F351435

General Info

Members Datasets Scaffolds Average Seq Length
238 125 238 192

Family's Representative Sequence

Representative Sequence 3300059492|Ga0587073_0083000|Ga0587073_0083000_129_728
Length 163
Sequence MTHHEHTLDGKRVAILATDMFEQVELVEPRKALEEAGATTELLSIKPGKGNPDQLRGDENVVSFVRDVFEAGKPVAAICHGPWVLVEAGMVRGRKLTSWPTLQTDIRNAGGNWVDQEVVVDQGLVTSRKPDDLPAFNKKIVEEFCEVRHEQQAASVQADATPK

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
34 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
71 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
72 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
117 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.87
Metatranscriptomes 15.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.56
Rhizosphere 91.6
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10326658 3300005327 Bacteria 1310
2 Ga0070658_10473476 3300005327 Bacteria 1080
3 Ga0070683_100379040 3300005329 Bacteria 1348
4 Ga0070683_100408686 3300005329 Bacteria 1295
5 Ga0070680_100042835 3300005336 Bacteria 3675
6 Ga0070680_100447954 3300005336 Unclassified 1102
7 Ga0070660_100278442 3300005339 Unclassified 1368
8 Ga0070660_100443488 3300005339 Bacteria 1076
9 Ga0070660_100537310 3300005339 Bacteria 974
10 Ga0070661_100060911 3300005344 Bacteria 2769
11 Ga0070661_100503528 3300005344 Bacteria 970
12 Ga0070713_101010256 3300005436 Bacteria 802
13 Ga0070711_100771813 3300005439 Bacteria 814
14 Ga0070681_10002835 3300005458 Bacteria 16022
15 Ga0070681_10037548 3300005458 Unclassified 4860
16 Ga0070681_10086198 3300005458 Bacteria 3093
17 Ga0070681_10220107 3300005458 Bacteria 1813
18 Ga0070681_10998740 3300005458 Bacteria 757
19 Ga0070679_100017831 3300005530 Bacteria 6875
20 Ga0070679_100021934 3300005530 Bacteria 6237
21 Ga0070679_100116888 3300005530 Bacteria 2652
22 Ga0070679_100142442 3300005530 Bacteria 2376
23 Ga0070679_100481203 3300005530 Bacteria 1186
24 Ga0070684_100200277 3300005535 Bacteria 1818
25 Ga0070684_101324393 3300005535 Bacteria 678
26 Ga0068853_100755080 3300005539 Bacteria 930
27 Ga0070665_100044953 3300005548 Bacteria 4433
28 Ga0068855_100005955 3300005563 Bacteria 14867
29 Ga0068855_100012098 3300005563 Bacteria 10424
30 Ga0068855_100012928 3300005563 Bacteria 10071
31 Ga0068857_100009654 3300005577 Bacteria 8385
32 Ga0068856_100021616 3300005614 Bacteria 6253
33 Ga0068856_100331309 3300005614 Bacteria 1540
34 Ga0070717_10248167 3300006028 Bacteria 1572
35 Ga0070717_10376606 3300006028 Bacteria 1272
36 Ga0070716_100651452 3300006173 Bacteria 799
37 Ga0075435_100863464 3300007076 Bacteria 789
38 Ga0105240_10011292 3300009093 Bacteria 12445
39 Ga0105240_10066652 3300009093 Bacteria 4465
40 Ga0105237_10090640 3300009545 Bacteria 3046
41 Ga0105238_10013349 3300009551 Bacteria 8287
42 Ga0105238_10027359 3300009551 Bacteria 5809
43 Ga0105238_10611097 3300009551 Bacteria 1099
44 Ga0105238_11086698 3300009551 Bacteria 822
45 Ga0105239_11680716 3300010375 Bacteria 735
46 Ga0157373_10108751 3300013100 Bacteria 1949
47 Ga0157371_10051507 3300013102 Unclassified 2925
48 Ga0157371_10133484 3300013102 Bacteria 1767
49 Ga0157370_10198579 3300013104 Bacteria 1861
50 Ga0157370_10281470 3300013104 Bacteria 1537
51 Ga0157370_10477760 3300013104 Bacteria 1145
52 Ga0157370_10517212 3300013104 Bacteria 1096
53 Ga0157369_10055296 3300013105 Bacteria 4285
54 Ga0157369_10124296 3300013105 Bacteria 2736
55 Ga0157369_10280715 3300013105 Bacteria 1735
56 Ga0157369_10309987 3300013105 Bacteria 1641
57 Ga0157374_10088339 3300013296 Bacteria 2952
58 Ga0157372_10000134 3300013307 Bacteria 81431
59 Ga0157372_10062792 3300013307 Bacteria 4163
60 Ga0182008_10169745 3300014497 Bacteria 1101
61 Ga0197907_10327725 3300020069 Unclassified 881
62 Ga0197907_11067716 3300020069 Bacteria 661
63 Ga0206356_10506953 3300020070 Bacteria 2438
64 Ga0206356_10619490 3300020070 Bacteria 762
65 Ga0206356_10827921 3300020070 Bacteria 947
66 Ga0206349_1523539 3300020075 Bacteria 608
67 Ga0206349_1687626 3300020075 Unclassified 912
68 Ga0206355_1017289 3300020076 Bacteria 1107
69 Ga0206355_1207516 3300020076 Bacteria 643
70 Ga0206355_1697754 3300020076 Bacteria 636
71 Ga0206352_10580408 3300020078 Bacteria 671
72 Ga0206352_10681870 3300020078 Bacteria 1063
73 Ga0206352_10993841 3300020078 Bacteria 907
74 Ga0206352_11061161 3300020078 Bacteria 641
75 Ga0206350_10239311 3300020080 Bacteria 620
76 Ga0206350_10989121 3300020080 Unclassified 910
77 Ga0206350_11071719 3300020080 Bacteria 642
78 Ga0206354_11253935 3300020081 Bacteria 841
79 Ga0206353_10009642 3300020082 Bacteria 1027
80 Ga0206353_10139615 3300020082 Bacteria 2912
81 Ga0154015_1269898 3300020610 Bacteria 1369
82 Ga0154015_1326186 3300020610 Bacteria 648
83 Ga0154015_1384070 3300020610 Bacteria 783
84 Ga0154015_1482124 3300020610 Unclassified 799
85 Ga0224712_10008293 3300022467 Bacteria 3073
86 Ga0224712_10022161 3300022467 Bacteria 2186
87 Ga0224712_10056766 3300022467 Bacteria 1545
88 Ga0224712_10370214 3300022467 Bacteria 679
89 Ga0224712_10412151 3300022467 Bacteria 645
90 Ga0207705_10426803 3300025909 Bacteria 1027
91 Ga0207707_10033867 3300025912 Bacteria 4470
92 Ga0207707_10119493 3300025912 Bacteria 2303
93 Ga0207707_10136549 3300025912 Bacteria 2144
94 Ga0207707_10451894 3300025912 Unclassified 1099
95 Ga0207695_10076703 3300025913 Bacteria 3397
96 Ga0207695_10107909 3300025913 Bacteria 2769
97 Ga0207695_10458629 3300025913 Bacteria 1158
98 Ga0207671_10180872 3300025914 Bacteria 1641
99 Ga0207663_10430413 3300025916 Bacteria 1014
100 Ga0207660_10041560 3300025917 Unclassified 3222
101 Ga0207660_10151376 3300025917 Bacteria 1782
102 Ga0207660_10958696 3300025917 Bacteria 698
103 Ga0207662_10349589 3300025918 Bacteria 993
104 Ga0207657_10001456 3300025919 Bacteria 25315
105 Ga0207657_10001467 3300025919 Bacteria 25216
106 Ga0207657_10005771 3300025919 Bacteria 12908
107 Ga0207649_10012809 3300025920 Bacteria 4666
108 Ga0207652_10021700 3300025921 Bacteria 5301
109 Ga0207652_10111375 3300025921 Bacteria 2427
110 Ga0207652_10480228 3300025921 Bacteria 1119
111 Ga0207652_10792999 3300025921 Bacteria 841
112 Ga0207694_10023265 3300025924 Unclassified 4705
113 Ga0207694_10027078 3300025924 Bacteria 4365
114 Ga0207700_10129613 3300025928 Bacteria 2057
115 Ga0207664_10127011 3300025929 Bacteria 2142
116 Ga0207665_10189425 3300025939 Bacteria 1494
117 Ga0207661_10266684 3300025944 Bacteria 1527
118 Ga0207667_10007274 3300025949 Bacteria 13350
119 Ga0207667_10011336 3300025949 Bacteria 10366
120 Ga0207667_10094279 3300025949 Bacteria 3090
121 Ga0207678_10148074 3300026067 Bacteria 2004
122 Ga0207702_10080340 3300026078 Bacteria 2828
123 Ga0207702_10135355 3300026078 Bacteria 2222
124 Ga0207674_10013111 3300026116 Bacteria 9224
125 Ga0268266_10029822 3300028379 Bacteria 4635
126 Ga0307413_10064096 3300031824 Bacteria 2281
127 Ga0307412_10177961 3300031911 Bacteria 1597
128 Ga0307415_100111559 3300032126 Bacteria 2030
129 Ga0373925_0806684 3300037068 Bacteria 774
130 Ga0395899_0058777 3300037312 Bacteria 2835
131 Ga0395899_0455014 3300037312 Bacteria 837
132 Ga0395900_0018545 3300037418 Bacteria 7095
133 Ga0395900_1205437 3300037418 Bacteria 672
134 Ga0395898_0020879 3300037466 Bacteria 6646
135 Ga0395898_0281153 3300037466 Bacteria 1587
136 Ga0395905_0291162 3300037471 Bacteria 1519
137 Ga0395901_0032813 3300038443 Bacteria 5357
138 Ga0395901_0061834 3300038443 Bacteria 3896
139 Ga0395901_0220030 3300038443 Bacteria 1985
140 Ga0395901_0603276 3300038443 Bacteria 1107
141 Ga0436365_0980803 3300039437 Bacteria 658
142 Ga0436360_1043461 3300039438 Bacteria 2573
143 Ga0436361_0771076 3300039447 Unclassified 1127
144 Ga0436363_0306704 3300039450 Bacteria 550
145 Ga0466965_0222619 3300044683 Bacteria 1006
146 Ga0466965_0382609 3300044683 Bacteria 775
147 Ga0466966_0035251 3300044684 Bacteria 3233
148 Ga0466966_0300877 3300044684 Bacteria 964
149 Ga0466961_0311361 3300044693 Bacteria 961
150 Ga0466963_0001162 3300044694 Bacteria 13808
151 Ga0466963_0376950 3300044694 Bacteria 1000
152 Ga0466963_0431302 3300044694 Bacteria 930
153 Ga0466963_0463379 3300044694 Bacteria 894
154 Ga0466963_0695991 3300044694 Bacteria 717
155 Ga0466963_0777337 3300044694 Bacteria 675
156 Ga0466964_0083963 3300044706 Bacteria 1372
157 Ga0466971_0059690 3300044719 Bacteria 1723
158 Ga0466971_0193173 3300044719 Bacteria 959
159 Ga0466971_0199563 3300044719 Bacteria 944
160 Ga0466971_0263407 3300044719 Bacteria 823
161 Ga0466968_0181555 3300044735 Bacteria 979
162 Ga0466970_0322994 3300044765 Bacteria 873
163 Ga0466957_0148697 3300044842 Bacteria 1513
164 Ga0466957_0259714 3300044842 Bacteria 1157
165 Ga0466957_0279013 3300044842 Bacteria 1118
166 Ga0466957_0497148 3300044842 Bacteria 845
167 Ga0466960_0005757 3300044901 Bacteria 4932
168 Ga0466959_0307126 3300045049 Bacteria 1086
169 Ga0466959_0555135 3300045049 Bacteria 774
170 Ga0466958_0036544 3300045836 Bacteria 2941
171 Ga0466958_0142424 3300045836 Bacteria 1510
172 Ga0466967_0001256 3300045976 Bacteria 14340
173 Ga0466967_0003646 3300045976 Bacteria 10125
174 Ga0466967_0025865 3300045976 Bacteria 4847
175 Ga0466967_0087698 3300045976 Bacteria 2822
176 Ga0466967_0115109 3300045976 Bacteria 2476
177 Ga0466967_0149276 3300045976 Bacteria 2183
178 Ga0466967_0162292 3300045976 Bacteria 2098
179 Ga0466967_0258660 3300045976 Bacteria 1665
180 Ga0466967_0313412 3300045976 Bacteria 1512
181 Ga0466967_0772898 3300045976 Bacteria 953
182 Ga0495629_0507629 3300046459 Bacteria 813
183 Ga0495651_0288705 3300046462 Bacteria 1105
184 Ga0495664_0168491 3300046477 Bacteria 1329
185 Ga0495628_0092314 3300046516 Bacteria 2342
186 Ga0495630_0718112 3300046517 Bacteria 764
187 Ga0495599_0152636 3300046678 Bacteria 1430
188 Ga0495674_0562001 3300047319 Bacteria 907
189 Ga0495684_0235708 3300047471 Bacteria 1337
190 Ga0496101_0149988 3300048904 Bacteria 1783
191 Ga0496102_0065681 3300048905 Bacteria 3326
192 Ga0496103_0301734 3300048906 Bacteria 1030
193 Ga0496103_0689137 3300048906 Bacteria 648
194 Ga0496106_0001342 3300048909 Bacteria 18453
195 Ga0496107_0000117 3300048910 Bacteria 38826
196 Ga0496109_1023444 3300048912 Bacteria 763
197 Ga0496109_1130106 3300048912 Bacteria 720
198 Ga0496110_0836764 3300048913 Bacteria 825
199 Ga0496111_0626476 3300048914 Bacteria 786
200 Ga0496112_0026851 3300048915 Bacteria 5548
201 Ga0496112_0084833 3300048915 Bacteria 3133
202 Ga0496112_0137003 3300048915 Bacteria 2418
203 Ga0496112_0208610 3300048915 Bacteria 1911
204 Ga0496112_0305267 3300048915 Bacteria 1537
205 Ga0496113_0108139 3300048916 Bacteria 2162
206 Ga0496113_0570036 3300048916 Bacteria 907
207 Ga0496115_0264582 3300048918 Bacteria 1414
208 Ga0501040_0155653 3300049576 Bacteria 1614
209 Ga0501046_0446888 3300049580 Bacteria 930
210 Ga0501047_0065130 3300049581 Bacteria 3513
211 Ga0501067_0020143 3300049583 Bacteria 3690
212 Ga0501069_0011032 3300049585 Bacteria 4790
213 Ga0501069_0012479 3300049585 Bacteria 4519
214 Ga0501069_0062999 3300049585 Bacteria 2071
215 Ga0501070_0025145 3300049586 Bacteria 4993
216 Ga0501070_0653058 3300049586 Bacteria 835
217 Ga0501073_0197972 3300049589 Bacteria 1390
218 Ga0501073_0357878 3300049589 Bacteria 1008
219 Ga0501074_0016291 3300049590 Bacteria 5397
220 Ga0501080_0100985 3300049742 Bacteria 2676
221 Ga0501080_0145960 3300049742 Bacteria 2187
222 nmdc:mga05p37_1136081_c1 3300050507 Bacteria 814
223 nmdc:mga0rr50_568027_c1 3300050513 Bacteria 966
224 Ga0495601_0085550 3300053077 Bacteria 2026
225 Ga0495595_0218461 3300053084 Bacteria 951
226 Ga0495619_0076392 3300053085 Bacteria 2249
227 Ga0587073_0037817 3300059492 Bacteria 1036
228 Ga0587073_0083000 3300059492 Bacteria 799
229 Ga0587088_065175 3300059508 Unclassified 747
230 Ga0587089_029407 3300059509 Unclassified 803
231 Ga0587128_024354 3300059630 Unclassified 956
232 Ga0587128_028652 3300059630 Bacteria 908
233 Ga0587079_096094 3300059647 Bacteria 701
234 Ga0501082_0003155 3300060353 Bacteria 14373
235 Ga0466962_0017268 3300061719 Bacteria 3476
236 Ga0466962_0032833 3300061719 Bacteria 2484
237 Ga0466962_0040430 3300061719 Bacteria 2232
238 Ga0466962_0061871 3300061719 Bacteria 1787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059492 Ga0587073_0083000 Ga0587073_0083000_129_728 155
2 3300039450 Ga0436363_0306704 Ga0436363_0306704_33_539 168
3 3300048906 Ga0496103_0689137 Ga0496103_0689137_67_621 174
4 3300044694 Ga0466963_0376950 Ga0466963_0376950_182_724 180
5 3300045976 Ga0466967_0001256 Ga0466967_0001256_2411_2953 180
6 3300044719 Ga0466971_0199563 Ga0466971_0199563_257_802 181
7 3300044901 Ga0466960_0005757 Ga0466960_0005757_2273_2818 181
8 3300045976 Ga0466967_0003646 Ga0466967_0003646_1790_2335 181
9 3300048912 Ga0496109_1023444 Ga0496109_1023444_34_579 181
10 3300049585 Ga0501069_0011032 Ga0501069_0011032_4130_4675 181
11 3300013104 Ga0157370_10281470 Ga0157370_102814702 183
12 3300013105 Ga0157369_10309987 Ga0157369_103099873 183
13 3300020078 Ga0206352_10681870 Ga0206352_106818702 183
14 3300020610 Ga0154015_1269898 Ga0154015_12698983 183
15 3300022467 Ga0224712_10056766 Ga0224712_100567662 183
16 3300044684 Ga0466966_0035251 Ga0466966_0035251_1669_2220 183
17 3300044842 Ga0466957_0148697 Ga0466957_0148697_808_1359 183
18 3300059492 Ga0587073_0037817 Ga0587073_0037817_113_682 183
19 3300059647 Ga0587079_096094 Ga0587079_096094_18_587 183
20 3300061719 Ga0466962_0017268 Ga0466962_0017268_2726_3277 183
21 3300045049 Ga0466959_0555135 Ga0466959_0555135_64_618 184
22 3300005329 Ga0070683_100408686 Ga0070683_1004086862 186
23 3300005336 Ga0070680_100447954 Ga0070680_1004479542 186
24 3300005339 Ga0070660_100278442 Ga0070660_1002784421 186
25 3300005458 Ga0070681_10037548 Ga0070681_100375482 186
26 3300005530 Ga0070679_100021934 Ga0070679_1000219345 186
27 3300005614 Ga0068856_100021616 Ga0068856_1000216164 186
28 3300009551 Ga0105238_10027359 Ga0105238_100273597 186
29 3300013102 Ga0157371_10051507 Ga0157371_100515073 186
30 3300013104 Ga0157370_10477760 Ga0157370_104777601 186
31 3300013307 Ga0157372_10000134 Ga0157372_1000013413 186
32 3300020069 Ga0197907_10327725 Ga0197907_103277252 186
33 3300020075 Ga0206349_1687626 Ga0206349_16876262 186
34 3300020080 Ga0206350_10989121 Ga0206350_109891211 186
35 3300020610 Ga0154015_1482124 Ga0154015_14821241 186
36 3300025912 Ga0207707_10451894 Ga0207707_104518942 186
37 3300025913 Ga0207695_10076703 Ga0207695_100767033 186
38 3300025917 Ga0207660_10041560 Ga0207660_100415604 186
39 3300025918 Ga0207662_10349589 Ga0207662_103495892 186
40 3300025919 Ga0207657_10001456 Ga0207657_1000145617 186
41 3300025921 Ga0207652_10021700 Ga0207652_100217001 186
42 3300025924 Ga0207694_10023265 Ga0207694_100232651 186
43 3300025949 Ga0207667_10011336 Ga0207667_100113369 186
44 3300026078 Ga0207702_10080340 Ga0207702_100803402 186
45 3300039447 Ga0436361_0771076 Ga0436361_0771076_182_745 187
46 3300005327 Ga0070658_10473476 Ga0070658_104734763 188
47 3300005339 Ga0070660_100537310 Ga0070660_1005373102 188
48 3300005530 Ga0070679_100116888 Ga0070679_1001168886 188
49 3300005539 Ga0068853_100755080 Ga0068853_1007550802 188
50 3300005563 Ga0068855_100012098 Ga0068855_1000120983 188
51 3300005563 Ga0068855_100012928 Ga0068855_1000129283 188
52 3300009093 Ga0105240_10011292 Ga0105240_100112924 188
53 3300009551 Ga0105238_11086698 Ga0105238_110866981 188
54 3300013100 Ga0157373_10108751 Ga0157373_101087514 188
55 3300013102 Ga0157371_10133484 Ga0157371_101334841 188
56 3300013105 Ga0157369_10124296 Ga0157369_101242965 188
57 3300020070 Ga0206356_10619490 Ga0206356_106194901 188
58 3300020076 Ga0206355_1017289 Ga0206355_10172891 188
59 3300020078 Ga0206352_10993841 Ga0206352_109938412 188
60 3300020078 Ga0206352_11061161 Ga0206352_110611611 188
61 3300020081 Ga0206354_11253935 Ga0206354_112539351 188
62 3300022467 Ga0224712_10022161 Ga0224712_100221616 188
63 3300025913 Ga0207695_10458629 Ga0207695_104586291 188
64 3300025919 Ga0207657_10005771 Ga0207657_100057717 188
65 3300025921 Ga0207652_10111375 Ga0207652_101113753 188
66 3300025949 Ga0207667_10007274 Ga0207667_1000727413 188
67 3300025949 Ga0207667_10094279 Ga0207667_100942795 188
68 3300037312 Ga0395899_0455014 Ga0395899_0455014_143_709 188
69 3300010375 Ga0105239_11680716 Ga0105239_116807161 189
70 3300020080 Ga0206350_11071719 Ga0206350_110717191 189
71 3300020082 Ga0206353_10139615 Ga0206353_101396155 189
72 3300020610 Ga0154015_1326186 Ga0154015_13261861 189
73 3300022467 Ga0224712_10370214 Ga0224712_103702141 189
74 3300038443 Ga0395901_0603276 Ga0395901_0603276_225_806 189
75 3300044684 Ga0466966_0300877 Ga0466966_0300877_225_794 189
76 3300044693 Ga0466961_0311361 Ga0466961_0311361_165_734 189
77 3300044694 Ga0466963_0463379 Ga0466963_0463379_201_770 189
78 3300044694 Ga0466963_0695991 Ga0466963_0695991_33_602 189
79 3300044694 Ga0466963_0777337 Ga0466963_0777337_15_584 189
80 3300044719 Ga0466971_0059690 Ga0466971_0059690_525_1094 189
81 3300044842 Ga0466957_0259714 Ga0466957_0259714_156_725 189
82 3300044842 Ga0466957_0279013 Ga0466957_0279013_163_732 189
83 3300045049 Ga0466959_0307126 Ga0466959_0307126_174_743 189
84 3300045836 Ga0466958_0142424 Ga0466958_0142424_838_1407 189
85 3300048918 Ga0496115_0264582 Ga0496115_0264582_699_1286 189
86 3300049576 Ga0501040_0155653 Ga0501040_0155653_695_1276 189
87 3300060353 Ga0501082_0003155 Ga0501082_0003155_1143_1715 189
88 3300061719 Ga0466962_0032833 Ga0466962_0032833_507_1076 189
89 3300061719 Ga0466962_0061871 Ga0466962_0061871_1198_1767 189
90 3300005344 Ga0070661_100503528 Ga0070661_1005035283 190
91 3300005436 Ga0070713_101010256 Ga0070713_1010102562 190
92 3300005439 Ga0070711_100771813 Ga0070711_1007718132 190
93 3300006028 Ga0070717_10248167 Ga0070717_102481673 190
94 3300006028 Ga0070717_10376606 Ga0070717_103766062 190
95 3300020070 Ga0206356_10827921 Ga0206356_108279212 190
96 3300020076 Ga0206355_1207516 Ga0206355_12075161 190
97 3300020080 Ga0206350_10239311 Ga0206350_102393111 190
98 3300025916 Ga0207663_10430413 Ga0207663_104304132 190
99 3300025917 Ga0207660_10958696 Ga0207660_109586962 190
100 3300025928 Ga0207700_10129613 Ga0207700_101296133 190
101 3300025929 Ga0207664_10127011 Ga0207664_101270112 190
102 3300031824 Ga0307413_10064096 Ga0307413_100640963 190
103 3300032126 Ga0307415_100111559 Ga0307415_1001115594 190
104 3300037418 Ga0395900_1205437 Ga0395900_1205437_67_660 190
105 3300037466 Ga0395898_0020879 Ga0395898_0020879_4722_5303 190
106 3300038443 Ga0395901_0032813 Ga0395901_0032813_2696_3277 190
107 3300039438 Ga0436360_1043461 Ga0436360_1043461_405_977 190
108 3300044694 Ga0466963_0431302 Ga0466963_0431302_218_799 190
109 3300045976 Ga0466967_0087698 Ga0466967_0087698_709_1281 190
110 3300045976 Ga0466967_0258660 Ga0466967_0258660_383_976 190
111 3300045976 Ga0466967_0772898 Ga0466967_0772898_163_735 190
112 3300046459 Ga0495629_0507629 Ga0495629_0507629_179_778 190
113 3300046516 Ga0495628_0092314 Ga0495628_0092314_1481_2080 190
114 3300046678 Ga0495599_0152636 Ga0495599_0152636_525_1124 190
115 3300047471 Ga0495684_0235708 Ga0495684_0235708_671_1270 190
116 3300049580 Ga0501046_0446888 Ga0501046_0446888_57_641 190
117 3300049581 Ga0501047_0065130 Ga0501047_0065130_2787_3371 190
118 3300049585 Ga0501069_0062999 Ga0501069_0062999_1218_1802 190
119 3300049586 Ga0501070_0025145 Ga0501070_0025145_677_1261 190
120 3300049589 Ga0501073_0197972 Ga0501073_0197972_790_1371 190
121 3300049589 Ga0501073_0357878 Ga0501073_0357878_395_991 190
122 3300049590 Ga0501074_0016291 Ga0501074_0016291_3964_4548 190
123 3300049742 Ga0501080_0100985 Ga0501080_0100985_751_1335 190
124 3300049742 Ga0501080_0145960 Ga0501080_0145960_365_949 190
125 3300053077 Ga0495601_0085550 Ga0495601_0085550_44_643 190
126 3300053084 Ga0495595_0218461 Ga0495595_0218461_191_790 190
127 3300053085 Ga0495619_0076392 Ga0495619_0076392_937_1536 190
128 3300005327 Ga0070658_10326658 Ga0070658_103266582 191
129 3300005329 Ga0070683_100379040 Ga0070683_1003790402 191
130 3300005336 Ga0070680_100042835 Ga0070680_1000428351 191
131 3300005339 Ga0070660_100443488 Ga0070660_1004434881 191
132 3300005344 Ga0070661_100060911 Ga0070661_1000609112 191
133 3300005458 Ga0070681_10002835 Ga0070681_100028354 191
134 3300005458 Ga0070681_10086198 Ga0070681_100861983 191
135 3300005458 Ga0070681_10220107 Ga0070681_102201072 191
136 3300005458 Ga0070681_10998740 Ga0070681_109987401 191
137 3300005530 Ga0070679_100017831 Ga0070679_1000178314 191
138 3300005530 Ga0070679_100142442 Ga0070679_1001424422 191
139 3300005530 Ga0070679_100481203 Ga0070679_1004812033 191
140 3300005535 Ga0070684_100200277 Ga0070684_1002002772 191
141 3300005535 Ga0070684_101324393 Ga0070684_1013243931 191
142 3300005548 Ga0070665_100044953 Ga0070665_1000449533 191
143 3300005563 Ga0068855_100005955 Ga0068855_1000059552 191
144 3300005577 Ga0068857_100009654 Ga0068857_1000096543 191
145 3300005614 Ga0068856_100331309 Ga0068856_1003313093 191
146 3300006173 Ga0070716_100651452 Ga0070716_1006514522 191
147 3300007076 Ga0075435_100863464 Ga0075435_1008634641 191
148 3300009093 Ga0105240_10066652 Ga0105240_100666523 191
149 3300009545 Ga0105237_10090640 Ga0105237_100906403 191
150 3300009551 Ga0105238_10013349 Ga0105238_100133493 191
151 3300009551 Ga0105238_10611097 Ga0105238_106110972 191
152 3300013104 Ga0157370_10198579 Ga0157370_101985792 191
153 3300013104 Ga0157370_10517212 Ga0157370_105172122 191
154 3300013105 Ga0157369_10055296 Ga0157369_100552962 191
155 3300013105 Ga0157369_10280715 Ga0157369_102807153 191
156 3300013296 Ga0157374_10088339 Ga0157374_100883394 191
157 3300013307 Ga0157372_10062792 Ga0157372_100627924 191
158 3300014497 Ga0182008_10169745 Ga0182008_101697452 191
159 3300020069 Ga0197907_11067716 Ga0197907_110677161 191
160 3300020070 Ga0206356_10506953 Ga0206356_105069532 191
161 3300020075 Ga0206349_1523539 Ga0206349_15235391 191
162 3300020076 Ga0206355_1697754 Ga0206355_16977541 191
163 3300020078 Ga0206352_10580408 Ga0206352_105804081 191
164 3300020082 Ga0206353_10009642 Ga0206353_100096421 191
165 3300020610 Ga0154015_1384070 Ga0154015_13840701 191
166 3300022467 Ga0224712_10008293 Ga0224712_100082933 191
167 3300022467 Ga0224712_10412151 Ga0224712_104121511 191
168 3300025909 Ga0207705_10426803 Ga0207705_104268033 191
169 3300025912 Ga0207707_10033867 Ga0207707_100338676 191
170 3300025912 Ga0207707_10119493 Ga0207707_101194932 191
171 3300025912 Ga0207707_10136549 Ga0207707_101365492 191
172 3300025913 Ga0207695_10107909 Ga0207695_101079093 191
173 3300025914 Ga0207671_10180872 Ga0207671_101808723 191
174 3300025917 Ga0207660_10151376 Ga0207660_101513763 191
175 3300025919 Ga0207657_10001467 Ga0207657_1000146727 191
176 3300025920 Ga0207649_10012809 Ga0207649_100128094 191
177 3300025921 Ga0207652_10480228 Ga0207652_104802283 191
178 3300025921 Ga0207652_10792999 Ga0207652_107929991 191
179 3300025924 Ga0207694_10027078 Ga0207694_100270782 191
180 3300025939 Ga0207665_10189425 Ga0207665_101894251 191
181 3300025944 Ga0207661_10266684 Ga0207661_102666842 191
182 3300026067 Ga0207678_10148074 Ga0207678_101480743 191
183 3300026078 Ga0207702_10135355 Ga0207702_101353552 191
184 3300026116 Ga0207674_10013111 Ga0207674_100131116 191
185 3300028379 Ga0268266_10029822 Ga0268266_100298224 191
186 3300031911 Ga0307412_10177961 Ga0307412_101779612 191
187 3300037068 Ga0373925_0806684 Ga0373925_0806684_59_649 191
188 3300037312 Ga0395899_0058777 Ga0395899_0058777_1916_2512 191
189 3300037418 Ga0395900_0018545 Ga0395900_0018545_1402_1998 191
190 3300037466 Ga0395898_0281153 Ga0395898_0281153_404_1000 191
191 3300037471 Ga0395905_0291162 Ga0395905_0291162_85_681 191
192 3300038443 Ga0395901_0061834 Ga0395901_0061834_1403_1999 191
193 3300038443 Ga0395901_0220030 Ga0395901_0220030_884_1471 191
194 3300039437 Ga0436365_0980803 Ga0436365_0980803_17_601 191
195 3300044683 Ga0466965_0222619 Ga0466965_0222619_215_817 191
196 3300044683 Ga0466965_0382609 Ga0466965_0382609_29_619 191
197 3300044694 Ga0466963_0001162 Ga0466963_0001162_4161_4760 191
198 3300044706 Ga0466964_0083963 Ga0466964_0083963_521_1111 191
199 3300044719 Ga0466971_0193173 Ga0466971_0193173_157_741 191
200 3300044719 Ga0466971_0263407 Ga0466971_0263407_102_692 191
201 3300044735 Ga0466968_0181555 Ga0466968_0181555_26_616 191
202 3300044765 Ga0466970_0322994 Ga0466970_0322994_67_657 191
203 3300044842 Ga0466957_0497148 Ga0466957_0497148_92_676 191
204 3300045836 Ga0466958_0036544 Ga0466958_0036544_865_1455 191
205 3300045976 Ga0466967_0025865 Ga0466967_0025865_3446_4045 191
206 3300045976 Ga0466967_0115109 Ga0466967_0115109_1107_1694 191
207 3300045976 Ga0466967_0149276 Ga0466967_0149276_167_757 191
208 3300045976 Ga0466967_0162292 Ga0466967_0162292_320_904 191
209 3300045976 Ga0466967_0313412 Ga0466967_0313412_822_1406 191
210 3300046462 Ga0495651_0288705 Ga0495651_0288705_216_803 191
211 3300046477 Ga0495664_0168491 Ga0495664_0168491_229_819 191
212 3300046517 Ga0495630_0718112 Ga0495630_0718112_79_666 191
213 3300047319 Ga0495674_0562001 Ga0495674_0562001_155_745 191
214 3300048904 Ga0496101_0149988 Ga0496101_0149988_177_776 191
215 3300048905 Ga0496102_0065681 Ga0496102_0065681_2343_2942 191
216 3300048906 Ga0496103_0301734 Ga0496103_0301734_264_863 191
217 3300048909 Ga0496106_0001342 Ga0496106_0001342_10745_11344 191
218 3300048910 Ga0496107_0000117 Ga0496107_0000117_14431_15030 191
219 3300048912 Ga0496109_1130106 Ga0496109_1130106_77_676 191
220 3300048913 Ga0496110_0836764 Ga0496110_0836764_199_798 191
221 3300048914 Ga0496111_0626476 Ga0496111_0626476_126_725 191
222 3300048915 Ga0496112_0026851 Ga0496112_0026851_1216_1812 191
223 3300048915 Ga0496112_0084833 Ga0496112_0084833_2112_2708 191
224 3300048915 Ga0496112_0137003 Ga0496112_0137003_1453_2049 191
225 3300048915 Ga0496112_0208610 Ga0496112_0208610_652_1257 191
226 3300048915 Ga0496112_0305267 Ga0496112_0305267_246_842 191
227 3300048916 Ga0496113_0108139 Ga0496113_0108139_396_992 191
228 3300048916 Ga0496113_0570036 Ga0496113_0570036_158_763 191
229 3300049583 Ga0501067_0020143 Ga0501067_0020143_2282_2869 191
230 3300049585 Ga0501069_0012479 Ga0501069_0012479_3237_3824 191
231 3300049586 Ga0501070_0653058 Ga0501070_0653058_187_771 191
232 3300050507 nmdc:mga05p37_1136081_c1 nmdc:mga05p37_1136081_c1_12_608 191
233 3300050513 nmdc:mga0rr50_568027_c1 nmdc:mga0rr50_568027_c1_102_698 191
234 3300059508 Ga0587088_065175 Ga0587088_065175_140_736 191
235 3300059509 Ga0587089_029407 Ga0587089_029407_196_792 191
236 3300059630 Ga0587128_024354 Ga0587128_024354_293_889 191
237 3300059630 Ga0587128_028652 Ga0587128_028652_233_829 191
238 3300061719 Ga0466962_0040430 Ga0466962_0040430_914_1498 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

43

143

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vrn-assembly1.cif.gz_B the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily 0.986 6 187
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9817 8 177
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.9811 10 176
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.981 10 176
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9781 10 177
ID Description Score Start End Superfamily
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9811 10 176 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9788 6 187 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9633 9 177 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9631 6 187 3.40.50.880
3fseB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9629 9 176 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7V9QL38-F1-model_v4 DJ-1/PfpI family protein 1 89 190
AF-A0A133ZEE5-F1-model_v4 Intracellular protease 1 domain protein 0.9994 81 183 GO:0006508
GO:0008233
AF-A0A538LZY7-F1-model_v4 Type 1 glutamine amidotransferase 0.9983 3 190 GO:0016740
AF-A0A1H3JBQ7-F1-model_v4 Protease I 0.9977 10 180 GO:0006508
GO:0008233
AF-A0A3C0B766-F1-model_v4 Protease 0.9977 96 184 GO:0006508
GO:0008233

Feature Viewer

pLDDT pTM Quality
95.81 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map