F350905

General Info

Members Datasets Scaffolds Average Seq Length
238 161 476 264

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10000119|Ga0105243_1000011948
Length 287
Sequence LIKRDLDIDRVNIQVQPSATADGSDTFMKLLLIGDVVGKPGRSALLDRLQDMQEQHAIDFTVMNAENVAGGFSITAAIAELLFSSGVDVMTSGNHIFDKHEVIEYIQKQPRLLRPANYPPHTPGNGMWVGEAKGVRIAVISLLGRVFMQPADDPFRIVNELITSLPDDVKIRIVDMHAEATSEKAAMGWYLDGRASAVYGTHTHVQTADERLLHEGTAYITDLGMTGSYGGVIGMKKGDIINRFTSPIHRKPDHSRAEVRICGVVVDVDEETGRARSIERINLEHTS

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
101 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
105 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
106 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
116 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
157 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
161 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 5.46
Rhizosphere 90.76
Stem 0
Stem Tuber 0
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10000119 3300009148 Bacteria 91258
2 JGI24034J14986_100407 3300001432 Bacteria 2452
3 JGI24748J21848_1000007 3300002074 Bacteria 208838
4 JGI24034J26672_10000002 3300002239 Bacteria 925353
5 rootL2_10212703 3300003322 Unclassified 2420
6 Ga0065707_10161432 3300005295 Unclassified 1560
7 Ga0070690_100080695 3300005330 Bacteria 2128
8 Ga0068869_100436127 3300005334 Bacteria 1083
9 Ga0070689_100114116 3300005340 Unclassified 2152
10 Ga0070668_100022818 3300005347 Bacteria 4731
11 Ga0070675_100500559 3300005354 Bacteria 1095
12 Ga0070671_100007418 3300005355 Bacteria 8766
13 Ga0070673_100232078 3300005364 Bacteria 1601
14 Ga0070703_10000530 3300005406 Bacteria 14354
15 Ga0070701_10226921 3300005438 Bacteria 1117
16 Ga0070700_100006795 3300005441 Bacteria 6135
17 Ga0070700_100110343 3300005441 Bacteria 1828
18 Ga0070700_100172648 3300005441 Unclassified 1498
19 Ga0070694_100006114 3300005444 Bacteria 7303
20 Ga0070694_100038727 3300005444 Bacteria 3170
21 Ga0070694_100373251 3300005444 Unclassified 1111
22 Ga0070708_100184856 3300005445 Bacteria 1949
23 Ga0070708_100721420 3300005445 Bacteria 938
24 Ga0068867_100480721 3300005459 Bacteria 1064
25 Ga0070685_10074148 3300005466 Bacteria 2024
26 Ga0070706_100002494 3300005467 Bacteria 18540
27 Ga0070706_100116708 3300005467 Bacteria 2486
28 Ga0070706_100297272 3300005467 Bacteria 1507
29 Ga0070707_100001325 3300005468 Bacteria 24376
30 Ga0070707_100008179 3300005468 Bacteria 9705
31 Ga0070707_100309354 3300005468 Unclassified 1536
32 Ga0070698_100007404 3300005471 Bacteria 11878
33 Ga0070698_100090020 3300005471 Bacteria 3052
34 Ga0070698_100342320 3300005471 Unclassified 1427
35 Ga0070699_100149861 3300005518 Bacteria 2062
36 Ga0070697_100095653 3300005536 Bacteria 2463
37 Ga0070697_100279303 3300005536 Bacteria 1433
38 Ga0070697_100646554 3300005536 Bacteria 931
39 Ga0070686_100185780 3300005544 Bacteria 1480
40 Ga0070695_100273747 3300005545 Bacteria 1238
41 Ga0070704_100000638 3300005549 Bacteria 16925
42 Ga0070704_100133538 3300005549 Bacteria 1927
43 Ga0068854_100118666 3300005578 Unclassified 2005
44 Ga0070702_100100489 3300005615 Bacteria 1773
45 Ga0070702_100165491 3300005615 Bacteria 1433
46 Ga0068859_100017521 3300005617 Bacteria 7200
47 Ga0068859_100254814 3300005617 Bacteria 1845
48 Ga0068859_100546837 3300005617 Bacteria 1253
49 Ga0068866_10009446 3300005718 Unclassified 4141
50 Ga0068861_100017825 3300005719 Bacteria 5046
51 Ga0068861_100080574 3300005719 Bacteria 2547
52 Ga0068858_100000008 3300005842 Bacteria 238361
53 Ga0068860_100292176 3300005843 Bacteria 1595
54 Ga0068860_100482465 3300005843 Bacteria 1236
55 Ga0068860_100579651 3300005843 Bacteria 1126
56 Ga0068862_100099686 3300005844 Bacteria 2540
57 Ga0070715_10000031 3300006163 Bacteria 86230
58 Ga0070716_100000007 3300006173 Bacteria 256300
59 Ga0075428_100197483 3300006844 Bacteria 2176
60 Ga0075430_100102413 3300006846 Bacteria 2390
61 Ga0075431_100042530 3300006847 Bacteria 4687
62 Ga0075433_10179338 3300006852 Bacteria 1885
63 Ga0075436_100000008 3300006914 Bacteria 279288
64 Ga0097620_100017520 3300006931 Bacteria 7200
65 Ga0097620_100254805 3300006931 Bacteria 1845
66 Ga0097620_100546823 3300006931 Bacteria 1253
67 Ga0075435_100000244 3300007076 Bacteria 33626
68 Ga0075435_100017349 3300007076 Bacteria 5447
69 Ga0099794_10022132 3300007265 Unclassified 2896
70 Ga0111539_10010730 3300009094 Bacteria 11530
71 Ga0105245_10047079 3300009098 Unclassified 3854
72 Ga0105247_10000001 3300009101 Bacteria 739726
73 Ga0114129_10017890 3300009147 Bacteria 10088
74 Ga0114129_10045834 3300009147 Bacteria 6146
75 Ga0114129_10613237 3300009147 Bacteria 1408
76 Ga0105243_10004942 3300009148 Bacteria 10444
77 Ga0105243_10301978 3300009148 Bacteria 1451
78 Ga0105243_10360878 3300009148 Bacteria 1337
79 Ga0105242_10000113 3300009176 Bacteria 58633
80 Ga0105242_10004299 3300009176 Bacteria 11099
81 Ga0105242_10055509 3300009176 Bacteria 3240
82 Ga0105242_10336809 3300009176 Bacteria 1389
83 Ga0105242_10581130 3300009176 Bacteria 1079
84 Ga0105249_10000028 3300009553 Bacteria 230039
85 Ga0105249_10014015 3300009553 Bacteria 7086
86 Ga0105249_10592578 3300009553 Bacteria 1162
87 Ga0105239_10030724 3300010375 Bacteria 5908
88 Ga0157378_10000163 3300013297 Bacteria 63786
89 Ga0157378_10036818 3300013297 Unclassified 4330
90 Ga0157378_10717614 3300013297 Unclassified 1020
91 Ga0163162_10000027 3300013306 Bacteria 178451
92 Ga0163162_10001557 3300013306 Bacteria 21449
93 Ga0163162_10083821 3300013306 Unclassified 3262
94 Ga0163162_10252071 3300013306 Unclassified 1897
95 Ga0163162_10758896 3300013306 Unclassified 1089
96 Ga0157375_10035866 3300013308 Bacteria 4738
97 Ga0157375_10249161 3300013308 Bacteria 1937
98 Ga0157375_10418764 3300013308 Bacteria 1505
99 Ga0163163_10219841 3300014325 Bacteria 1948
100 Ga0157380_10058481 3300014326 Bacteria 3073
101 Ga0157380_10131675 3300014326 Bacteria 2135
102 Ga0157376_10724000 3300014969 Unclassified 1002
103 Ga0163161_10005583 3300017792 Bacteria 8720
104 Ga0163161_10218526 3300017792 Bacteria 1475
105 Ga0163161_10358257 3300017792 Bacteria 1161
106 Ga0207672_1000748 3300025223 Bacteria 3577
107 Ga0207653_10000201 3300025885 Bacteria 40440
108 Ga0207642_10022160 3300025899 Bacteria 2514
109 Ga0207710_10000003 3300025900 Bacteria 1071597
110 Ga0207685_10000007 3300025905 Bacteria 278341
111 Ga0207699_10248694 3300025906 Bacteria 1224
112 Ga0207684_10019633 3300025910 Bacteria 5781
113 Ga0207684_10461913 3300025910 Unclassified 1090
114 Ga0207662_10192387 3300025918 Bacteria 1317
115 Ga0207646_10003914 3300025922 Bacteria 16534
116 Ga0207646_10079652 3300025922 Unclassified 2929
117 Ga0207646_10249524 3300025922 Bacteria 1603
118 Ga0207659_10160410 3300025926 Bacteria 1765
119 Ga0207687_10428994 3300025927 Bacteria 1092
120 Ga0207644_10000209 3300025931 Bacteria 40524
121 Ga0207686_10000114 3300025934 Bacteria 64832
122 Ga0207686_10000400 3300025934 Bacteria 30163
123 Ga0207686_10006928 3300025934 Bacteria 6102
124 Ga0207709_10000162 3300025935 Bacteria 91279
125 Ga0207709_10002929 3300025935 Bacteria 10423
126 Ga0207709_10184208 3300025935 Bacteria 1477
127 Ga0207670_10289876 3300025936 Bacteria 1278
128 Ga0207704_10141940 3300025938 Bacteria 1682
129 Ga0207665_10000018 3300025939 Bacteria 122653
130 Ga0207665_10027264 3300025939 Bacteria 3775
131 Ga0207689_10437125 3300025942 Bacteria 1093
132 Ga0207712_10000110 3300025961 Bacteria 89234
133 Ga0207668_10015518 3300025972 Bacteria 4735
134 Ga0207640_10066536 3300025981 Bacteria 2408
135 Ga0207677_10668894 3300026023 Bacteria 918
136 Ga0207703_10000354 3300026035 Bacteria 49391
137 Ga0207648_10326196 3300026089 Bacteria 1380
138 Ga0207648_10393922 3300026089 Unclassified 1254
139 Ga0207675_100001995 3300026118 Bacteria 20351
140 Ga0207675_100107467 3300026118 Bacteria 2631
141 Ga0207675_100861882 3300026118 Unclassified 921
142 Ga0209588_1012747 3300027671 Bacteria 2556
143 Ga0207428_10006080 3300027907 Bacteria 11165
144 Ga0207428_10070786 3300027907 Bacteria 2741
145 Ga0268264_10094624 3300028381 Bacteria 2583
146 Ga0265322_10002011 3300028654 Bacteria 6410
147 Ga0265338_10000800 3300028800 Bacteria 53168
148 Ga0265338_10007066 3300028800 Bacteria 14076
149 Ga0265338_10038651 3300028800 Bacteria 4516
150 Ga0265338_10257071 3300028800 Bacteria 1286
151 Ga0265324_10014268 3300029957 Bacteria 2944
152 Ga0265328_10000010 3300031239 Bacteria 163171
153 Ga0265328_10000014 3300031239 Bacteria 151076
154 Ga0265328_10002256 3300031239 Bacteria 8701
155 Ga0265331_10000659 3300031250 Bacteria 29797
156 Ga0265316_10002584 3300031344 Bacteria 18698
157 Ga0307513_10283215 3300031456 Bacteria 1434
158 Ga0265314_10003889 3300031711 Bacteria 14203
159 Ga0307416_100286589 3300032002 Unclassified 1628
160 Ga0307411_10189226 3300032005 Bacteria 1570
161 Ga0307415_100289810 3300032126 Unclassified 1351
162 Ga0316583_10051764 3300032133 Bacteria 1445
163 Ga0373942_0007096 3300035207 Bacteria 2592
164 Ga0373927_0000566 3300035695 Bacteria 28233
165 Ga0373925_0000881 3300037068 Bacteria 27431
166 Ga0400486_24501 3300038742 Bacteria 2920
167 Ga0242420_002506 3300038996 Unclassified 2625
168 Ga0439446_0010371 3300042156 Bacteria 2508
169 Ga0453683_0010562 3300044673 Bacteria 6117
170 Ga0453684_0036962 3300044712 Bacteria 6714
171 Ga0451576_0005147 3300045051 Bacteria 16559
172 Ga0451576_0022863 3300045051 Bacteria 6774
173 Ga0495590_0033867 3300046457 Bacteria 1785
174 Ga0495583_0113838 3300046506 Bacteria 1144
175 Ga0495616_0099636 3300046513 Bacteria 1364
176 Ga0495632_0033115 3300046519 Bacteria 2656
177 Ga0495642_0020760 3300046528 Bacteria 2582
178 Ga0495597_0104009 3300046542 Bacteria 1195
179 Ga0495622_0002304 3300046557 Bacteria 9292
180 Ga0495668_0001330 3300046616 Bacteria 24323
181 Ga0495634_0138083 3300046642 Bacteria 1550
182 Ga0495611_0092054 3300046648 Bacteria 1402
183 Ga0495659_0030422 3300046664 Bacteria 1879
184 Ga0495658_0027446 3300046683 Bacteria 3064
185 Ga0495649_0002428 3300046694 Bacteria 13146
186 Ga0495672_0002167 3300047320 Bacteria 18306
187 Ga0496101_0009077 3300048904 Bacteria 6522
188 Ga0496104_0000509 3300048907 Bacteria 33320
189 Ga0496104_0114688 3300048907 Bacteria 2584
190 Ga0496104_0512565 3300048907 Bacteria 1111
191 Ga0496105_0000091 3300048908 Bacteria 63179
192 Ga0496105_0086917 3300048908 Bacteria 2584
193 Ga0496106_0048317 3300048909 Bacteria 3205
194 Ga0496108_0072971 3300048911 Bacteria 2898
195 Ga0496109_0000097 3300048912 Bacteria 90961
196 Ga0496110_0020006 3300048913 Bacteria 5644
197 Ga0496111_0080527 3300048914 Bacteria 2376
198 Ga0496114_0208502 3300048917 Bacteria 1713
199 Ga0496115_0240631 3300048918 Bacteria 1491
200 Ga0496119_0001139 3300048922 Bacteria 33387
201 Ga0496119_0118414 3300048922 Bacteria 1459
202 Ga0496125_0110030 3300048928 Bacteria 1999
203 Ga0501031_0077209 3300049568 Bacteria 2169
204 Ga0501034_0009584 3300049571 Bacteria 10133
205 Ga0501034_0011363 3300049571 Bacteria 9234
206 Ga0501036_0019462 3300049572 Bacteria 5700
207 Ga0501040_0132334 3300049576 Bacteria 1754
208 Ga0501041_0024268 3300049577 Bacteria 3640
209 Ga0501041_0069515 3300049577 Bacteria 2160
210 Ga0501043_0499730 3300049579 Bacteria 909
211 Ga0501046_0034971 3300049580 Bacteria 4051
212 Ga0501047_0014679 3300049581 Bacteria 7454
213 Ga0501047_0035752 3300049581 Bacteria 4799
214 Ga0501075_0004690 3300049591 Bacteria 9280
215 Ga0501076_0154239 3300049592 Bacteria 1869
216 Ga0501080_0408649 3300049742 Bacteria 1221
217 Ga0501081_0250680 3300049743 Bacteria 1292
218 Ga0501044_0582191 3300049823 Bacteria 1013
219 nmdc:mga05p37_203118_c1 3300050507 Bacteria 2399
220 nmdc:mga05p37_558234_c1 3300050507 Bacteria 1302
221 nmdc:mga05p37_642722_c1 3300050507 Bacteria 1190
222 nmdc:mga05p37_75239_c1 3300050507 Bacteria 4156
223 nmdc:mga0qj67_345041_c1 3300050509 Bacteria 1204
224 nmdc:mga0qj67_379250_c1 3300050509 Bacteria 1142
225 nmdc:mga08y16_8269_c1 3300050511 Bacteria 10890
226 nmdc:mga08y16_97191_c1 3300050511 Bacteria 3067
227 nmdc:mga0n895_55581_c1 3300050512 Bacteria 3896
228 nmdc:mga0rr50_453_c1 3300050513 Bacteria 21802
229 nmdc:mga0rr50_59147_c1 3300050513 Bacteria 2876
230 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
231 nmdc:mga0a205_237144_c1 3300050515 Bacteria 1706
232 nmdc:mga0a205_248928_c1 3300050515 Bacteria 1657
233 Ga0500635_0018269 3300053080 Bacteria 2114
234 Ga0500637_0002096 3300053178 Bacteria 8734
235 Ga0501084_0356158 3300054114 Bacteria 1236
236 Ga0501082_0025550 3300060353 Bacteria 5089
237 Ga0530510_0066770 3300061734 Bacteria 2609
238 2828306571 2828305725 Bacteria 4916900
239 Ga0105243_10000119
240 JGI24034J14986_100407
241 JGI24748J21848_1000007
242 JGI24034J26672_10000002
243 rootL2_10212703
244 Ga0065707_10161432
245 Ga0070690_100080695
246 Ga0068869_100436127
247 Ga0070689_100114116
248 Ga0070668_100022818
249 Ga0070675_100500559
250 Ga0070671_100007418
251 Ga0070673_100232078
252 Ga0070703_10000530
253 Ga0070701_10226921
254 Ga0070700_100006795
255 Ga0070700_100110343
256 Ga0070700_100172648
257 Ga0070694_100006114
258 Ga0070694_100038727
259 Ga0070694_100373251
260 Ga0070708_100184856
261 Ga0070708_100721420
262 Ga0068867_100480721
263 Ga0070685_10074148
264 Ga0070706_100002494
265 Ga0070706_100116708
266 Ga0070706_100297272
267 Ga0070707_100001325
268 Ga0070707_100008179
269 Ga0070707_100309354
270 Ga0070698_100007404
271 Ga0070698_100090020
272 Ga0070698_100342320
273 Ga0070699_100149861
274 Ga0070697_100095653
275 Ga0070697_100279303
276 Ga0070697_100646554
277 Ga0070686_100185780
278 Ga0070695_100273747
279 Ga0070704_100000638
280 Ga0070704_100133538
281 Ga0068854_100118666
282 Ga0070702_100100489
283 Ga0070702_100165491
284 Ga0068859_100017521
285 Ga0068859_100254814
286 Ga0068859_100546837
287 Ga0068866_10009446
288 Ga0068861_100017825
289 Ga0068861_100080574
290 Ga0068858_100000008
291 Ga0068860_100292176
292 Ga0068860_100482465
293 Ga0068860_100579651
294 Ga0068862_100099686
295 Ga0070715_10000031
296 Ga0070716_100000007
297 Ga0075428_100197483
298 Ga0075430_100102413
299 Ga0075431_100042530
300 Ga0075433_10179338
301 Ga0075436_100000008
302 Ga0097620_100017520
303 Ga0097620_100254805
304 Ga0097620_100546823
305 Ga0075435_100000244
306 Ga0075435_100017349
307 Ga0099794_10022132
308 Ga0111539_10010730
309 Ga0105245_10047079
310 Ga0105247_10000001
311 Ga0114129_10017890
312 Ga0114129_10045834
313 Ga0114129_10613237
314 Ga0105243_10004942
315 Ga0105243_10301978
316 Ga0105243_10360878
317 Ga0105242_10000113
318 Ga0105242_10004299
319 Ga0105242_10055509
320 Ga0105242_10336809
321 Ga0105242_10581130
322 Ga0105249_10000028
323 Ga0105249_10014015
324 Ga0105249_10592578
325 Ga0105239_10030724
326 Ga0157378_10000163
327 Ga0157378_10036818
328 Ga0157378_10717614
329 Ga0163162_10000027
330 Ga0163162_10001557
331 Ga0163162_10083821
332 Ga0163162_10252071
333 Ga0163162_10758896
334 Ga0157375_10035866
335 Ga0157375_10249161
336 Ga0157375_10418764
337 Ga0163163_10219841
338 Ga0157380_10058481
339 Ga0157380_10131675
340 Ga0157376_10724000
341 Ga0163161_10005583
342 Ga0163161_10218526
343 Ga0163161_10358257
344 Ga0207672_1000748
345 Ga0207653_10000201
346 Ga0207642_10022160
347 Ga0207710_10000003
348 Ga0207685_10000007
349 Ga0207699_10248694
350 Ga0207684_10019633
351 Ga0207684_10461913
352 Ga0207662_10192387
353 Ga0207646_10003914
354 Ga0207646_10079652
355 Ga0207646_10249524
356 Ga0207659_10160410
357 Ga0207687_10428994
358 Ga0207644_10000209
359 Ga0207686_10000114
360 Ga0207686_10000400
361 Ga0207686_10006928
362 Ga0207709_10000162
363 Ga0207709_10002929
364 Ga0207709_10184208
365 Ga0207670_10289876
366 Ga0207704_10141940
367 Ga0207665_10000018
368 Ga0207665_10027264
369 Ga0207689_10437125
370 Ga0207712_10000110
371 Ga0207668_10015518
372 Ga0207640_10066536
373 Ga0207677_10668894
374 Ga0207703_10000354
375 Ga0207648_10326196
376 Ga0207648_10393922
377 Ga0207675_100001995
378 Ga0207675_100107467
379 Ga0207675_100861882
380 Ga0209588_1012747
381 Ga0207428_10006080
382 Ga0207428_10070786
383 Ga0268264_10094624
384 Ga0265322_10002011
385 Ga0265338_10000800
386 Ga0265338_10007066
387 Ga0265338_10038651
388 Ga0265338_10257071
389 Ga0265324_10014268
390 Ga0265328_10000010
391 Ga0265328_10000014
392 Ga0265328_10002256
393 Ga0265331_10000659
394 Ga0265316_10002584
395 Ga0307513_10283215
396 Ga0265314_10003889
397 Ga0307416_100286589
398 Ga0307411_10189226
399 Ga0307415_100289810
400 Ga0316583_10051764
401 Ga0373942_0007096
402 Ga0373927_0000566
403 Ga0373925_0000881
404 Ga0400486_24501
405 Ga0242420_002506
406 Ga0439446_0010371
407 Ga0453683_0010562
408 Ga0453684_0036962
409 Ga0451576_0005147
410 Ga0451576_0022863
411 Ga0495590_0033867
412 Ga0495583_0113838
413 Ga0495616_0099636
414 Ga0495632_0033115
415 Ga0495642_0020760
416 Ga0495597_0104009
417 Ga0495622_0002304
418 Ga0495668_0001330
419 Ga0495634_0138083
420 Ga0495611_0092054
421 Ga0495659_0030422
422 Ga0495658_0027446
423 Ga0495649_0002428
424 Ga0495672_0002167
425 Ga0496101_0009077
426 Ga0496104_0000509
427 Ga0496104_0114688
428 Ga0496104_0512565
429 Ga0496105_0000091
430 Ga0496105_0086917
431 Ga0496106_0048317
432 Ga0496108_0072971
433 Ga0496109_0000097
434 Ga0496110_0020006
435 Ga0496111_0080527
436 Ga0496114_0208502
437 Ga0496115_0240631
438 Ga0496119_0001139
439 Ga0496119_0118414
440 Ga0496125_0110030
441 Ga0501031_0077209
442 Ga0501034_0009584
443 Ga0501034_0011363
444 Ga0501036_0019462
445 Ga0501040_0132334
446 Ga0501041_0024268
447 Ga0501041_0069515
448 Ga0501043_0499730
449 Ga0501046_0034971
450 Ga0501047_0014679
451 Ga0501047_0035752
452 Ga0501075_0004690
453 Ga0501076_0154239
454 Ga0501080_0408649
455 Ga0501081_0250680
456 Ga0501044_0582191
457 nmdc:mga05p37_203118_c1
458 nmdc:mga05p37_558234_c1
459 nmdc:mga05p37_642722_c1
460 nmdc:mga05p37_75239_c1
461 nmdc:mga0qj67_345041_c1
462 nmdc:mga0qj67_379250_c1
463 nmdc:mga08y16_8269_c1
464 nmdc:mga08y16_97191_c1
465 nmdc:mga0n895_55581_c1
466 nmdc:mga0rr50_453_c1
467 nmdc:mga0rr50_59147_c1
468 nmdc:mga08x19_16_c1
469 nmdc:mga0a205_237144_c1
470 nmdc:mga0a205_248928_c1
471 Ga0500635_0018269
472 Ga0500637_0002096
473 Ga0501084_0356158
474 Ga0501082_0025550
475 Ga0530510_0066770
476 2828306571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13277

YmdB

YmdB-like protein

31

281

0.99

PF00149

Metallophos

Calcineurin-like phosphoesterase

28

206

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.9801 1 257
2cv9-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.9691 1 259
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.9653 1 257
2cv9-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.9653 1 259
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.9602 1 259
ID Description Score Start End Superfamily
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9801 1 257 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9731 1 259 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9694 1 259 3.60.21.10
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9653 1 257 3.60.21.10
1t71A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9441 1 257 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A2V8M5K8-F1-model_v4 Metallophosphoesterase 1.001 1 187 GO:0004113
GO:0046872
AF-A0A7W1QRE2-F1-model_v4 YmdB family metallophosphoesterase 1 1 141 GO:0004113
AF-A0A2V8S0C5-F1-model_v4 TIGR00282 family metallophosphoesterase 0.9971 1 260 GO:0004113
GO:0046872
AF-A0A3B9MIE9-F1-model_v4 Metallophosphoesterase 0.9957 6 96 GO:0004113
AF-A0A2V8QV88-F1-model_v4 Metallophosphoesterase 0.9931 78 260 GO:0004113

Map