F351868

General Info

Members Datasets Scaffolds Average Seq Length
239 172 234 189

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10064084|Ga0105251_100640842
Length 223
Sequence MVPYPQHIVQGHVEACVRGLSMYEYYDSTRSALMSPVLLAPRRFEDKRGWFSETWNERRVKDAGIDARFCQDNQSLSRETGTLRGLHFQAPPHAQAKLVRCLRGRILDVAVDIRRASPTFGKWLSVELSAANGLQLFIPRGYAHGFLTLEDDCEIAYKVDDFYSAEADGGVAWDDPAIGIDWHLGGRTPLLSDKDAALAPLSSLTVEFPYDGSPLEALRQVQV

Samples

Sample ID Description Type Environment
1 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
2 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
3 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
4 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
62 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
133 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
134 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
155 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
156 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
157 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
158 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
159 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
160 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
163 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
171 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.49
Metatranscriptomes 0.42
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.28
Nodule 0.84
Rhizoplane 2.09
Rhizosphere 86.61
Stem 0
Stem Tuber 0
Unclassified 4.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1008045 3300001978 Bacteria 1024
2 JGI24739J22299_10012725 3300001989 Bacteria 3085
3 JGI24737J22298_10035985 3300001990 Bacteria 1530
4 JGI24743J22301_10041086 3300001991 Bacteria 929
5 JGI24749J21850_1000051 3300002076 Bacteria 22278
6 JGI24744J21845_10010078 3300002077 Bacteria 1937
7 JGI24751J29686_10000156 3300002459 Bacteria 32856
8 JGI25153J46596_10020657 3300003215 Bacteria 2483
9 Ga0055536_1000309 3300003781 Bacteria 36801
10 Ga0065707_10119297 3300005295 Bacteria 2163
11 Ga0070658_10360231 3300005327 Bacteria 1245
12 Ga0070683_101017740 3300005329 Bacteria 795
13 Ga0070690_100777859 3300005330 Bacteria 741
14 Ga0070670_100000003 3300005331 Bacteria 529510
15 Ga0070670_100001680 3300005331 Bacteria 17968
16 Ga0070670_100027849 3300005331 Bacteria 4862
17 Ga0070670_100168380 3300005331 Bacteria 1900
18 Ga0070677_10023247 3300005333 Bacteria 2293
19 Ga0070666_10046231 3300005335 Bacteria 2919
20 Ga0070682_100120607 3300005337 Bacteria 1760
21 Ga0070682_100707087 3300005337 Bacteria 809
22 Ga0068868_100132132 3300005338 Bacteria 2043
23 Ga0070660_100047673 3300005339 Bacteria 3289
24 Ga0070660_100165032 3300005339 Bacteria 1786
25 Ga0070691_10201352 3300005341 Bacteria 1046
26 Ga0070661_100021586 3300005344 Bacteria 4600
27 Ga0070668_100000024 3300005347 Bacteria 94452
28 Ga0070668_100007397 3300005347 Bacteria 8150
29 Ga0070668_100382766 3300005347 Bacteria 1198
30 Ga0070669_100000044 3300005353 Bacteria 121087
31 Ga0070669_100135025 3300005353 Bacteria 1897
32 Ga0070671_100000021 3300005355 Bacteria 127093
33 Ga0070671_100120417 3300005355 Bacteria 2208
34 Ga0070659_100009724 3300005366 Bacteria 7063
35 Ga0070667_100000009 3300005367 Bacteria 281488
36 Ga0070667_100000122 3300005367 Bacteria 99820
37 Ga0070667_100004145 3300005367 Bacteria 12254
38 Ga0070667_100196750 3300005367 Bacteria 1787
39 Ga0070667_100623565 3300005367 Bacteria 994
40 Ga0070662_100195286 3300005457 Bacteria 1603
41 Ga0068853_100857086 3300005539 Bacteria 872
42 Ga0070693_100032061 3300005547 Bacteria 2886
43 Ga0070665_100223426 3300005548 Bacteria 1884
44 Ga0068855_100296441 3300005563 Bacteria 1792
45 Ga0070664_100553662 3300005564 Bacteria 1064
46 Ga0070664_101074981 3300005564 Bacteria 757
47 Ga0068857_100189736 3300005577 Bacteria 1872
48 Ga0068854_100044839 3300005578 Bacteria 3141
49 Ga0068852_100176116 3300005616 Bacteria 2008
50 Ga0068852_100359983 3300005616 Bacteria 1423
51 Ga0068859_100016533 3300005617 Bacteria 7407
52 Ga0068859_100028678 3300005617 Bacteria 5581
53 Ga0068864_100000148 3300005618 Bacteria 66302
54 Ga0068864_100003428 3300005618 Bacteria 13118
55 Ga0068866_10191837 3300005718 Bacteria 1215
56 Ga0068851_10168566 3300005834 Bacteria 1207
57 Ga0068863_100011232 3300005841 Bacteria 8679
58 Ga0068863_100016233 3300005841 Bacteria 7144
59 Ga0068858_100001651 3300005842 Bacteria 22784
60 Ga0068858_100885037 3300005842 Bacteria 873
61 Ga0068860_100000036 3300005843 Bacteria 234917
62 Ga0068860_100000152 3300005843 Bacteria 112187
63 Ga0068862_100000001 3300005844 Bacteria 523031
64 Ga0068862_100000031 3300005844 Bacteria 180203
65 Ga0068862_100004137 3300005844 Bacteria 12298
66 Ga0068862_100207778 3300005844 Bacteria 1768
67 Ga0075366_10219384 3300006195 Bacteria 1158
68 Ga0075370_10086696 3300006353 Bacteria 1803
69 Ga0068871_100268304 3300006358 Bacteria 1490
70 Ga0068865_100111470 3300006881 Bacteria 2019
71 Ga0097620_100016533 3300006931 Bacteria 7407
72 Ga0097620_100028675 3300006931 Bacteria 5581
73 Ga0075435_100761977 3300007076 Bacteria 842
74 Ga0105251_10064084 3300009011 Bacteria 1723
75 Ga0105247_10008857 3300009101 Bacteria 6135
76 Ga0105243_10194385 3300009148 Bacteria 1775
77 Ga0105242_10268504 3300009176 Bacteria 1544
78 Ga0105248_10000359 3300009177 Bacteria 53184
79 Ga0105248_10782696 3300009177 Bacteria 1077
80 Ga0105238_10593676 3300009551 Bacteria 1115
81 Ga0105249_10226952 3300009553 Bacteria 1840
82 Ga0123340_1073879 3300009763 Bacteria 766
83 Ga0123342_1032876 3300009766 Unclassified 2400
84 Ga0105239_11570387 3300010375 Bacteria 761
85 Ga0157373_10028484 3300013100 Bacteria 4030
86 Ga0157371_10000746 3300013102 Bacteria 37817
87 Ga0157369_10009601 3300013105 Bacteria 11065
88 Ga0157374_10911645 3300013296 Bacteria 897
89 Ga0157378_10134691 3300013297 Bacteria 2290
90 Ga0157375_10078273 3300013308 Bacteria 3339
91 Ga0163163_10504902 3300014325 Bacteria 1271
92 Ga0157380_10000199 3300014326 Bacteria 35164
93 Ga0157379_10214914 3300014968 Bacteria 1741
94 Ga0163161_10190793 3300017792 Bacteria 1575
95 Ga0209676_1000070 3300025292 Bacteria 312074
96 Ga0209050_1024416 3300025298 Bacteria 2092
97 Ga0209050_1027952 3300025298 Bacteria 1843
98 Ga0207697_10012265 3300025315 Bacteria 3598
99 Ga0207656_10145807 3300025321 Bacteria 1118
100 Ga0207682_10011433 3300025893 Bacteria 3465
101 Ga0207688_10074592 3300025901 Bacteria 1929
102 Ga0207680_10038378 3300025903 Bacteria 2772
103 Ga0207647_10044818 3300025904 Bacteria 2762
104 Ga0207657_10009896 3300025919 Bacteria 9545
105 Ga0207657_10036882 3300025919 Bacteria 4373
106 Ga0207649_10046092 3300025920 Bacteria 2676
107 Ga0207649_10090759 3300025920 Bacteria 2000
108 Ga0207681_10000041 3300025923 Bacteria 140201
109 Ga0207681_10011298 3300025923 Bacteria 5485
110 Ga0207681_11081908 3300025923 Bacteria 673
111 Ga0207650_10000004 3300025925 Bacteria 743372
112 Ga0207650_10040331 3300025925 Bacteria 3416
113 Ga0207650_10145468 3300025925 Bacteria 1866
114 Ga0207659_10066022 3300025926 Bacteria 2624
115 Ga0207687_10142670 3300025927 Bacteria 1819
116 Ga0207644_10000054 3300025931 Bacteria 86116
117 Ga0207690_10052655 3300025932 Bacteria 2727
118 Ga0207706_10140060 3300025933 Bacteria 2128
119 Ga0207709_10121523 3300025935 Bacteria 1764
120 Ga0207669_10058877 3300025937 Bacteria 2346
121 Ga0207704_10065534 3300025938 Bacteria 2275
122 Ga0207711_10000507 3300025941 Bacteria 40167
123 Ga0207689_10444050 3300025942 Bacteria 1084
124 Ga0207679_10449296 3300025945 Bacteria 1143
125 Ga0207668_10000031 3300025972 Bacteria 122168
126 Ga0207668_10428610 3300025972 Bacteria 1124
127 Ga0207640_10060234 3300025981 Bacteria 2508
128 Ga0207640_10805236 3300025981 Bacteria 814
129 Ga0207658_10000009 3300025986 Bacteria 264118
130 Ga0207658_10000092 3300025986 Bacteria 99965
131 Ga0207658_10163644 3300025986 Bacteria 1825
132 Ga0207658_10335957 3300025986 Bacteria 1312
133 Ga0207703_10001733 3300026035 Bacteria 19622
134 Ga0207639_10265729 3300026041 Bacteria 1503
135 Ga0207639_10640905 3300026041 Bacteria 982
136 Ga0207678_10013180 3300026067 Bacteria 7254
137 Ga0207678_10317866 3300026067 Bacteria 1339
138 Ga0207641_10000306 3300026088 Bacteria 61172
139 Ga0207641_10000742 3300026088 Bacteria 35060
140 Ga0207641_10007702 3300026088 Bacteria 8955
141 Ga0207648_10005246 3300026089 Bacteria 13102
142 Ga0207676_10000006 3300026095 Bacteria 681936
143 Ga0207676_10009952 3300026095 Bacteria 6763
144 Ga0207674_10396339 3300026116 Bacteria 1334
145 Ga0207675_100305781 3300026118 Bacteria 1550
146 Ga0207698_10023402 3300026142 Bacteria 4315
147 Ga0207698_11685829 3300026142 Bacteria 649
148 Ga0268265_10000001 3300028380 Bacteria 1230727
149 Ga0268265_10000118 3300028380 Bacteria 99496
150 Ga0268265_10012864 3300028380 Bacteria 5680
151 Ga0268264_10000001 3300028381 Bacteria 1221000
152 Ga0268264_10000111 3300028381 Bacteria 204718
153 Ga0307408_100011145 3300031548 Bacteria 5938
154 Ga0316576_10290860 3300031727 Bacteria 1222
155 Ga0307405_10011098 3300031731 Bacteria 4703
156 Ga0307405_10073993 3300031731 Bacteria 2201
157 Ga0307413_10004342 3300031824 Bacteria 6154
158 Ga0307413_10388620 3300031824 Bacteria 1089
159 Ga0307413_10401137 3300031824 Bacteria 1074
160 Ga0307410_10036032 3300031852 Bacteria 3218
161 Ga0307410_10204570 3300031852 Bacteria 1509
162 Ga0307406_10051324 3300031901 Bacteria 2618
163 Ga0307406_10328164 3300031901 Bacteria 1186
164 Ga0307407_10078062 3300031903 Bacteria 1993
165 Ga0307412_10008702 3300031911 Bacteria 5806
166 Ga0307412_10088360 3300031911 Bacteria 2162
167 Ga0307412_10123990 3300031911 Bacteria 1865
168 Ga0307412_10137829 3300031911 Bacteria 1783
169 Ga0307412_10152190 3300031911 Bacteria 1708
170 Ga0307412_10741186 3300031911 Bacteria 847
171 Ga0307409_100084197 3300031995 Bacteria 2581
172 Ga0307409_100561878 3300031995 Bacteria 1122
173 Ga0307416_100044363 3300032002 Bacteria 3490
174 Ga0307416_100045891 3300032002 Bacteria 3444
175 Ga0307416_100250071 3300032002 Bacteria 1725
176 Ga0307414_10010035 3300032004 Bacteria 5472
177 Ga0307414_10494706 3300032004 Bacteria 1081
178 Ga0307414_10519439 3300032004 Bacteria 1056
179 Ga0307414_10828921 3300032004 Bacteria 845
180 Ga0307411_10006780 3300032005 Bacteria 5765
181 Ga0307411_10090493 3300032005 Bacteria 2134
182 Ga0307415_100008640 3300032126 Bacteria 5659
183 Ga0316584_0260878 3300036712 Bacteria 1264
184 Ga0395900_0288871 3300037418 Bacteria 1629
185 Ga0395905_0227219 3300037471 Bacteria 1746
186 Ga0395901_0015051 3300038443 Bacteria 7867
187 Ga0395901_0216710 3300038443 Bacteria 2002
188 Ga0400483_021923 3300039062 Bacteria 1069
189 Ga0400483_232920 3300039062 Bacteria 1349
190 Ga0436361_0547178 3300039447 Bacteria 17760
191 Ga0451807_2189743 3300041486 Bacteria 833
192 Ga0451853_0051956 3300041512 Bacteria 807
193 Ga0439441_005745 3300042001 Bacteria 1940
194 Ga0439459_0083983 3300042438 Bacteria 756
195 Ga0466973_0422730 3300044659 Bacteria 801
196 Ga0495638_0007795 3300046460 Bacteria 7646
197 Ga0495607_0088189 3300046501 Bacteria 1687
198 Ga0495616_0000016 3300046513 Bacteria 182686
199 Ga0495632_0000597 3300046519 Bacteria 33515
200 Ga0495632_0058593 3300046519 Bacteria 1876
201 Ga0495648_0216705 3300046524 Bacteria 947
202 Ga0495654_0056642 3300046530 Bacteria 1894
203 Ga0495668_0009308 3300046616 Bacteria 6039
204 Ga0495659_0021533 3300046664 Bacteria 2173
205 Ga0495671_0048850 3300046692 Bacteria 2110
206 Ga0495660_0140125 3300046810 Bacteria 1204
207 Ga0495686_0069767 3300047472 Bacteria 2166
208 Ga0496103_0126531 3300048906 Bacteria 1630
209 Ga0496112_0323160 3300048915 Bacteria 1487
210 Ga0496113_0668311 3300048916 Bacteria 830
211 Ga0496114_0000023 3300048917 Bacteria 219092
212 Ga0496122_0008897 3300048925 Bacteria 10700
213 Ga0496123_0005801 3300048926 Bacteria 12262
214 Ga0496125_0032260 3300048928 Bacteria 4655
215 Ga0501034_1019062 3300049571 Bacteria 711
216 Ga0501227_014370 3300049665 Bacteria 1757
217 Ga0501242_003417 3300049674 Bacteria 1718
218 Ga0501249_000241 3300049679 Bacteria 16238
219 Ga0501250_024159 3300049680 Bacteria 808
220 Ga0501260_003692 3300049689 Bacteria 1386
221 Ga0501241_018564 3300049758 Bacteria 1274
222 Ga0501268_002932 3300049765 Bacteria 2294
223 Ga0501044_0110765 3300049823 Bacteria 2754
224 Ga0501204_000645 3300049850 Bacteria 3123
225 Ga0501226_016140 3300049853 Bacteria 822
226 nmdc:mga00v17_320425_c1 3300050491 Bacteria 1007
227 nmdc:mga0k408_75837_c1 3300050493 Bacteria 1965
228 Ga0500643_015469 3300053087 Bacteria 2616
229 Ga0500618_000014 3300053125 Bacteria 177186
230 Ga0500658_0203638 3300053134 Bacteria 905
231 Ga0500559_0000068 3300053136 Bacteria 82896
232 Ga0500559_0004761 3300053136 Bacteria 6361
233 Ga0500609_001541 3300053731 Bacteria 3365
234 Ga0587073_0107869 3300059492 Bacteria 733

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031911 Ga0307412_10123990 Ga0307412_101239902 167
2 3300005844 Ga0068862_100207778 Ga0068862_1002077782 175
3 3300014968 Ga0157379_10214914 Ga0157379_102149142 175
4 3300005367 Ga0070667_100196750 Ga0070667_1001967502 176
5 3300025986 Ga0207658_10163644 Ga0207658_101636442 176
6 iso_pu_bacteria 2995392953 2995393992 177
7 3300003781 Ga0055536_1000309 Ga0055536_10003098 178
8 3300025292 Ga0209676_1000070 Ga0209676_100007097 178
9 3300025298 Ga0209050_1027952 Ga0209050_10279522 178
10 3300031727 Ga0316576_10290860 Ga0316576_102908602 178
11 3300032004 Ga0307414_10828921 Ga0307414_108289212 178
12 3300036712 Ga0316584_0260878 Ga0316584_0260878_138_698 178
13 iso_pu_bacteria 2919138771 2919143041 178
14 3300009763 Ga0123340_1073879 Ga0123340_10738791 179
15 3300009766 Ga0123342_1032876 Ga0123342_10328762 179
16 3300049758 Ga0501241_018564 Ga0501241_018564_478_1044 180
17 3300039062 Ga0400483_021923 Ga0400483_021923_251_820 181
18 3300039062 Ga0400483_232920 Ga0400483_232920_569_1138 181
19 3300049571 Ga0501034_1019062 Ga0501034_1019062_124_699 181
20 3300048928 Ga0496125_0032260 Ga0496125_0032260_67_618 183
21 iso_pu_bacteria 2643221605 2644039822 183
22 iso_pu_bacteria 8057101203 8057104533 183
23 3300053087 Ga0500643_015469 Ga0500643_015469_1505_2071 184
24 3300002076 JGI24749J21850_1000051 JGI24749J21850_10000518 185
25 3300002459 JGI24751J29686_10000156 JGI24751J29686_100001563 185
26 3300005295 Ga0065707_10119297 Ga0065707_101192972 185
27 3300005331 Ga0070670_100000003 Ga0070670_10000000327 185
28 3300005331 Ga0070670_100001680 Ga0070670_10000168014 185
29 3300005335 Ga0070666_10046231 Ga0070666_100462312 185
30 3300005347 Ga0070668_100000024 Ga0070668_10000002469 185
31 3300005347 Ga0070668_100007397 Ga0070668_1000073974 185
32 3300005353 Ga0070669_100000044 Ga0070669_10000004487 185
33 3300005353 Ga0070669_100135025 Ga0070669_1001350252 185
34 3300005355 Ga0070671_100000021 Ga0070671_10000002123 185
35 3300005367 Ga0070667_100000009 Ga0070667_100000009152 185
36 3300005367 Ga0070667_100000122 Ga0070667_10000012258 185
37 3300005367 Ga0070667_100004145 Ga0070667_10000414511 185
38 3300005548 Ga0070665_100223426 Ga0070665_1002234262 185
39 3300005577 Ga0068857_100189736 Ga0068857_1001897361 185
40 3300005617 Ga0068859_100016533 Ga0068859_1000165336 185
41 3300005617 Ga0068859_100028678 Ga0068859_1000286786 185
42 3300005618 Ga0068864_100000148 Ga0068864_10000014834 185
43 3300005618 Ga0068864_100003428 Ga0068864_10000342810 185
44 3300005841 Ga0068863_100011232 Ga0068863_1000112329 185
45 3300005841 Ga0068863_100016233 Ga0068863_1000162336 185
46 3300005842 Ga0068858_100001651 Ga0068858_1000016513 185
47 3300005843 Ga0068860_100000036 Ga0068860_10000003616 185
48 3300005843 Ga0068860_100000152 Ga0068860_10000015256 185
49 3300005844 Ga0068862_100000001 Ga0068862_100000001512 185
50 3300005844 Ga0068862_100000031 Ga0068862_100000031145 185
51 3300006931 Ga0097620_100016533 Ga0097620_1000165333 185
52 3300006931 Ga0097620_100028675 Ga0097620_1000286752 185
53 3300009177 Ga0105248_10000359 Ga0105248_1000035914 185
54 3300009551 Ga0105238_10593676 Ga0105238_105936762 185
55 3300009553 Ga0105249_10226952 Ga0105249_102269522 185
56 3300014325 Ga0163163_10504902 Ga0163163_105049022 185
57 3300014326 Ga0157380_10000199 Ga0157380_1000019924 185
58 3300017792 Ga0163161_10190793 Ga0163161_101907932 185
59 3300025903 Ga0207680_10038378 Ga0207680_100383783 185
60 3300025923 Ga0207681_10000041 Ga0207681_1000004144 185
61 3300025923 Ga0207681_10011298 Ga0207681_100112983 185
62 3300025925 Ga0207650_10000004 Ga0207650_1000000425 185
63 3300025925 Ga0207650_10145468 Ga0207650_101454682 185
64 3300025931 Ga0207644_10000054 Ga0207644_1000005469 185
65 3300025941 Ga0207711_10000507 Ga0207711_100005079 185
66 3300025972 Ga0207668_10000031 Ga0207668_1000003166 185
67 3300025986 Ga0207658_10000009 Ga0207658_10000009115 185
68 3300025986 Ga0207658_10000092 Ga0207658_1000009245 185
69 3300026035 Ga0207703_10001733 Ga0207703_1000173313 185
70 3300026088 Ga0207641_10000306 Ga0207641_1000030639 185
71 3300026088 Ga0207641_10000742 Ga0207641_1000074233 185
72 3300026088 Ga0207641_10007702 Ga0207641_100077024 185
73 3300026095 Ga0207676_10000006 Ga0207676_10000006687 185
74 3300026095 Ga0207676_10009952 Ga0207676_100099521 185
75 3300028380 Ga0268265_10000001 Ga0268265_10000001525 185
76 3300028380 Ga0268265_10000118 Ga0268265_1000011810 185
77 3300028381 Ga0268264_10000001 Ga0268264_10000001115 185
78 3300028381 Ga0268264_10000111 Ga0268264_1000011141 185
79 3300031911 Ga0307412_10088360 Ga0307412_100883603 185
80 3300031911 Ga0307412_10152190 Ga0307412_101521902 185
81 3300041486 Ga0451807_2189743 Ga0451807_2189743_192_773 185
82 3300044659 Ga0466973_0422730 Ga0466973_0422730_110_667 185
83 3300049823 Ga0501044_0110765 Ga0501044_0110765_2178_2735 185
84 3300050491 nmdc:mga00v17_320425_c1 nmdc:mga00v17_320425_c1_156_713 185
85 3300053136 Ga0500559_0004761 Ga0500559_0004761_628_1200 185
86 iso_pu_bacteria 2643221552 2643782982 185
87 3300031911 Ga0307412_10741186 Ga0307412_107411861 186
88 3300031995 Ga0307409_100561878 Ga0307409_1005618782 186
89 3300032002 Ga0307416_100045891 Ga0307416_1000458913 186
90 3300032004 Ga0307414_10494706 Ga0307414_104947062 186
91 3300003215 JGI25153J46596_10020657 JGI25153J46596_100206572 187
92 3300006195 Ga0075366_10219384 Ga0075366_102193842 187
93 3300006353 Ga0075370_10086696 Ga0075370_100866963 187
94 3300007076 Ga0075435_100761977 Ga0075435_1007619772 187
95 3300025298 Ga0209050_1024416 Ga0209050_10244162 187
96 3300031731 Ga0307405_10073993 Ga0307405_100739931 187
97 3300031824 Ga0307413_10388620 Ga0307413_103886201 187
98 3300031824 Ga0307413_10401137 Ga0307413_104011372 187
99 3300031852 Ga0307410_10204570 Ga0307410_102045702 187
100 3300031901 Ga0307406_10328164 Ga0307406_103281642 187
101 3300031911 Ga0307412_10137829 Ga0307412_101378292 187
102 3300031995 Ga0307409_100084197 Ga0307409_1000841972 187
103 3300032004 Ga0307414_10519439 Ga0307414_105194392 187
104 3300032005 Ga0307411_10090493 Ga0307411_100904933 187
105 3300037418 Ga0395900_0288871 Ga0395900_0288871_553_1119 187
106 3300037471 Ga0395905_0227219 Ga0395905_0227219_606_1172 187
107 3300038443 Ga0395901_0015051 Ga0395901_0015051_6914_7477 187
108 3300038443 Ga0395901_0216710 Ga0395901_0216710_1103_1669 187
109 3300041512 Ga0451853_0051956 Ga0451853_0051956_31_651 187
110 3300042001 Ga0439441_005745 Ga0439441_005745_835_1455 187
111 3300042438 Ga0439459_0083983 Ga0439459_0083983_97_717 187
112 3300046460 Ga0495638_0007795 Ga0495638_0007795_926_1495 187
113 3300046501 Ga0495607_0088189 Ga0495607_0088189_277_846 187
114 3300046513 Ga0495616_0000016 Ga0495616_0000016_92103_92672 187
115 3300046519 Ga0495632_0000597 Ga0495632_0000597_27181_27750 187
116 3300046519 Ga0495632_0058593 Ga0495632_0058593_1190_1759 187
117 3300046524 Ga0495648_0216705 Ga0495648_0216705_337_906 187
118 3300046530 Ga0495654_0056642 Ga0495654_0056642_87_656 187
119 3300046616 Ga0495668_0009308 Ga0495668_0009308_1972_2592 187
120 3300046664 Ga0495659_0021533 Ga0495659_0021533_10_579 187
121 3300046692 Ga0495671_0048850 Ga0495671_0048850_513_1076 187
122 3300046810 Ga0495660_0140125 Ga0495660_0140125_385_1005 187
123 3300047472 Ga0495686_0069767 Ga0495686_0069767_336_899 187
124 3300049674 Ga0501242_003417 Ga0501242_003417_795_1361 187
125 3300049680 Ga0501250_024159 Ga0501250_024159_140_706 187
126 3300049765 Ga0501268_002932 Ga0501268_002932_1219_1785 187
127 3300050493 nmdc:mga0k408_75837_c1 nmdc:mga0k408_75837_c1_1233_1853 187
128 3300053125 Ga0500618_000014 Ga0500618_000014_66066_66635 187
129 3300053134 Ga0500658_0203638 Ga0500658_0203638_194_763 187
130 3300053136 Ga0500559_0000068 Ga0500559_0000068_33305_33874 187
131 3300053731 Ga0500609_001541 Ga0500609_001541_215_784 187
132 3300059492 Ga0587073_0107869 Ga0587073_0107869_50_646 187
133 3300013102 Ga0157371_10000746 Ga0157371_1000074612 188
134 3300013105 Ga0157369_10009601 Ga0157369_100096019 188
135 3300048925 Ga0496122_0008897 Ga0496122_0008897_8921_9535 188
136 3300048926 Ga0496123_0005801 Ga0496123_0005801_10541_11155 188
137 3300049665 Ga0501227_014370 Ga0501227_014370_196_762 188
138 3300049679 Ga0501249_000241 Ga0501249_000241_10678_11244 188
139 3300049689 Ga0501260_003692 Ga0501260_003692_185_751 188
140 3300049850 Ga0501204_000645 Ga0501204_000645_1810_2376 188
141 3300049853 Ga0501226_016140 Ga0501226_016140_112_678 188
142 3300005327 Ga0070658_10360231 Ga0070658_103602311 189
143 3300005337 Ga0070682_100707087 Ga0070682_1007070871 189
144 3300005339 Ga0070660_100047673 Ga0070660_1000476734 189
145 3300005344 Ga0070661_100021586 Ga0070661_1000215863 189
146 3300005366 Ga0070659_100009724 Ga0070659_1000097244 189
147 3300005457 Ga0070662_100195286 Ga0070662_1001952862 189
148 3300005616 Ga0068852_100176116 Ga0068852_1001761163 189
149 3300005834 Ga0068851_10168566 Ga0068851_101685662 189
150 3300013100 Ga0157373_10028484 Ga0157373_100284844 189
151 3300025321 Ga0207656_10145807 Ga0207656_101458071 189
152 3300025919 Ga0207657_10036882 Ga0207657_100368823 189
153 3300025920 Ga0207649_10046092 Ga0207649_100460923 189
154 3300025932 Ga0207690_10052655 Ga0207690_100526552 189
155 3300025933 Ga0207706_10140060 Ga0207706_101400602 189
156 3300025981 Ga0207640_10060234 Ga0207640_100602343 189
157 3300026041 Ga0207639_10640905 Ga0207639_106409052 189
158 3300026067 Ga0207678_10317866 Ga0207678_103178662 189
159 3300026116 Ga0207674_10396339 Ga0207674_103963392 189
160 3300026142 Ga0207698_10023402 Ga0207698_100234021 189
161 3300032002 Ga0307416_100250071 Ga0307416_1002500712 189
162 3300048917 Ga0496114_0000023 Ga0496114_0000023_169033_169602 189
163 3300001978 JGI24747J21853_1008045 JGI24747J21853_10080452 190
164 3300001989 JGI24739J22299_10012725 JGI24739J22299_100127253 190
165 3300001990 JGI24737J22298_10035985 JGI24737J22298_100359851 190
166 3300001991 JGI24743J22301_10041086 JGI24743J22301_100410862 190
167 3300002077 JGI24744J21845_10010078 JGI24744J21845_100100783 190
168 3300005329 Ga0070683_101017740 Ga0070683_1010177401 190
169 3300005330 Ga0070690_100777859 Ga0070690_1007778591 190
170 3300005331 Ga0070670_100027849 Ga0070670_1000278494 190
171 3300005331 Ga0070670_100168380 Ga0070670_1001683802 190
172 3300005333 Ga0070677_10023247 Ga0070677_100232472 190
173 3300005337 Ga0070682_100120607 Ga0070682_1001206071 190
174 3300005338 Ga0068868_100132132 Ga0068868_1001321323 190
175 3300005339 Ga0070660_100165032 Ga0070660_1001650322 190
176 3300005341 Ga0070691_10201352 Ga0070691_102013522 190
177 3300005347 Ga0070668_100382766 Ga0070668_1003827661 190
178 3300005355 Ga0070671_100120417 Ga0070671_1001204172 190
179 3300005367 Ga0070667_100623565 Ga0070667_1006235651 190
180 3300005539 Ga0068853_100857086 Ga0068853_1008570861 190
181 3300005547 Ga0070693_100032061 Ga0070693_1000320614 190
182 3300005563 Ga0068855_100296441 Ga0068855_1002964413 190
183 3300005564 Ga0070664_100553662 Ga0070664_1005536622 190
184 3300005564 Ga0070664_101074981 Ga0070664_1010749811 190
185 3300005578 Ga0068854_100044839 Ga0068854_1000448393 190
186 3300005616 Ga0068852_100359983 Ga0068852_1003599832 190
187 3300005718 Ga0068866_10191837 Ga0068866_101918372 190
188 3300005842 Ga0068858_100885037 Ga0068858_1008850371 190
189 3300005844 Ga0068862_100004137 Ga0068862_10000413711 190
190 3300006358 Ga0068871_100268304 Ga0068871_1002683041 190
191 3300006881 Ga0068865_100111470 Ga0068865_1001114703 190
192 3300009011 Ga0105251_10064084 Ga0105251_100640842 190
193 3300009101 Ga0105247_10008857 Ga0105247_100088573 190
194 3300009148 Ga0105243_10194385 Ga0105243_101943853 190
195 3300009176 Ga0105242_10268504 Ga0105242_102685041 190
196 3300009177 Ga0105248_10782696 Ga0105248_107826962 190
197 3300010375 Ga0105239_11570387 Ga0105239_115703871 190
198 3300013296 Ga0157374_10911645 Ga0157374_109116451 190
199 3300013297 Ga0157378_10134691 Ga0157378_101346912 190
200 3300013308 Ga0157375_10078273 Ga0157375_100782734 190
201 3300025315 Ga0207697_10012265 Ga0207697_100122654 190
202 3300025893 Ga0207682_10011433 Ga0207682_100114332 190
203 3300025901 Ga0207688_10074592 Ga0207688_100745923 190
204 3300025904 Ga0207647_10044818 Ga0207647_100448182 190
205 3300025919 Ga0207657_10009896 Ga0207657_100098964 190
206 3300025920 Ga0207649_10090759 Ga0207649_100907592 190
207 3300025923 Ga0207681_11081908 Ga0207681_110819081 190
208 3300025925 Ga0207650_10040331 Ga0207650_100403313 190
209 3300025926 Ga0207659_10066022 Ga0207659_100660223 190
210 3300025927 Ga0207687_10142670 Ga0207687_101426702 190
211 3300025935 Ga0207709_10121523 Ga0207709_101215233 190
212 3300025937 Ga0207669_10058877 Ga0207669_100588772 190
213 3300025938 Ga0207704_10065534 Ga0207704_100655341 190
214 3300025942 Ga0207689_10444050 Ga0207689_104440501 190
215 3300025945 Ga0207679_10449296 Ga0207679_104492961 190
216 3300025972 Ga0207668_10428610 Ga0207668_104286102 190
217 3300025981 Ga0207640_10805236 Ga0207640_108052361 190
218 3300025986 Ga0207658_10335957 Ga0207658_103359572 190
219 3300026041 Ga0207639_10265729 Ga0207639_102657292 190
220 3300026067 Ga0207678_10013180 Ga0207678_100131807 190
221 3300026089 Ga0207648_10005246 Ga0207648_1000524610 190
222 3300026118 Ga0207675_100305781 Ga0207675_1003057812 190
223 3300026142 Ga0207698_11685829 Ga0207698_116858291 190
224 3300028380 Ga0268265_10012864 Ga0268265_100128644 190
225 3300031548 Ga0307408_100011145 Ga0307408_1000111455 190
226 3300031731 Ga0307405_10011098 Ga0307405_100110984 190
227 3300031824 Ga0307413_10004342 Ga0307413_100043423 190
228 3300031852 Ga0307410_10036032 Ga0307410_100360323 190
229 3300031901 Ga0307406_10051324 Ga0307406_100513243 190
230 3300031903 Ga0307407_10078062 Ga0307407_100780622 190
231 3300031911 Ga0307412_10008702 Ga0307412_100087025 190
232 3300032002 Ga0307416_100044363 Ga0307416_1000443633 190
233 3300032004 Ga0307414_10010035 Ga0307414_100100355 190
234 3300032005 Ga0307411_10006780 Ga0307411_100067805 190
235 3300032126 Ga0307415_100008640 Ga0307415_1000086405 190
236 3300039447 Ga0436361_0547178 Ga0436361_0547178_10294_10875 190
237 3300048906 Ga0496103_0126531 Ga0496103_0126531_1039_1611 190
238 3300048915 Ga0496112_0323160 Ga0496112_0323160_627_1199 190
239 3300048916 Ga0496113_0668311 Ga0496113_0668311_77_649 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

30

203

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9888 3 167
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9783 3 179
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9705 3 173
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.968 3 173
5buv-assembly2.cif.gz_B-2 x-ray structure of wbca from yersinia enterocolitica 0.9603 5 167
ID Description Score Start End Superfamily
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9619 3 169 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9603 5 167 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9541 5 169 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9498 5 173 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.949 5 169 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2M9PCM0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9964 3 132 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A2P5LJ26-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9947 3 134 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A399FWI2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9918 3 167 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A435TQB2-F1-model_v4 deleted 0.9915 7 150
AF-V4K2K7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9907 3 169 GO:0000271
GO:0005829
GO:0008830
GO:0019305

Feature Viewer

pLDDT pTM Quality
96.72 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map