178 |
| 12 | 3300036712 | Ga0316584_0260878 | Ga0316584_0260878_138_698 | 178 |
| 13 | iso_pu_bacteria | 2919138771 | 2919143041 | 178 |
| 14 | 3300009763 | Ga0123340_1073879 | Ga0123340_10738791 | 179 |
| 15 | 3300009766 | Ga0123342_1032876 | Ga0123342_10328762 | 179 |
| 16 | 3300049758 | Ga0501241_018564 | Ga0501241_018564_478_1044 | 180 |
| 17 | 3300039062 | Ga0400483_021923 | Ga0400483_021923_251_820 | 181 |
| 18 | 3300039062 | Ga0400483_232920 | Ga0400483_232920_569_1138 | 181 |
| 19 | 3300049571 | Ga0501034_1019062 | Ga0501034_1019062_124_699 | 181 |
| 20 | 3300048928 | Ga0496125_0032260 | Ga0496125_0032260_67_618 | 183 |
| 21 | iso_pu_bacteria | 2643221605 | 2644039822 | 183 |
| 22 | iso_pu_bacteria | 8057101203 | 8057104533 | 183 |
| 23 | 3300053087 | Ga0500643_015469 | Ga0500643_015469_1505_2071 | 184 |
| 24 | 3300002076 | JGI24749J21850_1000051 | JGI24749J21850_10000518 | 185 |
| 25 | 3300002459 | JGI24751J29686_10000156 | JGI24751J29686_100001563 | 185 |
| 26 | 3300005295 | Ga0065707_10119297 | Ga0065707_101192972 | 185 |
| 27 | 3300005331 | Ga0070670_100000003 | Ga0070670_10000000327 | 185 |
| 28 | 3300005331 | Ga0070670_100001680 | Ga0070670_10000168014 | 185 |
| 29 | 3300005335 | Ga0070666_10046231 | Ga0070666_100462312 | 185 |
| 30 | 3300005347 | Ga0070668_100000024 | Ga0070668_10000002469 | 185 |
| 31 | 3300005347 | Ga0070668_100007397 | Ga0070668_1000073974 | 185 |
| 32 | 3300005353 | Ga0070669_100000044 | Ga0070669_10000004487 | 185 |
| 33 | 3300005353 | Ga0070669_100135025 | Ga0070669_1001350252 | 185 |
| 34 | 3300005355 | Ga0070671_100000021 | Ga0070671_10000002123 | 185 |
| 35 | 3300005367 | Ga0070667_100000009 | Ga0070667_100000009152 | 185 |
| 36 | 3300005367 | Ga0070667_100000122 | Ga0070667_10000012258 | 185 |
| 37 | 3300005367 | Ga0070667_100004145 | Ga0070667_10000414511 | 185 |
| 38 | 3300005548 | Ga0070665_100223426 | Ga0070665_1002234262 | 185 |
| 39 | 3300005577 | Ga0068857_100189736 | Ga0068857_1001897361 | 185 |
| 40 | 3300005617 | Ga0068859_100016533 | Ga0068859_1000165336 | 185 |
| 41 | 3300005617 | Ga0068859_100028678 | Ga0068859_1000286786 | 185 |
| 42 | 3300005618 | Ga0068864_100000148 | Ga0068864_10000014834 | 185 |
| 43 | 3300005618 | Ga0068864_100003428 | Ga0068864_10000342810 | 185 |
| 44 | 3300005841 | Ga0068863_100011232 | Ga0068863_1000112329 | 185 |
| 45 | 3300005841 | Ga0068863_100016233 | Ga0068863_1000162336 | 185 |
| 46 | 3300005842 | Ga0068858_100001651 | Ga0068858_1000016513 | 185 |
| 47 | 3300005843 | Ga0068860_100000036 | Ga0068860_10000003616 | 185 |
| 48 | 3300005843 | Ga0068860_100000152 | Ga0068860_10000015256 | 185 |
| 49 | 3300005844 | Ga0068862_100000001 | Ga0068862_100000001512 | 185 |
| 50 | 3300005844 | Ga0068862_100000031 | Ga0068862_100000031145 | 185 |
| 51 | 3300006931 | Ga0097620_100016533 | Ga0097620_1000165333 | 185 |
| 52 | 3300006931 | Ga0097620_100028675 | Ga0097620_1000286752 | 185 |
| 53 | 3300009177 | Ga0105248_10000359 | Ga0105248_1000035914 | 185 |
| 54 | 3300009551 | Ga0105238_10593676 | Ga0105238_105936762 | 185 |
| 55 | 3300009553 | Ga0105249_10226952 | Ga0105249_102269522 | 185 |
| 56 | 3300014325 | Ga0163163_10504902 | Ga0163163_105049022 | 185 |
| 57 | 3300014326 | Ga0157380_10000199 | Ga0157380_1000019924 | 185 |
| 58 | 3300017792 | Ga0163161_10190793 | Ga0163161_101907932 | 185 |
| 59 | 3300025903 | Ga0207680_10038378 | Ga0207680_100383783 | 185 |
| 60 | 3300025923 | Ga0207681_10000041 | Ga0207681_1000004144 | 185 |
| 61 | 3300025923 | Ga0207681_10011298 | Ga0207681_100112983 | 185 |
| 62 | 3300025925 | Ga0207650_10000004 | Ga0207650_1000000425 | 185 |
| 63 | 3300025925 | Ga0207650_10145468 | Ga0207650_101454682 | 185 |
| 64 | 3300025931 | Ga0207644_10000054 | Ga0207644_1000005469 | 185 |
| 65 | 3300025941 | Ga0207711_10000507 | Ga0207711_100005079 | 185 |
| 66 | 3300025972 | Ga0207668_10000031 | Ga0207668_1000003166 | 185 |
| 67 | 3300025986 | Ga0207658_10000009 | Ga0207658_10000009115 | 185 |
| 68 | 3300025986 | Ga0207658_10000092 | Ga0207658_1000009245 | 185 |
| 69 | 3300026035 | Ga0207703_10001733 | Ga0207703_1000173313 | 185 |
| 70 | 3300026088 | Ga0207641_10000306 | Ga0207641_1000030639 | 185 |
| 71 | 3300026088 | Ga0207641_10000742 | Ga0207641_1000074233 | 185 |
| 72 | 3300026088 | Ga0207641_10007702 | Ga0207641_100077024 | 185 |
| 73 | 3300026095 | Ga0207676_10000006 | Ga0207676_10000006687 | 185 |
| 74 | 3300026095 | Ga0207676_10009952 | Ga0207676_100099521 | 185 |
| 75 | 3300028380 | Ga0268265_10000001 | Ga0268265_10000001525 | 185 |
| 76 | 3300028380 | Ga0268265_10000118 | Ga0268265_1000011810 | 185 |
| 77 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001115 | 185 |
| 78 | 3300028381 | Ga0268264_10000111 | Ga0268264_1000011141 | 185 |
| 79 | 3300031911 | Ga0307412_10088360 | Ga0307412_100883603 | 185 |
| 80 | 3300031911 | Ga0307412_10152190 | Ga0307412_101521902 | 185 |
| 81 | 3300041486 | Ga0451807_2189743 | Ga0451807_2189743_192_773 | 185 |
| 82 | 3300044659 | Ga0466973_0422730 | Ga0466973_0422730_110_667 | 185 |
| 83 | 3300049823 | Ga0501044_0110765 | Ga0501044_0110765_2178_2735 | 185 |
| 84 | 3300050491 | nmdc:mga00v17_320425_c1 | nmdc:mga00v17_320425_c1_156_713 | 185 |
| 85 | 3300053136 | Ga0500559_0004761 | Ga0500559_0004761_628_1200 | 185 |
| 86 | iso_pu_bacteria | 2643221552 | 2643782982 | 185 |
| 87 | 3300031911 | Ga0307412_10741186 | Ga0307412_107411861 | 186 |
| 88 | 3300031995 | Ga0307409_100561878 | Ga0307409_1005618782 | 186 |
| 89 | 3300032002 | Ga0307416_100045891 | Ga0307416_1000458913 | 186 |
| 90 | 3300032004 | Ga0307414_10494706 | Ga0307414_104947062 | 186 |
| 91 | 3300003215 | JGI25153J46596_10020657 | JGI25153J46596_100206572 | 187 |
| 92 | 3300006195 | Ga0075366_10219384 | Ga0075366_102193842 | 187 |
| 93 | 3300006353 | Ga0075370_10086696 | Ga0075370_100866963 | 187 |
| 94 | 3300007076 | Ga0075435_100761977 | Ga0075435_1007619772 | 187 |
| 95 | 3300025298 | Ga0209050_1024416 | Ga0209050_10244162 | 187 |
| 96 | 3300031731 | Ga0307405_10073993 | Ga0307405_100739931 | 187 |
| 97 | 3300031824 | Ga0307413_10388620 | Ga0307413_103886201 | 187 |
| 98 | 3300031824 | Ga0307413_10401137 | Ga0307413_104011372 | 187 |
| 99 | 3300031852 | Ga0307410_10204570 | Ga0307410_102045702 | 187 |
| 100 | 3300031901 | Ga0307406_10328164 | Ga0307406_103281642 | 187 |
| 101 | 3300031911 | Ga0307412_10137829 | Ga0307412_101378292 | 187 |
| 102 | 3300031995 | Ga0307409_100084197 | Ga0307409_1000841972 | 187 |
| 103 | 3300032004 | Ga0307414_10519439 | Ga0307414_105194392 | 187 |
| 104 | 3300032005 | Ga0307411_10090493 | Ga0307411_100904933 | 187 |
| 105 | 3300037418 | Ga0395900_0288871 | Ga0395900_0288871_553_1119 | 187 |
| 106 | 3300037471 | Ga0395905_0227219 | Ga0395905_0227219_606_1172 | 187 |
| 107 | 3300038443 | Ga0395901_0015051 | Ga0395901_0015051_6914_7477 | 187 |
| 108 | 3300038443 | Ga0395901_0216710 | Ga0395901_0216710_1103_1669 | 187 |
| 109 | 3300041512 | Ga0451853_0051956 | Ga0451853_0051956_31_651 | 187 |
| 110 | 3300042001 | Ga0439441_005745 | Ga0439441_005745_835_1455 | 187 |
| 111 | 3300042438 | Ga0439459_0083983 | Ga0439459_0083983_97_717 | 187 |
| 112 | 3300046460 | Ga0495638_0007795 | Ga0495638_0007795_926_1495 | 187 |
| 113 | 3300046501 | Ga0495607_0088189 | Ga0495607_0088189_277_846 | 187 |
| 114 | 3300046513 | Ga0495616_0000016 | Ga0495616_0000016_92103_92672 | 187 |
| 115 | 3300046519 | Ga0495632_0000597 | Ga0495632_0000597_27181_27750 | 187 |
| 116 | 3300046519 | Ga0495632_0058593 | Ga0495632_0058593_1190_1759 | 187 |
| 117 | 3300046524 | Ga0495648_0216705 | Ga0495648_0216705_337_906 | 187 |
| 118 | 3300046530 | Ga0495654_0056642 | Ga0495654_0056642_87_656 | 187 |
| 119 | 3300046616 | Ga0495668_0009308 | Ga0495668_0009308_1972_2592 | 187 |
| 120 | 3300046664 | Ga0495659_0021533 | Ga0495659_0021533_10_579 | 187 |
| 121 | 3300046692 | Ga0495671_0048850 | Ga0495671_0048850_513_1076 | 187 |
| 122 | 3300046810 | Ga0495660_0140125 | Ga0495660_0140125_385_1005 | 187 |
| 123 | 3300047472 | Ga0495686_0069767 | Ga0495686_0069767_336_899 | 187 |
| 124 | 3300049674 | Ga0501242_003417 | Ga0501242_003417_795_1361 | 187 |
| 125 | 3300049680 | Ga0501250_024159 | Ga0501250_024159_140_706 | 187 |
| 126 | 3300049765 | Ga0501268_002932 | Ga0501268_002932_1219_1785 | 187 |
| 127 | 3300050493 | nmdc:mga0k408_75837_c1 | nmdc:mga0k408_75837_c1_1233_1853 | 187 |
| 128 | 3300053125 | Ga0500618_000014 | Ga0500618_000014_66066_66635 | 187 |
| 129 | 3300053134 | Ga0500658_0203638 | Ga0500658_0203638_194_763 | 187 |
| 130 | 3300053136 | Ga0500559_0000068 | Ga0500559_0000068_33305_33874 | 187 |
| 131 | 3300053731 | Ga0500609_001541 | Ga0500609_001541_215_784 | 187 |
| 132 | 3300059492 | Ga0587073_0107869 | Ga0587073_0107869_50_646 | 187 |
| 133 | 3300013102 | Ga0157371_10000746 | Ga0157371_1000074612 | 188 |
| 134 | 3300013105 | Ga0157369_10009601 | Ga0157369_100096019 | 188 |
| 135 | 3300048925 | Ga0496122_0008897 | Ga0496122_0008897_8921_9535 | 188 |
| 136 | 3300048926 | Ga0496123_0005801 | Ga0496123_0005801_10541_11155 | 188 |
| 137 | 3300049665 | Ga0501227_014370 | Ga0501227_014370_196_762 | 188 |
| 138 | 3300049679 | Ga0501249_000241 | Ga0501249_000241_10678_11244 | 188 |
| 139 | 3300049689 | Ga0501260_003692 | Ga0501260_003692_185_751 | 188 |
| 140 | 3300049850 | Ga0501204_000645 | Ga0501204_000645_1810_2376 | 188 |
| 141 | 3300049853 | Ga0501226_016140 | Ga0501226_016140_112_678 | 188 |
| 142 | 3300005327 | Ga0070658_10360231 | Ga0070658_103602311 | 189 |
| 143 | 3300005337 | Ga0070682_100707087 | Ga0070682_1007070871 | 189 |
| 144 | 3300005339 | Ga0070660_100047673 | Ga0070660_1000476734 | 189 |
| 145 | 3300005344 | Ga0070661_100021586 | Ga0070661_1000215863 | 189 |
| 146 | 3300005366 | Ga0070659_100009724 | Ga0070659_1000097244 | 189 |
| 147 | 3300005457 | Ga0070662_100195286 | Ga0070662_1001952862 | 189 |
| 148 | 3300005616 | Ga0068852_100176116 | Ga0068852_1001761163 | 189 |
| 149 | 3300005834 | Ga0068851_10168566 | Ga0068851_101685662 | 189 |
| 150 | 3300013100 | Ga0157373_10028484 | Ga0157373_100284844 | 189 |
| 151 | 3300025321 | Ga0207656_10145807 | Ga0207656_101458071 | 189 |
| 152 | 3300025919 | Ga0207657_10036882 | Ga0207657_100368823 | 189 |
| 153 | 3300025920 | Ga0207649_10046092 | Ga0207649_100460923 | 189 |
| 154 | 3300025932 | Ga0207690_10052655 | Ga0207690_100526552 | 189 |
| 155 | 3300025933 | Ga0207706_10140060 | Ga0207706_101400602 | 189 |
| 156 | 3300025981 | Ga0207640_10060234 | Ga0207640_100602343 | 189 |
| 157 | 3300026041 | Ga0207639_10640905 | Ga0207639_106409052 | 189 |
| 158 | 3300026067 | Ga0207678_10317866 | Ga0207678_103178662 | 189 |
| 159 | 3300026116 | Ga0207674_10396339 | Ga0207674_103963392 | 189 |
| 160 | 3300026142 | Ga0207698_10023402 | Ga0207698_100234021 | 189 |
| 161 | 3300032002 | Ga0307416_100250071 | Ga0307416_1002500712 | 189 |
| 162 | 3300048917 | Ga0496114_0000023 | Ga0496114_0000023_169033_169602 | 189 |
| 163 | 3300001978 | JGI24747J21853_1008045 | JGI24747J21853_10080452 | 190 |
| 164 | 3300001989 | JGI24739J22299_10012725 | JGI24739J22299_100127253 | 190 |
| 165 | 3300001990 | JGI24737J22298_10035985 | JGI24737J22298_100359851 | 190 |
| 166 | 3300001991 | JGI24743J22301_10041086 | JGI24743J22301_100410862 | 190 |
| 167 | 3300002077 | JGI24744J21845_10010078 | JGI24744J21845_100100783 | 190 |
| 168 | 3300005329 | Ga0070683_101017740 | Ga0070683_1010177401 | 190 |
| 169 | 3300005330 | Ga0070690_100777859 | Ga0070690_1007778591 | 190 |
| 170 | 3300005331 | Ga0070670_100027849 | Ga0070670_1000278494 | 190 |
| 171 | 3300005331 | Ga0070670_100168380 | Ga0070670_1001683802 | 190 |
| 172 | 3300005333 | Ga0070677_10023247 | Ga0070677_100232472 | 190 |
| 173 | 3300005337 | Ga0070682_100120607 | Ga0070682_1001206071 | 190 |
| 174 | 3300005338 | Ga0068868_100132132 | Ga0068868_1001321323 | 190 |
| 175 | 3300005339 | Ga0070660_100165032 | Ga0070660_1001650322 | 190 |
| 176 | 3300005341 | Ga0070691_10201352 | Ga0070691_102013522 | 190 |
| 177 | 3300005347 | Ga0070668_100382766 | Ga0070668_1003827661 | 190 |
| 178 | 3300005355 | Ga0070671_100120417 | Ga0070671_1001204172 | 190 |
| 179 | 3300005367 | Ga0070667_100623565 | Ga0070667_1006235651 | 190 |
| 180 | 3300005539 | Ga0068853_100857086 | Ga0068853_1008570861 | 190 |
| 181 | 3300005547 | Ga0070693_100032061 | Ga0070693_1000320614 | 190 |
| 182 | 3300005563 | Ga0068855_100296441 | Ga0068855_1002964413 | 190 |
| 183 | 3300005564 | Ga0070664_100553662 | Ga0070664_1005536622 | 190 |
| 184 | 3300005564 | Ga0070664_101074981 | Ga0070664_1010749811 | 190 |
| 185 | 3300005578 | Ga0068854_100044839 | Ga0068854_1000448393 | 190 |
| 186 | 3300005616 | Ga0068852_100359983 | Ga0068852_1003599832 | 190 |
| 187 | 3300005718 | Ga0068866_10191837 | Ga0068866_101918372 | 190 |
| 188 | 3300005842 | Ga0068858_100885037 | Ga0068858_1008850371 | 190 |
| 189 | 3300005844 | Ga0068862_100004137 | Ga0068862_10000413711 | 190 |
| 190 | 3300006358 | Ga0068871_100268304 | Ga0068871_1002683041 | 190 |
| 191 | 3300006881 | Ga0068865_100111470 | Ga0068865_1001114703 | 190 |
| 192 | 3300009011 | Ga0105251_10064084 | Ga0105251_100640842 | 190 |
| 193 | 3300009101 | Ga0105247_10008857 | Ga0105247_100088573 | 190 |
| 194 | 3300009148 | Ga0105243_10194385 | Ga0105243_101943853 | 190 |
| 195 | 3300009176 | Ga0105242_10268504 | Ga0105242_102685041 | 190 |
| 196 | 3300009177 | Ga0105248_10782696 | Ga0105248_107826962 | 190 |
| 197 | 3300010375 | Ga0105239_11570387 | Ga0105239_115703871 | 190 |
| 198 | 3300013296 | Ga0157374_10911645 | Ga0157374_109116451 | 190 |
| 199 | 3300013297 | Ga0157378_10134691 | Ga0157378_101346912 | 190 |
| 200 | 3300013308 | Ga0157375_10078273 | Ga0157375_100782734 | 190 |
| 201 | 3300025315 | Ga0207697_10012265 | Ga0207697_100122654 | 190 |
| 202 | 3300025893 | Ga0207682_10011433 | Ga0207682_100114332 | 190 |
| 203 | 3300025901 | Ga0207688_10074592 | Ga0207688_100745923 | 190 |
| 204 | 3300025904 | Ga0207647_10044818 | Ga0207647_100448182 | 190 |
| 205 | 3300025919 | Ga0207657_10009896 | Ga0207657_100098964 | 190 |
| 206 | 3300025920 | Ga0207649_10090759 | Ga0207649_100907592 | 190 |
| 207 | 3300025923 | Ga0207681_11081908 | Ga0207681_110819081 | 190 |
| 208 | 3300025925 | Ga0207650_10040331 | Ga0207650_100403313 | 190 |
| 209 | 3300025926 | Ga0207659_10066022 | Ga0207659_100660223 | 190 |
| 210 | 3300025927 | Ga0207687_10142670 | Ga0207687_101426702 | 190 |
| 211 | 3300025935 | Ga0207709_10121523 | Ga0207709_101215233 | 190 |
| 212 | 3300025937 | Ga0207669_10058877 | Ga0207669_100588772 | 190 |
| 213 | 3300025938 | Ga0207704_10065534 | Ga0207704_100655341 | 190 |
| 214 | 3300025942 | Ga0207689_10444050 | Ga0207689_104440501 | 190 |
| 215 | 3300025945 | Ga0207679_10449296 | Ga0207679_104492961 | 190 |
| 216 | 3300025972 | Ga0207668_10428610 | Ga0207668_104286102 | 190 |
| 217 | 3300025981 | Ga0207640_10805236 | Ga0207640_108052361 | 190 |
| 218 | 3300025986 | Ga0207658_10335957 | Ga0207658_103359572 | 190 |
| 219 | 3300026041 | Ga0207639_10265729 | Ga0207639_102657292 | 190 |
| 220 | 3300026067 | Ga0207678_10013180 | Ga0207678_100131807 | 190 |
| 221 | 3300026089 | Ga0207648_10005246 | Ga0207648_1000524610 | 190 |
| 222 | 3300026118 | Ga0207675_100305781 | Ga0207675_1003057812 | 190 |
| 223 | 3300026142 | Ga0207698_11685829 | Ga0207698_116858291 | 190 |
| 224 | 3300028380 | Ga0268265_10012864 | Ga0268265_100128644 | 190 |
| 225 | 3300031548 | Ga0307408_100011145 | Ga0307408_1000111455 | 190 |
| 226 | 3300031731 | Ga0307405_10011098 | Ga0307405_100110984 | 190 |
| 227 | 3300031824 | Ga0307413_10004342 | Ga0307413_100043423 | 190 |
| 228 | 3300031852 | Ga0307410_10036032 | Ga0307410_100360323 | 190 |
| 229 | 3300031901 | Ga0307406_10051324 | Ga0307406_100513243 | 190 |
| 230 | 3300031903 | Ga0307407_10078062 | Ga0307407_100780622 | 190 |
| 231 | 3300031911 | Ga0307412_10008702 | Ga0307412_100087025 | 190 |
| 232 | 3300032002 | Ga0307416_100044363 | Ga0307416_1000443633 | 190 |
| 233 | 3300032004 | Ga0307414_10010035 | Ga0307414_100100355 | 190 |
| 234 | 3300032005 | Ga0307411_10006780 | Ga0307411_100067805 | 190 |
| 235 | 3300032126 | Ga0307415_100008640 | Ga0307415_1000086405 | 190 |
| 236 | 3300039447 | Ga0436361_0547178 | Ga0436361_0547178_10294_10875 | 190 |
| 237 | 3300048906 | Ga0496103_0126531 | Ga0496103_0126531_1039_1611 | 190 |
| 238 | 3300048915 | Ga0496112_0323160 | Ga0496112_0323160_627_1199 | 190 |
| 239 | 3300048916 | Ga0496113_0668311 | Ga0496113_0668311_77_649 | 190 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ryk-assembly1.cif.gz_B | 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound | 0.9888 | 3 | 167 |
| 7pvi-assembly1.cif.gz_BBB | dtdp-sugar epimerase | 0.9783 | 3 | 179 |
| 2ixk-assembly1.cif.gz_B | rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) | 0.9705 | 3 | 173 |
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.968 | 3 | 173 |
| 5buv-assembly2.cif.gz_B-2 | x-ray structure of wbca from yersinia enterocolitica | 0.9603 | 5 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1epzA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9619 | 3 | 169 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9603 | 5 | 167 | 2.60.120.10 |
| 2ixcB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9541 | 5 | 169 | 2.60.120.10 |
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9498 | 5 | 173 | 2.60.120.10 |
| 2c0zA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.949 | 5 | 169 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M9PCM0-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9964 | 3 | 132 |
GO:0000271
GO:0005829 GO:0008830 GO:0019305 |
| AF-A0A2P5LJ26-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9947 | 3 | 134 |
GO:0000271
GO:0005829 GO:0008830 GO:0019305 |
| AF-A0A399FWI2-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9918 | 3 | 167 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A435TQB2-F1-model_v4 | deleted | 0.9915 | 7 | 150 |
|
| AF-V4K2K7-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9907 | 3 | 169 |
GO:0000271
GO:0005829 GO:0008830 GO:0019305 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar