F350934

General Info

Members Datasets Scaffolds Average Seq Length
238 173 476 311

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10438656|Ga0105239_104386562
Length 365
Sequence LANLTVLDFEKSIAELDQWLERLRQISRDPDNSQNTPELAGQIAKLEQDRRAILEGVFANLTPWDKVLLARHEKRPYTLDYINAITDGFEELHGDRMFADDPAIVSGIGWIRVPIARTDMASTEQSGEESDIPPVKIPEPYERVAVAIVGHQKGRDIKTRQLRNFGYARPEGYRKAVRVMKLAAKFGMPIITLIDTPGAAADVAADERGVSEAIASAMFEMATLPVPIVSVVIGEGGSGGALAIGVADRVLMLEYSVYSVIAPEGCAAILWRDPEKKSDAAQALNLTAQRALDLKIIDAVVSEPLGGAHRDWAEAAENVRHAVARQLADLRGLTGEQLSDGRYERFRNLGTFTTAQPKKSSSNGA

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
159 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
160 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
161 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
162 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
163 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
164 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
165 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
166 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
171 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
172 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.34
Nodule 0
Rhizoplane 2.1
Rhizosphere 81.09
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10438656 3300010375 Bacteria 1481
2 Ga0070683_100000520 3300005329 Bacteria 27050
3 Ga0070683_100004877 3300005329 Bacteria 11115
4 Ga0070683_100246857 3300005329 Bacteria 1698
5 Ga0070690_100031198 3300005330 Bacteria 3318
6 Ga0070660_100000854 3300005339 Bacteria 20293
7 Ga0070689_100149441 3300005340 Bacteria 1883
8 Ga0070691_10000128 3300005341 Bacteria 23228
9 Ga0070661_100096829 3300005344 Bacteria 2190
10 Ga0070669_100373758 3300005353 Bacteria 1161
11 Ga0070675_100154344 3300005354 Bacteria 1970
12 Ga0070714_100001537 3300005435 Bacteria 16838
13 Ga0070714_100046852 3300005435 Bacteria 3670
14 Ga0070714_100070888 3300005435 Bacteria 3013
15 Ga0070713_100000309 3300005436 Bacteria 32256
16 Ga0070694_100233063 3300005444 Bacteria 1386
17 Ga0070708_100261467 3300005445 Bacteria 1627
18 Ga0070681_10360894 3300005458 Bacteria 1363
19 Ga0070706_100051078 3300005467 Bacteria 3815
20 Ga0070706_100158239 3300005467 Bacteria 2115
21 Ga0070707_100360287 3300005468 Bacteria 1413
22 Ga0070698_100000551 3300005471 Bacteria 40014
23 Ga0070679_100001251 3300005530 Bacteria 22398
24 Ga0070684_100000312 3300005535 Bacteria 33509
25 Ga0070684_100135587 3300005535 Bacteria 2223
26 Ga0070697_100004843 3300005536 Bacteria 10322
27 Ga0070664_100006067 3300005564 Bacteria 9767
28 Ga0068857_100000230 3300005577 Bacteria 37360
29 Ga0068856_100022216 3300005614 Bacteria 6169
30 Ga0068856_100099382 3300005614 Bacteria 2901
31 Ga0068852_100278694 3300005616 Bacteria 1611
32 Ga0068859_100435853 3300005617 Bacteria 1407
33 Ga0068870_10168288 3300005840 Bacteria 1306
34 Ga0068860_100576980 3300005843 Bacteria 1129
35 Ga0081539_10164222 3300005985 Bacteria 1055
36 Ga0070717_10359293 3300006028 Bacteria 1303
37 Ga0075365_10000607 3300006038 Bacteria 14086
38 Ga0075364_10016168 3300006051 Bacteria 4640
39 Ga0070712_100024481 3300006175 Bacteria 4002
40 Ga0075367_10005935 3300006178 Bacteria 6126
41 Ga0075369_10000072 3300006186 Bacteria 26574
42 Ga0075427_10000199 3300006194 Bacteria 6092
43 Ga0075370_10000085 3300006353 Bacteria 28579
44 Ga0075428_100002334 3300006844 Bacteria 20589
45 Ga0075428_100072524 3300006844 Bacteria 3761
46 Ga0075430_100000409 3300006846 Bacteria 31906
47 Ga0075430_100244792 3300006846 Bacteria 1486
48 Ga0075431_100002251 3300006847 Bacteria 18501
49 Ga0075431_100010932 3300006847 Bacteria 9132
50 Ga0075431_100234451 3300006847 Bacteria 1869
51 Ga0075433_10329750 3300006852 Bacteria 1350
52 Ga0075434_100036176 3300006871 Bacteria 4884
53 Ga0075434_100392930 3300006871 Bacteria 1408
54 Ga0075429_100017908 3300006880 Bacteria 6125
55 Ga0075429_100039115 3300006880 Bacteria 4128
56 Ga0075429_100097638 3300006880 Bacteria 2563
57 Ga0068865_100218152 3300006881 Bacteria 1490
58 Ga0097620_100435877 3300006931 Bacteria 1407
59 Ga0075435_100121657 3300007076 Bacteria 2178
60 Ga0111539_10060989 3300009094 Bacteria 4469
61 Ga0111539_10150322 3300009094 Bacteria 2726
62 Ga0111539_10212956 3300009094 Bacteria 2251
63 Ga0111539_10595077 3300009094 Bacteria 1288
64 Ga0105245_10000008 3300009098 Bacteria 279925
65 Ga0105245_10257192 3300009098 Bacteria 1698
66 Ga0114129_10000756 3300009147 Bacteria 41145
67 Ga0114129_10004596 3300009147 Bacteria 19485
68 Ga0114129_10044775 3300009147 Bacteria 6224
69 Ga0114129_10086862 3300009147 Bacteria 4337
70 Ga0114129_10249737 3300009147 Bacteria 2382
71 Ga0105242_10371238 3300009176 Bacteria 1327
72 Ga0105237_10000018 3300009545 Bacteria 237291
73 Ga0105238_10015196 3300009551 Bacteria 7795
74 Ga0105249_10030482 3300009553 Bacteria 4876
75 Ga0105239_10010433 3300010375 Bacteria 10387
76 Ga0105239_10089494 3300010375 Bacteria 3394
77 Ga0157371_10111545 3300013102 Bacteria 1941
78 Ga0157370_10137396 3300013104 Unclassified 2278
79 Ga0157369_10001798 3300013105 Bacteria 25966
80 Ga0157374_10112986 3300013296 Bacteria 2614
81 Ga0157378_10146325 3300013297 Bacteria 2198
82 Ga0157372_10027726 3300013307 Bacteria 6173
83 Ga0157380_10011602 3300014326 Bacteria 6370
84 Ga0157376_10036480 3300014969 Bacteria 3983
85 Ga0206356_10377977 3300020070 Bacteria 3014
86 Ga0213876_10104093 3300021384 Bacteria 1505
87 Ga0213875_10002371 3300021388 Bacteria 11334
88 Ga0224712_10000479 3300022467 Bacteria 8048
89 Ga0207705_10002431 3300025909 Bacteria 14370
90 Ga0207707_10049913 3300025912 Bacteria 3646
91 Ga0207671_10000049 3300025914 Bacteria 194682
92 Ga0207693_10209751 3300025915 Bacteria 1531
93 Ga0207657_10005295 3300025919 Bacteria 13516
94 Ga0207652_10096984 3300025921 Unclassified 2598
95 Ga0207652_10189990 3300025921 Bacteria 1847
96 Ga0207646_10003340 3300025922 Bacteria 18224
97 Ga0207646_10277224 3300025922 Bacteria 1515
98 Ga0207659_10120861 3300025926 Bacteria 2007
99 Ga0207687_10000071 3300025927 Bacteria 77050
100 Ga0207687_10165585 3300025927 Bacteria 1700
101 Ga0207700_10000509 3300025928 Bacteria 22819
102 Ga0207700_10140874 3300025928 Bacteria 1981
103 Ga0207664_10044447 3300025929 Bacteria 3479
104 Ga0207664_10093250 3300025929 Bacteria 2473
105 Ga0207670_10034653 3300025936 Bacteria 3265
106 Ga0207670_10067444 3300025936 Bacteria 2462
107 Ga0207704_10186084 3300025938 Bacteria 1506
108 Ga0207661_10000061 3300025944 Bacteria 77364
109 Ga0207661_10199465 3300025944 Bacteria 1758
110 Ga0207679_10009219 3300025945 Bacteria 6308
111 Ga0207702_10000812 3300026078 Bacteria 33136
112 Ga0207702_10185904 3300026078 Bacteria 1916
113 Ga0207676_10474687 3300026095 Bacteria 1183
114 Ga0207674_10000149 3300026116 Bacteria 82289
115 Ga0207675_100169169 3300026118 Bacteria 2088
116 Ga0207683_10004418 3300026121 Bacteria 12153
117 Ga0209966_1003446 3300027695 Bacteria 2660
118 Ga0268266_10038982 3300028379 Bacteria 4046
119 Ga0265326_10004805 3300028558 Bacteria 4285
120 Ga0265334_10000092 3300028573 Bacteria 64246
121 Ga0265334_10010897 3300028573 Bacteria 3837
122 Ga0265323_10015525 3300028653 Bacteria 2994
123 Ga0265323_10020398 3300028653 Bacteria 2552
124 Ga0307515_10000019 3300028794 Bacteria 422262
125 Ga0307515_10132442 3300028794 Bacteria 2735
126 Ga0265338_10005957 3300028800 Bacteria 15684
127 Ga0265338_10067782 3300028800 Bacteria 3079
128 Ga0265338_10262393 3300028800 Bacteria 1269
129 Ga0265330_10000910 3300031235 Bacteria 18260
130 Ga0265330_10042175 3300031235 Bacteria 2022
131 Ga0265316_10001839 3300031344 Bacteria 22312
132 Ga0265316_10034532 3300031344 Bacteria 4106
133 Ga0265316_10058864 3300031344 Bacteria 2990
134 Ga0265316_10150172 3300031344 Bacteria 1745
135 Ga0307509_10000065 3300031507 Bacteria 142674
136 Ga0307509_10041621 3300031507 Bacteria 4984
137 Ga0307509_10270114 3300031507 Bacteria 1469
138 Ga0265313_10000109 3300031595 Bacteria 83136
139 Ga0265313_10031997 3300031595 Bacteria 2691
140 Ga0265342_10042480 3300031712 Bacteria 2746
141 Ga0307516_10126629 3300031730 Bacteria 2338
142 Ga0307405_10181334 3300031731 Bacteria 1512
143 Ga0307406_10021829 3300031901 Bacteria 3792
144 Ga0307416_100268087 3300032002 Bacteria 1674
145 Ga0307415_100016536 3300032126 Bacteria 4401
146 Ga0307415_100213506 3300032126 Bacteria 1541
147 Ga0373949_0000251 3300035090 Bacteria 20226
148 Ga0373923_0153832 3300035111 Bacteria 1046
149 Ga0373936_0000006 3300035113 Bacteria 318697
150 Ga0373941_0018631 3300035115 Bacteria 1920
151 Ga0373943_0056746 3300035170 Bacteria 1944
152 Ga0373955_0105852 3300035172 Bacteria 1621
153 Ga0373961_0000072 3300035241 Bacteria 54778
154 Ga0373935_0292649 3300035692 Bacteria 1149
155 Ga0373927_0000003 3300035695 Bacteria 480348
156 Ga0373937_0091808 3300036401 Bacteria 2814
157 Ga0395899_0023120 3300037312 Bacteria 4710
158 Ga0395900_0017700 3300037418 Bacteria 7275
159 Ga0395898_0016088 3300037466 Bacteria 7663
160 Ga0436364_0244866 3300037853 Bacteria 6015
161 Ga0436364_1477747 3300037853 Bacteria 1867
162 Ga0395901_0181522 3300038443 Bacteria 2207
163 Ga0436365_1120825 3300039437 Bacteria 1617
164 Ga0436365_1533244 3300039437 Bacteria 2436
165 Ga0436361_0479208 3300039447 Bacteria 1860
166 Ga0436363_1548781 3300039450 Bacteria 1166
167 Ga0451577_0023331 3300042876 Bacteria 5644
168 Ga0451577_0035137 3300042876 Bacteria 4515
169 Ga0451577_0366146 3300042876 Bacteria 1308
170 Ga0453683_0024051 3300044673 Bacteria 3879
171 Ga0453684_0000078 3300044712 Bacteria 428794
172 Ga0453684_0004004 3300044712 Bacteria 32120
173 Ga0453684_0038862 3300044712 Bacteria 6495
174 Ga0451576_0056756 3300045051 Bacteria 4094
175 Ga0451576_0310940 3300045051 Bacteria 1648
176 Ga0466967_0072771 3300045976 Bacteria 3082
177 Ga0495638_0148465 3300046460 Bacteria 1362
178 Ga0495630_0027550 3300046517 Bacteria 4217
179 Ga0495636_0011198 3300047318 Bacteria 3549
180 Ga0495674_0013389 3300047319 Bacteria 7713
181 Ga0495674_0104014 3300047319 Bacteria 2414
182 Ga0495686_0005041 3300047472 Bacteria 10599
183 Ga0496104_0131524 3300048907 Bacteria 2404
184 Ga0496104_0460540 3300048907 Bacteria 1183
185 Ga0496109_0469919 3300048912 Bacteria 1188
186 Ga0496110_0042423 3300048913 Bacteria 3971
187 Ga0496112_0350844 3300048915 Bacteria 1418
188 Ga0501292_002743 3300049515 Bacteria 2297
189 Ga0501033_0210388 3300049570 Bacteria 1387
190 Ga0501034_0504083 3300049571 Bacteria 1124
191 Ga0501047_0073229 3300049581 Bacteria 3298
192 Ga0501048_0261477 3300049582 Bacteria 1230
193 Ga0501074_0012655 3300049590 Bacteria 6137
194 Ga0501075_0085553 3300049591 Bacteria 2389
195 Ga0501227_015392 3300049665 Bacteria 1709
196 Ga0501081_0127941 3300049743 Bacteria 1813
197 nmdc:mga03n38_205_c1 3300050490 Bacteria 13523
198 nmdc:mga00v17_1719_c1 3300050491 Bacteria 11370
199 nmdc:mga00v17_447_c1 3300050491 Bacteria 23192
200 nmdc:mga0yw44_28_c1 3300050492 Bacteria 35472
201 nmdc:mga06z11_618_c1 3300050494 Bacteria 12948
202 nmdc:mga07m45_145_c1 3300050496 Bacteria 28384
203 nmdc:mga05p37_16008_c1 3300050507 Bacteria 9024
204 nmdc:mga05p37_478896_c1 3300050507 Bacteria 1434
205 nmdc:mga05p37_7357_c2 3300050507 Bacteria 7571
206 nmdc:mga09592_15850_c1 3300050508 Bacteria 6159
207 nmdc:mga09592_1962_c1 3300050508 Bacteria 16588
208 nmdc:mga09592_8606_c1 3300050508 Bacteria 8302
209 nmdc:mga0qj67_375316_c1 3300050509 Bacteria 1148
210 nmdc:mga0qj67_39943_c1 3300050509 Bacteria 3687
211 nmdc:mga06r32_13727_c1 3300050510 Bacteria 7347
212 nmdc:mga06r32_7622_c1 3300050510 Bacteria 9734
213 nmdc:mga08y16_147632_c1 3300050511 Bacteria 2444
214 nmdc:mga08y16_216655_c1 3300050511 Bacteria 1982
215 nmdc:mga08y16_54320_c1 3300050511 Bacteria 4185
216 nmdc:mga0n895_57944_c1 3300050512 Bacteria 3819
217 nmdc:mga0rr50_10386_c1 3300050513 Bacteria 5905
218 nmdc:mga08x19_82728_c1 3300050514 Bacteria 2109
219 nmdc:mga0a205_53034_c1 3300050515 Bacteria 3914
220 nmdc:mga0a205_90530_c1 3300050515 Bacteria 2957
221 nmdc:mga0sz30_87_c1 3300050516 Bacteria 30481
222 Ga0495612_0050282 3300053078 Bacteria 1712
223 Ga0500635_0043789 3300053080 Bacteria 1507
224 Ga0500646_0019273 3300053090 Bacteria 1804
225 Ga0500583_0050687 3300053092 Bacteria 1926
226 Ga0500566_0005763 3300053094 Bacteria 7358
227 Ga0500566_0006156 3300053094 Bacteria 7133
228 Ga0500654_050600 3300053099 Bacteria 2241
229 Ga0500594_0027630 3300053118 Bacteria 1471
230 Ga0500595_000222 3300053119 Bacteria 38935
231 Ga0500597_005862 3300053120 Bacteria 4014
232 Ga0500618_002902 3300053125 Bacteria 6143
233 Ga0500642_0029452 3300053130 Bacteria 2275
234 Ga0500559_0056529 3300053136 Bacteria 1742
235 Ga0500619_050921 3300053154 Bacteria 1340
236 Ga0500630_022196 3300053159 Bacteria 3135
237 Ga0500636_0023991 3300053177 Bacteria 3606
238 Ga0530510_0082255 3300061734 Bacteria 2345
239 Ga0105239_10438656
240 Ga0070683_100000520
241 Ga0070683_100004877
242 Ga0070683_100246857
243 Ga0070690_100031198
244 Ga0070660_100000854
245 Ga0070689_100149441
246 Ga0070691_10000128
247 Ga0070661_100096829
248 Ga0070669_100373758
249 Ga0070675_100154344
250 Ga0070714_100001537
251 Ga0070714_100046852
252 Ga0070714_100070888
253 Ga0070713_100000309
254 Ga0070694_100233063
255 Ga0070708_100261467
256 Ga0070681_10360894
257 Ga0070706_100051078
258 Ga0070706_100158239
259 Ga0070707_100360287
260 Ga0070698_100000551
261 Ga0070679_100001251
262 Ga0070684_100000312
263 Ga0070684_100135587
264 Ga0070697_100004843
265 Ga0070664_100006067
266 Ga0068857_100000230
267 Ga0068856_100022216
268 Ga0068856_100099382
269 Ga0068852_100278694
270 Ga0068859_100435853
271 Ga0068870_10168288
272 Ga0068860_100576980
273 Ga0081539_10164222
274 Ga0070717_10359293
275 Ga0075365_10000607
276 Ga0075364_10016168
277 Ga0070712_100024481
278 Ga0075367_10005935
279 Ga0075369_10000072
280 Ga0075427_10000199
281 Ga0075370_10000085
282 Ga0075428_100002334
283 Ga0075428_100072524
284 Ga0075430_100000409
285 Ga0075430_100244792
286 Ga0075431_100002251
287 Ga0075431_100010932
288 Ga0075431_100234451
289 Ga0075433_10329750
290 Ga0075434_100036176
291 Ga0075434_100392930
292 Ga0075429_100017908
293 Ga0075429_100039115
294 Ga0075429_100097638
295 Ga0068865_100218152
296 Ga0097620_100435877
297 Ga0075435_100121657
298 Ga0111539_10060989
299 Ga0111539_10150322
300 Ga0111539_10212956
301 Ga0111539_10595077
302 Ga0105245_10000008
303 Ga0105245_10257192
304 Ga0114129_10000756
305 Ga0114129_10004596
306 Ga0114129_10044775
307 Ga0114129_10086862
308 Ga0114129_10249737
309 Ga0105242_10371238
310 Ga0105237_10000018
311 Ga0105238_10015196
312 Ga0105249_10030482
313 Ga0105239_10010433
314 Ga0105239_10089494
315 Ga0157371_10111545
316 Ga0157370_10137396
317 Ga0157369_10001798
318 Ga0157374_10112986
319 Ga0157378_10146325
320 Ga0157372_10027726
321 Ga0157380_10011602
322 Ga0157376_10036480
323 Ga0206356_10377977
324 Ga0213876_10104093
325 Ga0213875_10002371
326 Ga0224712_10000479
327 Ga0207705_10002431
328 Ga0207707_10049913
329 Ga0207671_10000049
330 Ga0207693_10209751
331 Ga0207657_10005295
332 Ga0207652_10096984
333 Ga0207652_10189990
334 Ga0207646_10003340
335 Ga0207646_10277224
336 Ga0207659_10120861
337 Ga0207687_10000071
338 Ga0207687_10165585
339 Ga0207700_10000509
340 Ga0207700_10140874
341 Ga0207664_10044447
342 Ga0207664_10093250
343 Ga0207670_10034653
344 Ga0207670_10067444
345 Ga0207704_10186084
346 Ga0207661_10000061
347 Ga0207661_10199465
348 Ga0207679_10009219
349 Ga0207702_10000812
350 Ga0207702_10185904
351 Ga0207676_10474687
352 Ga0207674_10000149
353 Ga0207675_100169169
354 Ga0207683_10004418
355 Ga0209966_1003446
356 Ga0268266_10038982
357 Ga0265326_10004805
358 Ga0265334_10000092
359 Ga0265334_10010897
360 Ga0265323_10015525
361 Ga0265323_10020398
362 Ga0307515_10000019
363 Ga0307515_10132442
364 Ga0265338_10005957
365 Ga0265338_10067782
366 Ga0265338_10262393
367 Ga0265330_10000910
368 Ga0265330_10042175
369 Ga0265316_10001839
370 Ga0265316_10034532
371 Ga0265316_10058864
372 Ga0265316_10150172
373 Ga0307509_10000065
374 Ga0307509_10041621
375 Ga0307509_10270114
376 Ga0265313_10000109
377 Ga0265313_10031997
378 Ga0265342_10042480
379 Ga0307516_10126629
380 Ga0307405_10181334
381 Ga0307406_10021829
382 Ga0307416_100268087
383 Ga0307415_100016536
384 Ga0307415_100213506
385 Ga0373949_0000251
386 Ga0373923_0153832
387 Ga0373936_0000006
388 Ga0373941_0018631
389 Ga0373943_0056746
390 Ga0373955_0105852
391 Ga0373961_0000072
392 Ga0373935_0292649
393 Ga0373927_0000003
394 Ga0373937_0091808
395 Ga0395899_0023120
396 Ga0395900_0017700
397 Ga0395898_0016088
398 Ga0436364_0244866
399 Ga0436364_1477747
400 Ga0395901_0181522
401 Ga0436365_1120825
402 Ga0436365_1533244
403 Ga0436361_0479208
404 Ga0436363_1548781
405 Ga0451577_0023331
406 Ga0451577_0035137
407 Ga0451577_0366146
408 Ga0453683_0024051
409 Ga0453684_0000078
410 Ga0453684_0004004
411 Ga0453684_0038862
412 Ga0451576_0056756
413 Ga0451576_0310940
414 Ga0466967_0072771
415 Ga0495638_0148465
416 Ga0495630_0027550
417 Ga0495636_0011198
418 Ga0495674_0013389
419 Ga0495674_0104014
420 Ga0495686_0005041
421 Ga0496104_0131524
422 Ga0496104_0460540
423 Ga0496109_0469919
424 Ga0496110_0042423
425 Ga0496112_0350844
426 Ga0501292_002743
427 Ga0501033_0210388
428 Ga0501034_0504083
429 Ga0501047_0073229
430 Ga0501048_0261477
431 Ga0501074_0012655
432 Ga0501075_0085553
433 Ga0501227_015392
434 Ga0501081_0127941
435 nmdc:mga03n38_205_c1
436 nmdc:mga00v17_1719_c1
437 nmdc:mga00v17_447_c1
438 nmdc:mga0yw44_28_c1
439 nmdc:mga06z11_618_c1
440 nmdc:mga07m45_145_c1
441 nmdc:mga05p37_16008_c1
442 nmdc:mga05p37_478896_c1
443 nmdc:mga05p37_7357_c2
444 nmdc:mga09592_15850_c1
445 nmdc:mga09592_1962_c1
446 nmdc:mga09592_8606_c1
447 nmdc:mga0qj67_375316_c1
448 nmdc:mga0qj67_39943_c1
449 nmdc:mga06r32_13727_c1
450 nmdc:mga06r32_7622_c1
451 nmdc:mga08y16_147632_c1
452 nmdc:mga08y16_216655_c1
453 nmdc:mga08y16_54320_c1
454 nmdc:mga0n895_57944_c1
455 nmdc:mga0rr50_10386_c1
456 nmdc:mga08x19_82728_c1
457 nmdc:mga0a205_53034_c1
458 nmdc:mga0a205_90530_c1
459 nmdc:mga0sz30_87_c1
460 Ga0495612_0050282
461 Ga0500635_0043789
462 Ga0500646_0019273
463 Ga0500583_0050687
464 Ga0500566_0005763
465 Ga0500566_0006156
466 Ga0500654_050600
467 Ga0500594_0027630
468 Ga0500595_000222
469 Ga0500597_005862
470 Ga0500618_002902
471 Ga0500642_0029452
472 Ga0500559_0056529
473 Ga0500619_050921
474 Ga0500630_022196
475 Ga0500636_0023991
476 Ga0530510_0082255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

139

350

0.99

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

6

128

0.91

PF01039

Carboxyl_trans

Carboxyl transferase domain

142

347

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.956 4 311
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.946 5 311
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9373 4 311
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.937 6 311
2f9i-assembly1.cif.gz_A crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9284 1 311
ID Description Score Start End Superfamily
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9407 55 311 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9402 5 311 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9172 5 311 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9159 55 311 3.90.226.10
4l6wA02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8646 76 292 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7Y5RSQ7-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9958 210 313 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A2D5NEY2-F1-model_v4 deleted 0.992 201 313
AF-X0VPV1-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9912 185 313 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A536DQL1-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9898 54 313 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A3C1X866-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9897 30 313 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295

Map