F351436

General Info

Members Datasets Scaffolds Average Seq Length
238 158 476 177

Family's Representative Sequence

Representative Sequence 3300060346|Ga0587111_0044978|Ga0587111_0044978_318_926
Length 202
Sequence MVGKPSRLNPDNRLDPDKERQQMAIGPVQLIVLGFRHPDFHGEIIAELDRLRQSDTIRVIDALAVYKDTQGDVEVEHLSNLTTEEAVELGSKITALIGLGIDGEEGMQAGAVAGAEAAAADGVHVFSDDDAWDVLAEIPNDSAAALLLIEHHWAVPLRDAIARAGGFRLADGFISPFDLIGIGLLTAEEAKELHDLETAAAG

Samples

Sample ID Description Type Environment
1 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
74 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
151 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
152 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
153 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
157 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
158 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.76
Metatranscriptomes 7.98
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0.42
Rhizoplane 7.14
Rhizosphere 88.66
Stem 0
Stem Tuber 0
Unclassified 5.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587111_0044978 3300060346 Bacteria 955
2 Ga0006770J48903_1036693 3300003305 Bacteria 746
3 Ga0006777J48905_1079549 3300003308 Bacteria 748
4 Ga0058859_11556429 3300004798 Bacteria 621
5 Ga0058862_12564186 3300004803 Bacteria 759
6 Ga0058862_12864897 3300004803 Bacteria 624
7 Ga0070682_101198031 3300005337 Bacteria 641
8 Ga0068868_100180759 3300005338 Bacteria 1750
9 Ga0070660_100898357 3300005339 Bacteria 747
10 Ga0070674_101541914 3300005356 Bacteria 598
11 Ga0070709_10006888 3300005434 Bacteria 6207
12 Ga0070709_10043795 3300005434 Unclassified 2769
13 Ga0070709_10081488 3300005434 Unclassified 2112
14 Ga0070714_100017019 3300005435 Bacteria 5883
15 Ga0070714_100532042 3300005435 Bacteria 1123
16 Ga0070713_100005767 3300005436 Bacteria 8506
17 Ga0070713_100122325 3300005436 Bacteria 2284
18 Ga0070713_100153752 3300005436 Bacteria 2049
19 Ga0070713_100847484 3300005436 Bacteria 877
20 Ga0070710_10001096 3300005437 Bacteria 12813
21 Ga0070710_10098734 3300005437 Unclassified 1735
22 Ga0070711_100002317 3300005439 Bacteria 10815
23 Ga0070711_100536889 3300005439 Unclassified 969
24 Ga0070708_100093527 3300005445 Bacteria 2741
25 Ga0070708_100320976 3300005445 Bacteria 1459
26 Ga0070662_100422396 3300005457 Bacteria 1103
27 Ga0070681_10661068 3300005458 Bacteria 960
28 Ga0070706_100006631 3300005467 Bacteria 10920
29 Ga0070698_100495391 3300005471 Bacteria 1160
30 Ga0070665_100067574 3300005548 Bacteria 3584
31 Ga0070665_100305137 3300005548 Bacteria 1595
32 Ga0068854_100656341 3300005578 Bacteria 901
33 Ga0068856_100047558 3300005614 Bacteria 4226
34 Ga0068852_101867827 3300005616 Bacteria 623
35 Ga0068864_100059520 3300005618 Bacteria 3305
36 Ga0068861_100334119 3300005719 Bacteria 1324
37 Ga0068863_100254515 3300005841 Bacteria 1697
38 Ga0081455_10118897 3300005937 Bacteria 2085
39 Ga0081455_10369212 3300005937 Bacteria 1006
40 Ga0081539_10166517 3300005985 Bacteria 1046
41 Ga0070717_10012907 3300006028 Bacteria 6381
42 Ga0070717_10098332 3300006028 Bacteria 2481
43 Ga0070716_100052622 3300006173 Unclassified 2319
44 Ga0070716_100508997 3300006173 Bacteria 890
45 Ga0070712_100011016 3300006175 Bacteria 5721
46 Ga0070712_100104996 3300006175 Unclassified 2097
47 Ga0070712_100159166 3300006175 Bacteria 1742
48 Ga0070712_100340322 3300006175 Bacteria 1225
49 Ga0075430_100205635 3300006846 Bacteria 1634
50 Ga0099794_10149423 3300007265 Bacteria 1185
51 Ga0099795_10154778 3300007788 Bacteria 941
52 Ga0105241_10394566 3300009174 Bacteria 1212
53 Ga0105238_10022733 3300009551 Bacteria 6390
54 Ga0105238_10732232 3300009551 Bacteria 1002
55 Ga0099796_10049778 3300010159 Bacteria 1450
56 Ga0105239_10938698 3300010375 Bacteria 993
57 Ga0157371_10685151 3300013102 Bacteria 767
58 Ga0157370_10695947 3300013104 Bacteria 928
59 Ga0157369_10970870 3300013105 Bacteria 870
60 Ga0157375_10216402 3300013308 Bacteria 2074
61 Ga0163163_10067064 3300014325 Bacteria 3566
62 Ga0163163_10528321 3300014325 Bacteria 1242
63 Ga0157376_10467954 3300014969 Bacteria 1233
64 Ga0197907_11178937 3300020069 Bacteria 841
65 Ga0206356_11192735 3300020070 Bacteria 599
66 Ga0206349_1558618 3300020075 Bacteria 658
67 Ga0206352_10277413 3300020078 Bacteria 636
68 Ga0206352_11017168 3300020078 Bacteria 713
69 Ga0206350_10816188 3300020080 Bacteria 961
70 Ga0206350_10825941 3300020080 Unclassified 911
71 Ga0206354_10980161 3300020081 Bacteria 744
72 Ga0207692_10002016 3300025898 Bacteria 7756
73 Ga0207692_10133268 3300025898 Bacteria 1406
74 Ga0207699_10026074 3300025906 Bacteria 3217
75 Ga0207699_10035981 3300025906 Bacteria 2820
76 Ga0207699_10276565 3300025906 Unclassified 1165
77 Ga0207684_10000574 3300025910 Bacteria 44726
78 Ga0207654_10239666 3300025911 Bacteria 1211
79 Ga0207693_10002154 3300025915 Bacteria 17186
80 Ga0207693_10026061 3300025915 Bacteria 4630
81 Ga0207693_10080517 3300025915 Unclassified 2550
82 Ga0207693_10165466 3300025915 Bacteria 1741
83 Ga0207663_10029237 3300025916 Bacteria 3234
84 Ga0207663_10337492 3300025916 Unclassified 1137
85 Ga0207694_10615706 3300025924 Bacteria 914
86 Ga0207700_10015204 3300025928 Bacteria 5066
87 Ga0207700_10227295 3300025928 Bacteria 1585
88 Ga0207664_10029491 3300025929 Bacteria 4179
89 Ga0207664_10124019 3300025929 Bacteria 2166
90 Ga0207706_10872513 3300025933 Bacteria 761
91 Ga0207670_10213878 3300025936 Unclassified 1472
92 Ga0207669_11025611 3300025937 Bacteria 694
93 Ga0207665_10085638 3300025939 Unclassified 2176
94 Ga0207665_10145220 3300025939 Unclassified 1695
95 Ga0207665_10268589 3300025939 Bacteria 1266
96 Ga0207640_10921521 3300025981 Bacteria 764
97 Ga0207702_10003420 3300026078 Bacteria 14519
98 Ga0207641_10005973 3300026088 Bacteria 10316
99 Ga0207676_10021908 3300026095 Bacteria 4694
100 Ga0207676_10770430 3300026095 Bacteria 937
101 Ga0207675_100858010 3300026118 Bacteria 923
102 Ga0207675_101361034 3300026118 Bacteria 730
103 Ga0209179_1046167 3300027512 Bacteria 926
104 Ga0268266_10064785 3300028379 Bacteria 3158
105 Ga0268266_10313875 3300028379 Bacteria 1465
106 Ga0307517_10168163 3300028786 Bacteria 1449
107 Ga0307515_10055682 3300028794 Bacteria 5771
108 Ga0307512_10018774 3300030522 Bacteria 6311
109 Ga0265766_1006114 3300030863 Bacteria 781
110 Ga0265761_102794 3300030889 Bacteria 830
111 Ga0307513_10021740 3300031456 Bacteria 7568
112 Ga0307508_10060012 3300031616 Bacteria 3364
113 Ga0307406_10641582 3300031901 Bacteria 880
114 Ga0307416_101651510 3300032002 Bacteria 746
115 Ga0307415_100777573 3300032126 Bacteria 872
116 Ga0373945_0006718 3300035116 Bacteria 3716
117 Ga0373954_0365640 3300035118 Bacteria 713
118 Ga0373960_0161696 3300035121 Bacteria 771
119 Ga0373943_0207578 3300035170 Bacteria 1086
120 Ga0373924_0077647 3300035410 Bacteria 1408
121 Ga0373935_0074565 3300035692 Bacteria 2194
122 Ga0373935_0296231 3300035692 Bacteria 1142
123 Ga0373935_0359276 3300035692 Bacteria 1040
124 Ga0373927_0221109 3300035695 Bacteria 1244
125 Ga0373933_0051777 3300035724 Bacteria 2455
126 Ga0373947_0171965 3300035725 Bacteria 1406
127 Ga0373937_0059657 3300036401 Bacteria 3506
128 Ga0373937_0357710 3300036401 Bacteria 1383
129 Ga0265778_038913 3300036457 Bacteria 630
130 Ga0373925_0003507 3300037068 Bacteria 12124
131 Ga0395899_0034466 3300037312 Bacteria 3802
132 Ga0395900_0104134 3300037418 Bacteria 2915
133 Ga0466960_0371201 3300044901 Bacteria 820
134 Ga0495592_0042428 3300046454 Bacteria 3407
135 Ga0495592_0169647 3300046454 Bacteria 1495
136 Ga0495629_0328233 3300046459 Bacteria 1045
137 Ga0495629_0462445 3300046459 Bacteria 858
138 Ga0495651_0045197 3300046462 Bacteria 3412
139 Ga0495651_0164271 3300046462 Bacteria 1588
140 Ga0495653_0007538 3300046463 Bacteria 8898
141 Ga0495653_0025795 3300046463 Bacteria 4716
142 Ga0495580_0290438 3300046472 Bacteria 1115
143 Ga0495639_0239131 3300046475 Bacteria 896
144 Ga0495664_0113801 3300046477 Bacteria 1634
145 Ga0495664_0171536 3300046477 Bacteria 1316
146 Ga0495608_0092651 3300046511 Bacteria 1952
147 Ga0495618_0026044 3300046514 Bacteria 3633
148 Ga0495628_0100005 3300046516 Bacteria 2239
149 Ga0495628_0204527 3300046516 Bacteria 1487
150 Ga0495630_0094876 3300046517 Bacteria 2255
151 Ga0495630_0105054 3300046517 Bacteria 2138
152 Ga0495630_0273955 3300046517 Bacteria 1289
153 Ga0495630_0361662 3300046517 Bacteria 1111
154 Ga0495630_0787933 3300046517 Bacteria 726
155 Ga0495630_0807050 3300046517 Bacteria 716
156 Ga0495652_0089548 3300046529 Bacteria 2519
157 Ga0495640_0071702 3300046533 Bacteria 2324
158 Ga0495640_0189941 3300046533 Bacteria 1306
159 Ga0495587_0118697 3300046536 Bacteria 1515
160 Ga0495587_0122367 3300046536 Bacteria 1490
161 Ga0495645_0059255 3300046543 Bacteria 2777
162 Ga0495645_0140421 3300046543 Bacteria 1686
163 Ga0495645_0176611 3300046543 Bacteria 1466
164 Ga0495667_0008640 3300046559 Bacteria 6916
165 Ga0495667_0241497 3300046559 Bacteria 1150
166 Ga0495634_0095319 3300046642 Bacteria 1928
167 Ga0495634_0230488 3300046642 Bacteria 1140
168 Ga0495635_0009406 3300046663 Bacteria 6833
169 Ga0495635_0037384 3300046663 Bacteria 3361
170 Ga0495588_0321345 3300046674 Bacteria 814
171 Ga0495657_0004273 3300046675 Bacteria 11411
172 Ga0495657_0283693 3300046675 Bacteria 990
173 Ga0495599_0025063 3300046678 Bacteria 3733
174 Ga0495599_0122644 3300046678 Bacteria 1615
175 Ga0495599_0153821 3300046678 Bacteria 1423
176 Ga0495646_0032233 3300046680 Bacteria 3262
177 Ga0495624_0329084 3300046690 Bacteria 920
178 Ga0495581_0031131 3300047315 Bacteria 3091
179 Ga0495604_0117696 3300047317 Bacteria 1927
180 Ga0495674_0040232 3300047319 Bacteria 4183
181 Ga0495674_0086207 3300047319 Bacteria 2689
182 Ga0495674_0100585 3300047319 Bacteria 2460
183 Ga0495674_0124737 3300047319 Bacteria 2173
184 Ga0495680_0056538 3300047322 Bacteria 3037
185 Ga0495680_0070410 3300047322 Bacteria 2667
186 Ga0495680_0081517 3300047322 Bacteria 2442
187 Ga0495675_0015863 3300047444 Bacteria 4764
188 Ga0495684_0026833 3300047471 Bacteria 4426
189 Ga0495684_0062096 3300047471 Bacteria 2842
190 Ga0495684_0265875 3300047471 Bacteria 1243
191 Ga0495684_0522848 3300047471 Bacteria 812
192 Ga0495602_0097962 3300048088 Bacteria 2414
193 Ga0496100_0048532 3300048903 Bacteria 2741
194 Ga0496101_0197358 3300048904 Bacteria 1555
195 Ga0496101_0739641 3300048904 Bacteria 776
196 Ga0496104_0008546 3300048907 Bacteria 9103
197 Ga0496104_0042363 3300048907 Bacteria 4272
198 Ga0496104_0142443 3300048907 Bacteria 2303
199 Ga0496104_0187480 3300048907 Bacteria 1979
200 Ga0496105_0031315 3300048908 Bacteria 4361
201 Ga0496105_0062260 3300048908 Bacteria 3079
202 Ga0496108_0261895 3300048911 Bacteria 1505
203 Ga0496109_0613771 3300048912 Bacteria 1024
204 Ga0496109_1097298 3300048912 Bacteria 733
205 Ga0496109_1645830 3300048912 Bacteria 576
206 Ga0496110_0129523 3300048913 Bacteria 2278
207 Ga0496112_0001396 3300048915 Bacteria 18455
208 Ga0496112_0008263 3300048915 Bacteria 9314
209 Ga0496114_0041354 3300048917 Bacteria 3820
210 Ga0501032_0204098 3300049569 Bacteria 1290
211 Ga0501039_0006257 3300049575 Bacteria 9044
212 Ga0501042_0109343 3300049578 Bacteria 1990
213 Ga0501043_0436337 3300049579 Bacteria 986
214 Ga0501069_0328297 3300049585 Bacteria 900
215 Ga0501071_0538771 3300049587 Bacteria 896
216 Ga0501072_0070308 3300049588 Bacteria 2764
217 Ga0501075_0017850 3300049591 Bacteria 5126
218 Ga0501077_0055927 3300049593 Bacteria 2505
219 Ga0501079_0077320 3300049741 Bacteria 2574
220 Ga0501083_0180438 3300049744 Bacteria 1379
221 Ga0501035_0321633 3300049822 Bacteria 1300
222 Ga0495601_0119469 3300053077 Bacteria 1711
223 Ga0495601_0151509 3300053077 Bacteria 1514
224 Ga0495601_0196898 3300053077 Bacteria 1317
225 Ga0495612_0019760 3300053078 Bacteria 2699
226 Ga0495619_0062327 3300053085 Bacteria 2482
227 Ga0495619_0111452 3300053085 Bacteria 1870
228 Ga0495619_0184333 3300053085 Bacteria 1444
229 Ga0495619_0234396 3300053085 Bacteria 1272
230 Ga0500569_010274 3300053109 Bacteria 2200
231 Ga0500594_0015396 3300053118 Bacteria 1844
232 Ga0500577_0153385 3300053142 Bacteria 978
233 Ga0587085_034759 3300059506 Bacteria 848
234 Ga0587101_017370 3300059623 Bacteria 996
235 Ga0501082_0094020 3300060353 Bacteria 2590
236 2689994324 2687453743 Bacteria 8361025
237 2816424227 2816332119 Bacteria 8120218
238 8054477297 8054472261 Bacteria 7464355
239 Ga0587111_0044978
240 Ga0006770J48903_1036693
241 Ga0006777J48905_1079549
242 Ga0058859_11556429
243 Ga0058862_12564186
244 Ga0058862_12864897
245 Ga0070682_101198031
246 Ga0068868_100180759
247 Ga0070660_100898357
248 Ga0070674_101541914
249 Ga0070709_10006888
250 Ga0070709_10043795
251 Ga0070709_10081488
252 Ga0070714_100017019
253 Ga0070714_100532042
254 Ga0070713_100005767
255 Ga0070713_100122325
256 Ga0070713_100153752
257 Ga0070713_100847484
258 Ga0070710_10001096
259 Ga0070710_10098734
260 Ga0070711_100002317
261 Ga0070711_100536889
262 Ga0070708_100093527
263 Ga0070708_100320976
264 Ga0070662_100422396
265 Ga0070681_10661068
266 Ga0070706_100006631
267 Ga0070698_100495391
268 Ga0070665_100067574
269 Ga0070665_100305137
270 Ga0068854_100656341
271 Ga0068856_100047558
272 Ga0068852_101867827
273 Ga0068864_100059520
274 Ga0068861_100334119
275 Ga0068863_100254515
276 Ga0081455_10118897
277 Ga0081455_10369212
278 Ga0081539_10166517
279 Ga0070717_10012907
280 Ga0070717_10098332
281 Ga0070716_100052622
282 Ga0070716_100508997
283 Ga0070712_100011016
284 Ga0070712_100104996
285 Ga0070712_100159166
286 Ga0070712_100340322
287 Ga0075430_100205635
288 Ga0099794_10149423
289 Ga0099795_10154778
290 Ga0105241_10394566
291 Ga0105238_10022733
292 Ga0105238_10732232
293 Ga0099796_10049778
294 Ga0105239_10938698
295 Ga0157371_10685151
296 Ga0157370_10695947
297 Ga0157369_10970870
298 Ga0157375_10216402
299 Ga0163163_10067064
300 Ga0163163_10528321
301 Ga0157376_10467954
302 Ga0197907_11178937
303 Ga0206356_11192735
304 Ga0206349_1558618
305 Ga0206352_10277413
306 Ga0206352_11017168
307 Ga0206350_10816188
308 Ga0206350_10825941
309 Ga0206354_10980161
310 Ga0207692_10002016
311 Ga0207692_10133268
312 Ga0207699_10026074
313 Ga0207699_10035981
314 Ga0207699_10276565
315 Ga0207684_10000574
316 Ga0207654_10239666
317 Ga0207693_10002154
318 Ga0207693_10026061
319 Ga0207693_10080517
320 Ga0207693_10165466
321 Ga0207663_10029237
322 Ga0207663_10337492
323 Ga0207694_10615706
324 Ga0207700_10015204
325 Ga0207700_10227295
326 Ga0207664_10029491
327 Ga0207664_10124019
328 Ga0207706_10872513
329 Ga0207670_10213878
330 Ga0207669_11025611
331 Ga0207665_10085638
332 Ga0207665_10145220
333 Ga0207665_10268589
334 Ga0207640_10921521
335 Ga0207702_10003420
336 Ga0207641_10005973
337 Ga0207676_10021908
338 Ga0207676_10770430
339 Ga0207675_100858010
340 Ga0207675_101361034
341 Ga0209179_1046167
342 Ga0268266_10064785
343 Ga0268266_10313875
344 Ga0307517_10168163
345 Ga0307515_10055682
346 Ga0307512_10018774
347 Ga0265766_1006114
348 Ga0265761_102794
349 Ga0307513_10021740
350 Ga0307508_10060012
351 Ga0307406_10641582
352 Ga0307416_101651510
353 Ga0307415_100777573
354 Ga0373945_0006718
355 Ga0373954_0365640
356 Ga0373960_0161696
357 Ga0373943_0207578
358 Ga0373924_0077647
359 Ga0373935_0074565
360 Ga0373935_0296231
361 Ga0373935_0359276
362 Ga0373927_0221109
363 Ga0373933_0051777
364 Ga0373947_0171965
365 Ga0373937_0059657
366 Ga0373937_0357710
367 Ga0265778_038913
368 Ga0373925_0003507
369 Ga0395899_0034466
370 Ga0395900_0104134
371 Ga0466960_0371201
372 Ga0495592_0042428
373 Ga0495592_0169647
374 Ga0495629_0328233
375 Ga0495629_0462445
376 Ga0495651_0045197
377 Ga0495651_0164271
378 Ga0495653_0007538
379 Ga0495653_0025795
380 Ga0495580_0290438
381 Ga0495639_0239131
382 Ga0495664_0113801
383 Ga0495664_0171536
384 Ga0495608_0092651
385 Ga0495618_0026044
386 Ga0495628_0100005
387 Ga0495628_0204527
388 Ga0495630_0094876
389 Ga0495630_0105054
390 Ga0495630_0273955
391 Ga0495630_0361662
392 Ga0495630_0787933
393 Ga0495630_0807050
394 Ga0495652_0089548
395 Ga0495640_0071702
396 Ga0495640_0189941
397 Ga0495587_0118697
398 Ga0495587_0122367
399 Ga0495645_0059255
400 Ga0495645_0140421
401 Ga0495645_0176611
402 Ga0495667_0008640
403 Ga0495667_0241497
404 Ga0495634_0095319
405 Ga0495634_0230488
406 Ga0495635_0009406
407 Ga0495635_0037384
408 Ga0495588_0321345
409 Ga0495657_0004273
410 Ga0495657_0283693
411 Ga0495599_0025063
412 Ga0495599_0122644
413 Ga0495599_0153821
414 Ga0495646_0032233
415 Ga0495624_0329084
416 Ga0495581_0031131
417 Ga0495604_0117696
418 Ga0495674_0040232
419 Ga0495674_0086207
420 Ga0495674_0100585
421 Ga0495674_0124737
422 Ga0495680_0056538
423 Ga0495680_0070410
424 Ga0495680_0081517
425 Ga0495675_0015863
426 Ga0495684_0026833
427 Ga0495684_0062096
428 Ga0495684_0265875
429 Ga0495684_0522848
430 Ga0495602_0097962
431 Ga0496100_0048532
432 Ga0496101_0197358
433 Ga0496101_0739641
434 Ga0496104_0008546
435 Ga0496104_0042363
436 Ga0496104_0142443
437 Ga0496104_0187480
438 Ga0496105_0031315
439 Ga0496105_0062260
440 Ga0496108_0261895
441 Ga0496109_0613771
442 Ga0496109_1097298
443 Ga0496109_1645830
444 Ga0496110_0129523
445 Ga0496112_0001396
446 Ga0496112_0008263
447 Ga0496114_0041354
448 Ga0501032_0204098
449 Ga0501039_0006257
450 Ga0501042_0109343
451 Ga0501043_0436337
452 Ga0501069_0328297
453 Ga0501071_0538771
454 Ga0501072_0070308
455 Ga0501075_0017850
456 Ga0501077_0055927
457 Ga0501079_0077320
458 Ga0501083_0180438
459 Ga0501035_0321633
460 Ga0495601_0119469
461 Ga0495601_0151509
462 Ga0495601_0196898
463 Ga0495612_0019760
464 Ga0495619_0062327
465 Ga0495619_0111452
466 Ga0495619_0184333
467 Ga0495619_0234396
468 Ga0500569_010274
469 Ga0500594_0015396
470 Ga0500577_0153385
471 Ga0587085_034759
472 Ga0587101_017370
473 Ga0501082_0094020
474 2689994324
475 2816424227
476 8054477297

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v43-assembly1.cif.gz_B crystal structure of the flavin oxygenase with cofactor and substrate bound involved in folate catabolism 0.6231 2 135
3nrb-assembly1.cif.gz_A crystal structure of a formyltetrahydrofolate deformylase (puru, pp_1943) from pseudomonas putida kt2440 at 2.05 a resolution 0.6082 5 138
3nrb-assembly1.cif.gz_D crystal structure of a formyltetrahydrofolate deformylase (puru, pp_1943) from pseudomonas putida kt2440 at 2.05 a resolution 0.603 6 137
3dc2-assembly1.cif.gz_B crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis 0.5893 2 138
6gou-assembly1.cif.gz_D-2 development of alkyl glycerone phosphate synthase inhibitors: complex with inhibitor 2i 0.564 5 134
ID Description Score Start End Superfamily
af_P37051_4_77_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.609 6 132 3.30.70.260
af_A0A1I9LP11_7_70_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.605 109 132 3.30.70.100
af_I1JD23_3_71_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5997 109 132 3.30.70.100
1u8sA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.595 3 138 3.30.70.260
af_P37051_4_77_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.5908 6 132 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A3D5DQJ0-F1-model_v4 DUF1269 domain-containing protein 0.7983 1 117
AF-Q021L4-F1-model_v4 Uncharacterized protein 0.7377 5 141
AF-A0A5C4PZW8-F1-model_v4 DUF1269 domain-containing protein 0.735 6 138
AF-A0A1H9DQP2-F1-model_v4 Uncharacterized membrane protein 0.7254 6 137
AF-A0A4S3TIW0-F1-model_v4 DUF1269 domain-containing protein 0.7246 6 136

Map