F351710

General Info

Members Datasets Scaffolds Average Seq Length
239 170 478 165

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100027213|Ga0070708_1000272134
Length 183
Sequence MYRRGHAEHLVWERTHIMILGMTTSTFTFVHVLLSLVGIGSGFVVVFGLLTGKRLDGWTGLFLATTVATSVTGFGFPFDHLLPSHKVGIISLVVLAVAILARYAFHLAGAWRRIYVISAAVALYLNVFVFIVQAFEKVPALRAMAPTQKEPPFLVAQLVVLAVFVGLTILAAKGFHTQPARAA

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
82 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 0.42
Rhizosphere 96.65
Stem 0
Stem Tuber 0
Unclassified 24.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100027213 3300005445 Bacteria 4904
2 Ga0065712_10010875 3300005290 Bacteria 2555
3 Ga0065715_10020991 3300005293 Bacteria 2445
4 Ga0065707_10002394 3300005295 Bacteria 4650
5 Ga0070676_10117412 3300005328 Unclassified 1665
6 Ga0070676_10304709 3300005328 Bacteria 1081
7 Ga0070690_100319546 3300005330 Bacteria 1118
8 Ga0070670_100017265 3300005331 Bacteria 6189
9 Ga0068869_100003155 3300005334 Bacteria 10061
10 Ga0068869_100067281 3300005334 Bacteria 2642
11 Ga0070666_10010377 3300005335 Bacteria 5824
12 Ga0070666_10597760 3300005335 Bacteria 805
13 Ga0070680_100269836 3300005336 Bacteria 1440
14 Ga0068868_100503484 3300005338 Unclassified 1061
15 Ga0070689_100157182 3300005340 Bacteria 1836
16 Ga0070661_101075413 3300005344 Unclassified 669
17 Ga0070668_100138576 3300005347 Bacteria 1959
18 Ga0070668_100326482 3300005347 Bacteria 1293
19 Ga0070669_100015714 3300005353 Bacteria 5398
20 Ga0070669_100139277 3300005353 Bacteria 1869
21 Ga0070675_100015877 3300005354 Bacteria 5963
22 Ga0070674_100000371 3300005356 Bacteria 22500
23 Ga0070674_100137691 3300005356 Bacteria 1828
24 Ga0070659_100055011 3300005366 Bacteria 3135
25 Ga0070667_100037570 3300005367 Bacteria 4060
26 Ga0070667_100516258 3300005367 Bacteria 1096
27 Ga0070714_101914385 3300005435 Unclassified 579
28 Ga0070711_100061094 3300005439 Bacteria 2622
29 Ga0070711_100178794 3300005439 Bacteria 1623
30 Ga0070694_100299317 3300005444 Bacteria 1232
31 Ga0070708_100001240 3300005445 Bacteria 19632
32 Ga0070708_100011763 3300005445 Bacteria 7120
33 Ga0070708_101303716 3300005445 Bacteria 678
34 Ga0070663_100843692 3300005455 Bacteria 788
35 Ga0070662_100225112 3300005457 Unclassified 1498
36 Ga0070681_10456023 3300005458 Bacteria 1191
37 Ga0068867_100044959 3300005459 Bacteria 3236
38 Ga0070706_100000923 3300005467 Bacteria 32144
39 Ga0070706_100024078 3300005467 Bacteria 5605
40 Ga0070706_100029055 3300005467 Bacteria 5093
41 Ga0070706_100153966 3300005467 Unclassified 2146
42 Ga0070707_100132749 3300005468 Bacteria 2422
43 Ga0070698_100000807 3300005471 Bacteria 34196
44 Ga0070699_100009824 3300005518 Bacteria 8281
45 Ga0070699_100102698 3300005518 Bacteria 2507
46 Ga0070684_100184263 3300005535 Bacteria 1898
47 Ga0070697_100002742 3300005536 Bacteria 13558
48 Ga0070697_100008629 3300005536 Bacteria 7958
49 Ga0070697_100009281 3300005536 Bacteria 7688
50 Ga0070697_100154978 3300005536 Unclassified 1933
51 Ga0070697_101231798 3300005536 Bacteria 667
52 Ga0068853_100164473 3300005539 Bacteria 2004
53 Ga0070672_100030871 3300005543 Bacteria 4029
54 Ga0070672_100078142 3300005543 Bacteria 2647
55 Ga0070696_100091713 3300005546 Bacteria 2164
56 Ga0070696_100115446 3300005546 Bacteria 1937
57 Ga0070693_100202002 3300005547 Bacteria 1291
58 Ga0070665_100921380 3300005548 Unclassified 886
59 Ga0070704_100315760 3300005549 Bacteria 1307
60 Ga0068855_100094391 3300005563 Bacteria 3449
61 Ga0070664_100106121 3300005564 Bacteria 2447
62 Ga0070664_100329861 3300005564 Bacteria 1384
63 Ga0068857_100029864 3300005577 Bacteria 4810
64 Ga0068857_100473528 3300005577 Bacteria 1173
65 Ga0068857_100482206 3300005577 Bacteria 1162
66 Ga0068859_100186478 3300005617 Unclassified 2158
67 Ga0068864_101682337 3300005618 Bacteria 639
68 Ga0068861_100614270 3300005719 Bacteria 1000
69 Ga0068861_102188469 3300005719 Bacteria 554
70 Ga0068870_10041372 3300005840 Unclassified 2394
71 Ga0068863_100987450 3300005841 Unclassified 844
72 Ga0068863_101310337 3300005841 Bacteria 731
73 Ga0068860_100000251 3300005843 Bacteria 79943
74 Ga0068860_100325585 3300005843 Bacteria 1509
75 Ga0068862_100071565 3300005844 Bacteria 2994
76 Ga0081538_10015852 3300005981 Bacteria 5811
77 Ga0097621_100032583 3300006237 Bacteria 4145
78 Ga0068871_100013467 3300006358 Bacteria 6071
79 Ga0075428_100761251 3300006844 Bacteria 1030
80 Ga0075428_100929035 3300006844 Unclassified 922
81 Ga0075430_100646580 3300006846 Unclassified 872
82 Ga0075433_10245681 3300006852 Unclassified 1589
83 Ga0075434_100958451 3300006871 Unclassified 870
84 Ga0075429_100027932 3300006880 Bacteria 4898
85 Ga0097620_100186482 3300006931 Unclassified 2158
86 Ga0099795_10111820 3300007788 Bacteria 1083
87 Ga0099795_10172355 3300007788 Bacteria 899
88 Ga0105240_10458364 3300009093 Bacteria 1425
89 Ga0105245_10010357 3300009098 Bacteria 8122
90 Ga0114129_10028737 3300009147 Bacteria 7878
91 Ga0114129_10029339 3300009147 Bacteria 7793
92 Ga0114129_10029978 3300009147 Bacteria 7703
93 Ga0114129_10085164 3300009147 Bacteria 4385
94 Ga0105241_10067904 3300009174 Bacteria 2761
95 Ga0105242_10008990 3300009176 Bacteria 7671
96 Ga0105242_10280177 3300009176 Bacteria 1514
97 Ga0105242_11224689 3300009176 Unclassified 771
98 Ga0105248_10815481 3300009177 Unclassified 1053
99 Ga0105237_10029853 3300009545 Bacteria 5538
100 Ga0105237_10105915 3300009545 Bacteria 2803
101 Ga0105238_10017414 3300009551 Bacteria 7301
102 Ga0105249_10173969 3300009553 Bacteria 2090
103 Ga0105249_10566890 3300009553 Bacteria 1188
104 Ga0105249_10979016 3300009553 Bacteria 914
105 Ga0099796_10014554 3300010159 Unclassified 2275
106 Ga0099796_10016919 3300010159 Bacteria 2162
107 Ga0099796_10149100 3300010159 Bacteria 920
108 Ga0105239_10041078 3300010375 Bacteria 5068
109 Ga0105246_10019818 3300011119 Bacteria 4308
110 Ga0157374_10061922 3300013296 Bacteria 3506
111 Ga0157378_10040242 3300013297 Bacteria 4144
112 Ga0163162_11169150 3300013306 Unclassified 873
113 Ga0163162_11667151 3300013306 Bacteria 728
114 Ga0157372_10198164 3300013307 Unclassified 2326
115 Ga0157375_10119918 3300013308 Bacteria 2738
116 Ga0157375_10638824 3300013308 Bacteria 1221
117 Ga0163163_10162857 3300014325 Unclassified 2276
118 Ga0157380_10004336 3300014326 Bacteria 9838
119 Ga0157380_10760107 3300014326 Bacteria 982
120 Ga0157379_10149740 3300014968 Bacteria 2105
121 Ga0157376_10093563 3300014969 Bacteria 2610
122 Ga0213876_10451516 3300021384 Unclassified 684
123 Ga0224571_100076 3300022734 Bacteria 3645
124 Ga0228598_1009871 3300024227 Bacteria 1907
125 Ga0207682_10015235 3300025893 Bacteria 2992
126 Ga0207642_10116469 3300025899 Bacteria 1370
127 Ga0207688_10009304 3300025901 Bacteria 5355
128 Ga0207680_10020952 3300025903 Unclassified 3530
129 Ga0207645_10138555 3300025907 Unclassified 1585
130 Ga0207645_10309174 3300025907 Bacteria 1053
131 Ga0207643_10052876 3300025908 Unclassified 2307
132 Ga0207684_10003809 3300025910 Bacteria 14546
133 Ga0207684_10011548 3300025910 Bacteria 7717
134 Ga0207684_10284917 3300025910 Bacteria 1425
135 Ga0207654_10106043 3300025911 Bacteria 1740
136 Ga0207695_10452418 3300025913 Bacteria 1167
137 Ga0207671_10024083 3300025914 Bacteria 4582
138 Ga0207663_10048680 3300025916 Bacteria 2625
139 Ga0207649_10935369 3300025920 Unclassified 680
140 Ga0207646_10189856 3300025922 Bacteria 1855
141 Ga0207681_10032906 3300025923 Bacteria 3397
142 Ga0207694_10068546 3300025924 Bacteria 2770
143 Ga0207650_10139711 3300025925 Bacteria 1903
144 Ga0207659_10290144 3300025926 Bacteria 1340
145 Ga0207664_10649905 3300025929 Unclassified 948
146 Ga0207706_10049972 3300025933 Bacteria 3695
147 Ga0207686_10038046 3300025934 Bacteria 2908
148 Ga0207709_10185177 3300025935 Bacteria 1474
149 Ga0207670_10071655 3300025936 Bacteria 2397
150 Ga0207669_10001397 3300025937 Bacteria 10283
151 Ga0207669_10714955 3300025937 Bacteria 824
152 Ga0207691_10052900 3300025940 Bacteria 3708
153 Ga0207689_10063988 3300025942 Bacteria 3026
154 Ga0207689_10379604 3300025942 Unclassified 1177
155 Ga0207661_10278651 3300025944 Bacteria 1494
156 Ga0207679_10070462 3300025945 Bacteria 2635
157 Ga0207679_10828287 3300025945 Bacteria 844
158 Ga0207667_10148830 3300025949 Bacteria 2410
159 Ga0207651_11061971 3300025960 Bacteria 725
160 Ga0207712_10276391 3300025961 Unclassified 1369
161 Ga0207668_10046018 3300025972 Bacteria 2979
162 Ga0207668_10197324 3300025972 Bacteria 1600
163 Ga0207658_10201980 3300025986 Unclassified 1660
164 Ga0207658_10249764 3300025986 Bacteria 1507
165 Ga0207639_10076480 3300026041 Bacteria 2636
166 Ga0207678_11066862 3300026067 Bacteria 715
167 Ga0207678_11432114 3300026067 Unclassified 611
168 Ga0207708_10316540 3300026075 Bacteria 1272
169 Ga0207708_10736009 3300026075 Bacteria 845
170 Ga0207708_11028476 3300026075 Unclassified 716
171 Ga0207702_11058332 3300026078 Bacteria 805
172 Ga0207641_10862445 3300026088 Bacteria 898
173 Ga0207648_10081501 3300026089 Bacteria 2822
174 Ga0207648_10172958 3300026089 Bacteria 1909
175 Ga0207676_10093905 3300026095 Bacteria 2471
176 Ga0207676_11697165 3300026095 Unclassified 630
177 Ga0207674_10052260 3300026116 Bacteria 4168
178 Ga0207674_10268765 3300026116 Bacteria 1652
179 Ga0207674_10331719 3300026116 Bacteria 1471
180 Ga0207675_100006893 3300026118 Bacteria 10761
181 Ga0207675_100063987 3300026118 Bacteria 3437
182 Ga0207683_10031574 3300026121 Bacteria 4597
183 Ga0209588_1091777 3300027671 Unclassified 979
184 Ga0268265_10012961 3300028380 Bacteria 5660
185 Ga0268265_10360771 3300028380 Unclassified 1330
186 Ga0268265_11042890 3300028380 Bacteria 809
187 Ga0268264_10757633 3300028381 Bacteria 968
188 Ga0265338_10063566 3300028800 Bacteria 3217
189 Ga0265338_10163773 3300028800 Bacteria 1714
190 Ga0265328_10337888 3300031239 Unclassified 585
191 Ga0265325_10319261 3300031241 Unclassified 690
192 Ga0265340_10068490 3300031247 Bacteria 1686
193 Ga0265339_10023664 3300031249 Unclassified 3549
194 Ga0265339_10068182 3300031249 Bacteria 1902
195 Ga0265331_10000002 3300031250 Bacteria 511481
196 Ga0265327_10009962 3300031251 Bacteria 6765
197 Ga0265316_10014315 3300031344 Bacteria 6989
198 Ga0307508_10000114 3300031616 Bacteria 95098
199 Ga0265314_10013802 3300031711 Bacteria 6507
200 Ga0265314_10033772 3300031711 Unclassified 3745
201 Ga0265314_10047275 3300031711 Bacteria 3029
202 Ga0373939_0079346 3300035114 Unclassified 1087
203 Ga0373956_0356309 3300035119 Bacteria 697
204 Ga0373927_0235573 3300035695 Bacteria 1203
205 Ga0373937_0069042 3300036401 Bacteria 3258
206 Ga0265778_004907 3300036457 Bacteria 1402
207 Ga0373925_1040400 3300037068 Unclassified 674
208 Ga0395899_0075453 3300037312 Unclassified 2462
209 Ga0395900_0004122 3300037418 Bacteria 15476
210 Ga0395898_0173916 3300037466 Unclassified 2058
211 Ga0395901_0001693 3300038443 Bacteria 22747
212 Ga0436365_1000303 3300039437 Bacteria 1264
213 Ga0436365_1656950 3300039437 Unclassified 2046
214 Ga0436361_0443738 3300039447 Unclassified 770
215 Ga0451849_0866403 3300041505 Unclassified 544
216 Ga0495603_0135072 3300046455 Unclassified 1436
217 Ga0495580_0022049 3300046472 Bacteria 4693
218 Ga0495580_0479880 3300046472 Unclassified 832
219 Ga0495594_0094090 3300046499 Unclassified 1681
220 Ga0495668_0072073 3300046616 Unclassified 1898
221 Ga0495588_0088601 3300046674 Unclassified 1620
222 Ga0495674_0337259 3300047319 Bacteria 1226
223 Ga0495677_0013675 3300047445 Unclassified 2954
224 Ga0495684_0345265 3300047471 Bacteria 1058
225 Ga0496115_0051520 3300048918 Bacteria 3301
226 Ga0496126_0703313 3300048929 Unclassified 785
227 Ga0501041_0463503 3300049577 Bacteria 805
228 Ga0501067_0001881 3300049583 Bacteria 11513
229 Ga0501068_0167062 3300049584 Bacteria 1388
230 Ga0501080_0013432 3300049742 Bacteria 7535
231 nmdc:mga05p37_1512252_c1 3300050507 Bacteria 668
232 nmdc:mga05p37_246967_c1 3300050507 Bacteria 2142
233 nmdc:mga05p37_261251_c1 3300050507 Bacteria 2072
234 nmdc:mga05p37_674678_c1 3300050507 Bacteria 1153
235 nmdc:mga09592_83739_c1 3300050508 Unclassified 2718
236 nmdc:mga0qj67_610962_c1 3300050509 Unclassified 872
237 nmdc:mga0n895_1641346_c1 3300050512 Unclassified 606
238 Ga0500622_0072153 3300053156 Bacteria 1743
239 Ga0501082_1316853 3300060353 Unclassified 631
240 Ga0070708_100027213
241 Ga0065712_10010875
242 Ga0065715_10020991
243 Ga0065707_10002394
244 Ga0070676_10117412
245 Ga0070676_10304709
246 Ga0070690_100319546
247 Ga0070670_100017265
248 Ga0068869_100003155
249 Ga0068869_100067281
250 Ga0070666_10010377
251 Ga0070666_10597760
252 Ga0070680_100269836
253 Ga0068868_100503484
254 Ga0070689_100157182
255 Ga0070661_101075413
256 Ga0070668_100138576
257 Ga0070668_100326482
258 Ga0070669_100015714
259 Ga0070669_100139277
260 Ga0070675_100015877
261 Ga0070674_100000371
262 Ga0070674_100137691
263 Ga0070659_100055011
264 Ga0070667_100037570
265 Ga0070667_100516258
266 Ga0070714_101914385
267 Ga0070711_100061094
268 Ga0070711_100178794
269 Ga0070694_100299317
270 Ga0070708_100001240
271 Ga0070708_100011763
272 Ga0070708_101303716
273 Ga0070663_100843692
274 Ga0070662_100225112
275 Ga0070681_10456023
276 Ga0068867_100044959
277 Ga0070706_100000923
278 Ga0070706_100024078
279 Ga0070706_100029055
280 Ga0070706_100153966
281 Ga0070707_100132749
282 Ga0070698_100000807
283 Ga0070699_100009824
284 Ga0070699_100102698
285 Ga0070684_100184263
286 Ga0070697_100002742
287 Ga0070697_100008629
288 Ga0070697_100009281
289 Ga0070697_100154978
290 Ga0070697_101231798
291 Ga0068853_100164473
292 Ga0070672_100030871
293 Ga0070672_100078142
294 Ga0070696_100091713
295 Ga0070696_100115446
296 Ga0070693_100202002
297 Ga0070665_100921380
298 Ga0070704_100315760
299 Ga0068855_100094391
300 Ga0070664_100106121
301 Ga0070664_100329861
302 Ga0068857_100029864
303 Ga0068857_100473528
304 Ga0068857_100482206
305 Ga0068859_100186478
306 Ga0068864_101682337
307 Ga0068861_100614270
308 Ga0068861_102188469
309 Ga0068870_10041372
310 Ga0068863_100987450
311 Ga0068863_101310337
312 Ga0068860_100000251
313 Ga0068860_100325585
314 Ga0068862_100071565
315 Ga0081538_10015852
316 Ga0097621_100032583
317 Ga0068871_100013467
318 Ga0075428_100761251
319 Ga0075428_100929035
320 Ga0075430_100646580
321 Ga0075433_10245681
322 Ga0075434_100958451
323 Ga0075429_100027932
324 Ga0097620_100186482
325 Ga0099795_10111820
326 Ga0099795_10172355
327 Ga0105240_10458364
328 Ga0105245_10010357
329 Ga0114129_10028737
330 Ga0114129_10029339
331 Ga0114129_10029978
332 Ga0114129_10085164
333 Ga0105241_10067904
334 Ga0105242_10008990
335 Ga0105242_10280177
336 Ga0105242_11224689
337 Ga0105248_10815481
338 Ga0105237_10029853
339 Ga0105237_10105915
340 Ga0105238_10017414
341 Ga0105249_10173969
342 Ga0105249_10566890
343 Ga0105249_10979016
344 Ga0099796_10014554
345 Ga0099796_10016919
346 Ga0099796_10149100
347 Ga0105239_10041078
348 Ga0105246_10019818
349 Ga0157374_10061922
350 Ga0157378_10040242
351 Ga0163162_11169150
352 Ga0163162_11667151
353 Ga0157372_10198164
354 Ga0157375_10119918
355 Ga0157375_10638824
356 Ga0163163_10162857
357 Ga0157380_10004336
358 Ga0157380_10760107
359 Ga0157379_10149740
360 Ga0157376_10093563
361 Ga0213876_10451516
362 Ga0224571_100076
363 Ga0228598_1009871
364 Ga0207682_10015235
365 Ga0207642_10116469
366 Ga0207688_10009304
367 Ga0207680_10020952
368 Ga0207645_10138555
369 Ga0207645_10309174
370 Ga0207643_10052876
371 Ga0207684_10003809
372 Ga0207684_10011548
373 Ga0207684_10284917
374 Ga0207654_10106043
375 Ga0207695_10452418
376 Ga0207671_10024083
377 Ga0207663_10048680
378 Ga0207649_10935369
379 Ga0207646_10189856
380 Ga0207681_10032906
381 Ga0207694_10068546
382 Ga0207650_10139711
383 Ga0207659_10290144
384 Ga0207664_10649905
385 Ga0207706_10049972
386 Ga0207686_10038046
387 Ga0207709_10185177
388 Ga0207670_10071655
389 Ga0207669_10001397
390 Ga0207669_10714955
391 Ga0207691_10052900
392 Ga0207689_10063988
393 Ga0207689_10379604
394 Ga0207661_10278651
395 Ga0207679_10070462
396 Ga0207679_10828287
397 Ga0207667_10148830
398 Ga0207651_11061971
399 Ga0207712_10276391
400 Ga0207668_10046018
401 Ga0207668_10197324
402 Ga0207658_10201980
403 Ga0207658_10249764
404 Ga0207639_10076480
405 Ga0207678_11066862
406 Ga0207678_11432114
407 Ga0207708_10316540
408 Ga0207708_10736009
409 Ga0207708_11028476
410 Ga0207702_11058332
411 Ga0207641_10862445
412 Ga0207648_10081501
413 Ga0207648_10172958
414 Ga0207676_10093905
415 Ga0207676_11697165
416 Ga0207674_10052260
417 Ga0207674_10268765
418 Ga0207674_10331719
419 Ga0207675_100006893
420 Ga0207675_100063987
421 Ga0207683_10031574
422 Ga0209588_1091777
423 Ga0268265_10012961
424 Ga0268265_10360771
425 Ga0268265_11042890
426 Ga0268264_10757633
427 Ga0265338_10063566
428 Ga0265338_10163773
429 Ga0265328_10337888
430 Ga0265325_10319261
431 Ga0265340_10068490
432 Ga0265339_10023664
433 Ga0265339_10068182
434 Ga0265331_10000002
435 Ga0265327_10009962
436 Ga0265316_10014315
437 Ga0307508_10000114
438 Ga0265314_10013802
439 Ga0265314_10033772
440 Ga0265314_10047275
441 Ga0373939_0079346
442 Ga0373956_0356309
443 Ga0373927_0235573
444 Ga0373937_0069042
445 Ga0265778_004907
446 Ga0373925_1040400
447 Ga0395899_0075453
448 Ga0395900_0004122
449 Ga0395898_0173916
450 Ga0395901_0001693
451 Ga0436365_1000303
452 Ga0436365_1656950
453 Ga0436361_0443738
454 Ga0451849_0866403
455 Ga0495603_0135072
456 Ga0495580_0022049
457 Ga0495580_0479880
458 Ga0495594_0094090
459 Ga0495668_0072073
460 Ga0495588_0088601
461 Ga0495674_0337259
462 Ga0495677_0013675
463 Ga0495684_0345265
464 Ga0496115_0051520
465 Ga0496126_0703313
466 Ga0501041_0463503
467 Ga0501067_0001881
468 Ga0501068_0167062
469 Ga0501080_0013432
470 nmdc:mga05p37_1512252_c1
471 nmdc:mga05p37_246967_c1
472 nmdc:mga05p37_261251_c1
473 nmdc:mga05p37_674678_c1
474 nmdc:mga09592_83739_c1
475 nmdc:mga0qj67_610962_c1
476 nmdc:mga0n895_1641346_c1
477 Ga0500622_0072153
478 Ga0501082_1316853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2l7a-assembly1.cif.gz_A solution structure of the r3 domain of talin 0.5888 8 103
6lo8-assembly1.cif.gz_D cryo-em structure of the tim22 complex from yeast 0.5779 51 146
1qlb-assembly1.cif.gz_F respiratory complex ii-like fumarate reductase from wolinella succinogenes 0.5772 11 152
1e7p-assembly1.cif.gz_C quinol:fumarate reductase from wolinella succinogenes 0.5561 11 152
7uk5-assembly1.cif.gz_A human kv4.2-kchip2 channel complex in an open state, transmembrane region 0.5477 2 144
ID Description Score Start End Superfamily
af_Q20381_162_300_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.5943 2 107 1.20.120.350
af_Q9Z0Y8_1120_1253_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.5895 1 119 1.20.120.350
af_Q2FZC9_1_204_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.5774 4 153 1.20.1300.10
af_F1R2F2_354_536_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5671 3 148 1.20.120.1770
2bs3C00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.5617 11 162 1.20.1300.10
ID Description Score Start End GO Terms
AF-A7IM47-F1-model_v4 Uncharacterized protein 0.9652 4 149 GO:0016020
AF-A0A437ME15-F1-model_v4 DUF2306 domain-containing protein 0.9642 1 152 GO:0016020
AF-A0A502FSF8-F1-model_v4 DUF2231 domain-containing protein 0.9608 1 152 GO:0016020
AF-A0A1G4PD52-F1-model_v4 Uncharacterized protein 0.9596 4 153 GO:0016020
AF-A0A1Q5SAN2-F1-model_v4 Membrane protein 0.9585 1 148 GO:0016020

Map