F350689

General Info

Members Datasets Scaffolds Average Seq Length
238 139 476 352

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100249722|Ga0070667_1002497221
Length 402
Sequence VLTEHLMTLPPTAIGLRHIEQTKAGAGDIGDTVTGSREPYRINLRSVVRLQGHVMIELCLASALLAAGGIGASRAVHYLRADVTTQGAAPAVPASPLGAHGDLSSLPDVRVALETTGTFLGMSDELLLERVRTQPIARFKLNHGGSSLSFRIDFADGSRAAWKPMQTNMQSVPRKEVAAYRLNRLLGLHAVPPAAPRAVTRDELLAHLHPESIQSLPRIKAETVFGPDGKTIGTASYWIPVIKDSGFDTPEGRKTTQAWLTAGQPIPPDRLSMAAQVSTLIVFDFLTSNPDRYSGGNMKMSEDGKQLYFMDNTMSFYVDGNGNERNREILYRTQRFSRSLIRALDKVTVPNMQRALAEELGTPYEILTPAEISAVVARRALVQRYITDLIAQLGEKDVLYFD

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
80 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.2
Rhizosphere 93.7
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100249722 3300005367 Bacteria 1586
2 rootH1_10057623 3300003323 Bacteria 10819
3 rootH1_10101523 3300003323 Bacteria 11169
4 Ga0070658_10004227 3300005327 Bacteria 11742
5 Ga0070683_100023204 3300005329 Bacteria 5548
6 Ga0070683_100159631 3300005329 Bacteria 2139
7 Ga0070690_100005314 3300005330 Bacteria 7225
8 Ga0070670_100012499 3300005331 Bacteria 7266
9 Ga0070670_100178036 3300005331 Bacteria 1846
10 Ga0068869_100113522 3300005334 Bacteria 2064
11 Ga0070689_100000006 3300005340 Bacteria 332562
12 Ga0070689_100009293 3300005340 Bacteria 6966
13 Ga0070691_10031073 3300005341 Bacteria 2504
14 Ga0070687_100092896 3300005343 Unclassified 1673
15 Ga0070668_100069590 3300005347 Bacteria 2738
16 Ga0070669_100053459 3300005353 Bacteria 2956
17 Ga0070674_100002947 3300005356 Bacteria 9438
18 Ga0070673_100010387 3300005364 Bacteria 6303
19 Ga0070673_100104195 3300005364 Bacteria 2342
20 Ga0070673_100145533 3300005364 Bacteria 2003
21 Ga0070673_100311587 3300005364 Bacteria 1388
22 Ga0070688_100040120 3300005365 Bacteria 2867
23 Ga0070688_100102886 3300005365 Bacteria 1886
24 Ga0070688_100134568 3300005365 Bacteria 1672
25 Ga0070714_100110005 3300005435 Bacteria 2439
26 Ga0070713_100098448 3300005436 Bacteria 2529
27 Ga0070710_10024575 3300005437 Bacteria 3180
28 Ga0070711_100120898 3300005439 Bacteria 1937
29 Ga0070681_10156481 3300005458 Unclassified 2203
30 Ga0068867_100019161 3300005459 Bacteria 4874
31 Ga0070679_100079887 3300005530 Bacteria 3260
32 Ga0070679_100142718 3300005530 Unclassified 2373
33 Ga0070684_100122814 3300005535 Bacteria 2337
34 Ga0068853_100157152 3300005539 Bacteria 2049
35 Ga0070672_100012587 3300005543 Bacteria 5946
36 Ga0070672_100124534 3300005543 Bacteria 2113
37 Ga0070686_100001323 3300005544 Bacteria 14004
38 Ga0068855_100048815 3300005563 Bacteria 4994
39 Ga0068855_100148861 3300005563 Bacteria 2662
40 Ga0068855_100361223 3300005563 Bacteria 1598
41 Ga0068857_100162175 3300005577 Unclassified 2029
42 Ga0068852_100258491 3300005616 Bacteria 1671
43 Ga0068861_100028221 3300005719 Bacteria 4094
44 Ga0068858_100367813 3300005842 Bacteria 1379
45 Ga0068862_100041037 3300005844 Bacteria 3936
46 Ga0068871_100086469 3300006358 Bacteria 2605
47 Ga0068865_100007411 3300006881 Bacteria 6751
48 Ga0105240_10003810 3300009093 Bacteria 23297
49 Ga0105240_10215704 3300009093 Bacteria 2239
50 Ga0111539_10010178 3300009094 Bacteria 11851
51 Ga0105237_10002083 3300009545 Bacteria 25292
52 Ga0105237_10093103 3300009545 Bacteria 3003
53 Ga0105249_10048832 3300009553 Bacteria 3858
54 Ga0157374_10244362 3300013296 Unclassified 1765
55 Ga0157378_10118696 3300013297 Bacteria 2435
56 Ga0163163_10114887 3300014325 Bacteria 2723
57 Ga0213876_10065009 3300021384 Bacteria 1925
58 Ga0207666_1001147 3300025271 Bacteria 3129
59 Ga0207697_10034260 3300025315 Bacteria 2079
60 Ga0207692_10023392 3300025898 Bacteria 2856
61 Ga0207688_10192206 3300025901 Bacteria 1221
62 Ga0207705_10006559 3300025909 Bacteria 8621
63 Ga0207707_10124798 3300025912 Bacteria 2251
64 Ga0207707_10126926 3300025912 Unclassified 2231
65 Ga0207695_10131890 3300025913 Bacteria 2455
66 Ga0207695_10169549 3300025913 Bacteria 2109
67 Ga0207671_10000193 3300025914 Bacteria 94808
68 Ga0207663_10067359 3300025916 Bacteria 2295
69 Ga0207662_10031382 3300025918 Bacteria 3087
70 Ga0207662_10124514 3300025918 Bacteria 1620
71 Ga0207652_10015583 3300025921 Bacteria 6185
72 Ga0207652_10040536 3300025921 Bacteria 3955
73 Ga0207652_10141631 3300025921 Bacteria 2150
74 Ga0207681_10012568 3300025923 Bacteria 5227
75 Ga0207650_10042562 3300025925 Unclassified 3332
76 Ga0207650_10311737 3300025925 Bacteria 1287
77 Ga0207659_10334603 3300025926 Unclassified 1253
78 Ga0207670_10000003 3300025936 Bacteria 760449
79 Ga0207670_10002528 3300025936 Bacteria 9604
80 Ga0207669_10018498 3300025937 Bacteria 3604
81 Ga0207704_10000312 3300025938 Bacteria 22857
82 Ga0207691_10023320 3300025940 Bacteria 5826
83 Ga0207691_10081142 3300025940 Bacteria 2916
84 Ga0207691_10104414 3300025940 Bacteria 2525
85 Ga0207691_10122585 3300025940 Bacteria 2302
86 Ga0207689_10025687 3300025942 Bacteria 4934
87 Ga0207661_10019482 3300025944 Bacteria 5059
88 Ga0207661_10055178 3300025944 Bacteria 3186
89 Ga0207667_10120977 3300025949 Bacteria 2698
90 Ga0207651_10022958 3300025960 Bacteria 3828
91 Ga0207651_10023744 3300025960 Bacteria 3779
92 Ga0207651_10076857 3300025960 Bacteria 2388
93 Ga0207668_10158772 3300025972 Bacteria 1759
94 Ga0207658_10273451 3300025986 Bacteria 1445
95 Ga0207708_10002494 3300026075 Bacteria 13542
96 Ga0207648_10003900 3300026089 Bacteria 15553
97 Ga0207674_10138176 3300026116 Unclassified 2398
98 Ga0207675_100046818 3300026118 Bacteria 4040
99 Ga0207683_10032092 3300026121 Bacteria 4561
100 Ga0207698_10141842 3300026142 Bacteria 2071
101 Ga0207698_10145546 3300026142 Bacteria 2049
102 Ga0207428_10004551 3300027907 Bacteria 13139
103 Ga0268265_10372823 3300028380 Bacteria 1310
104 Ga0265326_10012861 3300028558 Unclassified 2454
105 Ga0265319_1006376 3300028563 Bacteria 5472
106 Ga0265319_1008441 3300028563 Bacteria 4512
107 Ga0265334_10012041 3300028573 Bacteria 3633
108 Ga0265318_10000030 3300028577 Bacteria 146681
109 Ga0265318_10000517 3300028577 Bacteria 27763
110 Ga0265318_10005288 3300028577 Bacteria 6073
111 Ga0265322_10003077 3300028654 Bacteria 5085
112 Ga0265336_10004967 3300028666 Bacteria 4958
113 Ga0265338_10007434 3300028800 Bacteria 13599
114 Ga0265338_10035344 3300028800 Bacteria 4806
115 Ga0265338_10060487 3300028800 Bacteria 3328
116 Ga0265338_10071889 3300028800 Bacteria 2956
117 Ga0265338_10170179 3300028800 Unclassified 1672
118 Ga0265324_10000019 3300029957 Bacteria 177592
119 Ga0265324_10025771 3300029957 Bacteria 2083
120 Ga0265330_10000105 3300031235 Bacteria 69914
121 Ga0265330_10000371 3300031235 Bacteria 31472
122 Ga0265330_10001269 3300031235 Bacteria 14796
123 Ga0265330_10002478 3300031235 Bacteria 10036
124 Ga0265330_10003357 3300031235 Bacteria 8394
125 Ga0265330_10023430 3300031235 Unclassified 2803
126 Ga0265332_10000781 3300031238 Bacteria 19397
127 Ga0265332_10000889 3300031238 Bacteria 18022
128 Ga0265328_10023188 3300031239 Bacteria 2356
129 Ga0265328_10063318 3300031239 Bacteria 1358
130 Ga0265320_10000017 3300031240 Bacteria 196688
131 Ga0265320_10001679 3300031240 Bacteria 15730
132 Ga0265320_10001917 3300031240 Bacteria 14683
133 Ga0265320_10002783 3300031240 Bacteria 12052
134 Ga0265320_10018637 3300031240 Bacteria 3815
135 Ga0265325_10000480 3300031241 Bacteria 28882
136 Ga0265325_10076723 3300031241 Bacteria 1667
137 Ga0265329_10000077 3300031242 Bacteria 44378
138 Ga0265329_10000359 3300031242 Bacteria 24183
139 Ga0265329_10000616 3300031242 Bacteria 18281
140 Ga0265329_10008518 3300031242 Bacteria 3883
141 Ga0265340_10000950 3300031247 Bacteria 16499
142 Ga0265340_10044202 3300031247 Bacteria 2180
143 Ga0265340_10053809 3300031247 Bacteria 1943
144 Ga0265339_10000019 3300031249 Bacteria 177620
145 Ga0265339_10006947 3300031249 Bacteria 7364
146 Ga0265339_10007285 3300031249 Bacteria 7167
147 Ga0265339_10012776 3300031249 Bacteria 5106
148 Ga0265339_10023061 3300031249 Bacteria 3601
149 Ga0265331_10000027 3300031250 Bacteria 220058
150 Ga0265331_10001963 3300031250 Bacteria 14373
151 Ga0265331_10002051 3300031250 Bacteria 13951
152 Ga0265331_10008133 3300031250 Bacteria 5991
153 Ga0265316_10000067 3300031344 Bacteria 108861
154 Ga0265316_10000227 3300031344 Bacteria 65091
155 Ga0265316_10005799 3300031344 Bacteria 11915
156 Ga0265316_10007995 3300031344 Bacteria 9875
157 Ga0265316_10024846 3300031344 Bacteria 5007
158 Ga0265316_10044479 3300031344 Bacteria 3532
159 Ga0307509_10088625 3300031507 Bacteria 3176
160 Ga0265313_10000236 3300031595 Bacteria 59962
161 Ga0265313_10003339 3300031595 Bacteria 13118
162 Ga0265313_10029440 3300031595 Bacteria 2841
163 Ga0265313_10070369 3300031595 Unclassified 1612
164 Ga0265314_10000008 3300031711 Bacteria 485166
165 Ga0265314_10000069 3300031711 Bacteria 153728
166 Ga0265314_10002405 3300031711 Bacteria 19236
167 Ga0265314_10008822 3300031711 Bacteria 8612
168 Ga0265314_10011735 3300031711 Bacteria 7206
169 Ga0265342_10001604 3300031712 Bacteria 20865
170 Ga0265342_10002425 3300031712 Bacteria 16111
171 Ga0265342_10003143 3300031712 Bacteria 13801
172 Ga0265342_10004051 3300031712 Bacteria 11697
173 Ga0265342_10008132 3300031712 Bacteria 7570
174 Ga0265342_10011649 3300031712 Bacteria 6000
175 Ga0265342_10013735 3300031712 Bacteria 5411
176 Ga0265342_10049536 3300031712 Bacteria 2513
177 Ga0265342_10059742 3300031712 Bacteria 2251
178 Ga0316576_10008404 3300031727 Bacteria 6581
179 Ga0316578_10013865 3300031728 Bacteria 4285
180 Ga0373934_0046104 3300035086 Bacteria 1724
181 Ga0373954_0007470 3300035118 Bacteria 4784
182 Ga0373955_0023003 3300035172 Bacteria 3170
183 Ga0373924_0009151 3300035410 Bacteria 3624
184 Ga0373933_0005943 3300035724 Bacteria 6639
185 Ga0373933_0064093 3300035724 Bacteria 2223
186 Ga0373933_0080800 3300035724 Bacteria 1993
187 Ga0373947_0020140 3300035725 Bacteria 3850
188 Ga0373937_0001783 3300036401 Bacteria 18071
189 Ga0373937_0004140 3300036401 Bacteria 12305
190 Ga0373937_0094723 3300036401 Bacteria 2769
191 Ga0373937_0245553 3300036401 Bacteria 1687
192 Ga0373937_0366211 3300036401 Unclassified 1366
193 Ga0373925_0055120 3300037068 Bacteria 2975
194 Ga0436365_0497434 3300039437 Bacteria 2104
195 Ga0436361_1102108 3300039447 Bacteria 2552
196 Ga0451577_0047136 3300042876 Bacteria 3854
197 Ga0453684_0000999 3300044712 Bacteria 92098
198 Ga0453684_0012946 3300044712 Bacteria 13656
199 Ga0453684_0054755 3300044712 Bacteria 5193
200 Ga0453684_0080232 3300044712 Bacteria 4075
201 Ga0451576_0010366 3300045051 Bacteria 10700
202 Ga0495628_0086997 3300046516 Bacteria 2423
203 Ga0495630_0100090 3300046517 Bacteria 2193
204 Ga0495586_0030694 3300046535 Bacteria 2877
205 Ga0495634_0001845 3300046642 Bacteria 18252
206 Ga0495674_0006079 3300047319 Bacteria 11589
207 Ga0495680_0090071 3300047322 Bacteria 2302
208 Ga0496100_0224042 3300048903 Bacteria 1381
209 Ga0496101_0086954 3300048904 Bacteria 2319
210 Ga0496104_0333449 3300048907 Bacteria 1430
211 Ga0496108_0079253 3300048911 Bacteria 2780
212 Ga0496112_0093286 3300048915 Bacteria 2981
213 Ga0496114_0003117 3300048917 Bacteria 12715
214 Ga0496114_0033660 3300048917 Bacteria 4224
215 Ga0496114_0063715 3300048917 Bacteria 3086
216 Ga0496115_0047157 3300048918 Bacteria 3445
217 Ga0496115_0050494 3300048918 Bacteria 3332
218 Ga0501067_0000175 3300049583 Bacteria 36013
219 Ga0501067_0016914 3300049583 Bacteria 4029
220 Ga0501068_0093024 3300049584 Unclassified 1862
221 Ga0501069_0050167 3300049585 Unclassified 2320
222 Ga0501070_0000575 3300049586 Bacteria 33460
223 Ga0501073_0017282 3300049589 Bacteria 5225
224 Ga0501073_0021295 3300049589 Bacteria 4674
225 Ga0501073_0029225 3300049589 Bacteria 3938
226 Ga0501074_0053482 3300049590 Bacteria 2912
227 Ga0501079_0224369 3300049741 Bacteria 1468
228 Ga0501080_0002642 3300049742 Bacteria 15670
229 Ga0501080_0023529 3300049742 Bacteria 5709
230 Ga0501083_0000882 3300049744 Bacteria 19848
231 Ga0501083_0002278 3300049744 Bacteria 13129
232 nmdc:mga09592_201965_c1 3300050508 Bacteria 1721
233 nmdc:mga08y16_14140_c1 3300050511 Bacteria 8400
234 Ga0495601_0135753 3300053077 Bacteria 1603
235 Ga0495595_0037313 3300053084 Bacteria 2209
236 Ga0501082_0000739 3300060353 Bacteria 28788
237 Ga0501082_0008751 3300060353 Bacteria 8726
238 Ga0530510_0087365 3300061734 Unclassified 2272
239 Ga0070667_100249722
240 rootH1_10057623
241 rootH1_10101523
242 Ga0070658_10004227
243 Ga0070683_100023204
244 Ga0070683_100159631
245 Ga0070690_100005314
246 Ga0070670_100012499
247 Ga0070670_100178036
248 Ga0068869_100113522
249 Ga0070689_100000006
250 Ga0070689_100009293
251 Ga0070691_10031073
252 Ga0070687_100092896
253 Ga0070668_100069590
254 Ga0070669_100053459
255 Ga0070674_100002947
256 Ga0070673_100010387
257 Ga0070673_100104195
258 Ga0070673_100145533
259 Ga0070673_100311587
260 Ga0070688_100040120
261 Ga0070688_100102886
262 Ga0070688_100134568
263 Ga0070714_100110005
264 Ga0070713_100098448
265 Ga0070710_10024575
266 Ga0070711_100120898
267 Ga0070681_10156481
268 Ga0068867_100019161
269 Ga0070679_100079887
270 Ga0070679_100142718
271 Ga0070684_100122814
272 Ga0068853_100157152
273 Ga0070672_100012587
274 Ga0070672_100124534
275 Ga0070686_100001323
276 Ga0068855_100048815
277 Ga0068855_100148861
278 Ga0068855_100361223
279 Ga0068857_100162175
280 Ga0068852_100258491
281 Ga0068861_100028221
282 Ga0068858_100367813
283 Ga0068862_100041037
284 Ga0068871_100086469
285 Ga0068865_100007411
286 Ga0105240_10003810
287 Ga0105240_10215704
288 Ga0111539_10010178
289 Ga0105237_10002083
290 Ga0105237_10093103
291 Ga0105249_10048832
292 Ga0157374_10244362
293 Ga0157378_10118696
294 Ga0163163_10114887
295 Ga0213876_10065009
296 Ga0207666_1001147
297 Ga0207697_10034260
298 Ga0207692_10023392
299 Ga0207688_10192206
300 Ga0207705_10006559
301 Ga0207707_10124798
302 Ga0207707_10126926
303 Ga0207695_10131890
304 Ga0207695_10169549
305 Ga0207671_10000193
306 Ga0207663_10067359
307 Ga0207662_10031382
308 Ga0207662_10124514
309 Ga0207652_10015583
310 Ga0207652_10040536
311 Ga0207652_10141631
312 Ga0207681_10012568
313 Ga0207650_10042562
314 Ga0207650_10311737
315 Ga0207659_10334603
316 Ga0207670_10000003
317 Ga0207670_10002528
318 Ga0207669_10018498
319 Ga0207704_10000312
320 Ga0207691_10023320
321 Ga0207691_10081142
322 Ga0207691_10104414
323 Ga0207691_10122585
324 Ga0207689_10025687
325 Ga0207661_10019482
326 Ga0207661_10055178
327 Ga0207667_10120977
328 Ga0207651_10022958
329 Ga0207651_10023744
330 Ga0207651_10076857
331 Ga0207668_10158772
332 Ga0207658_10273451
333 Ga0207708_10002494
334 Ga0207648_10003900
335 Ga0207674_10138176
336 Ga0207675_100046818
337 Ga0207683_10032092
338 Ga0207698_10141842
339 Ga0207698_10145546
340 Ga0207428_10004551
341 Ga0268265_10372823
342 Ga0265326_10012861
343 Ga0265319_1006376
344 Ga0265319_1008441
345 Ga0265334_10012041
346 Ga0265318_10000030
347 Ga0265318_10000517
348 Ga0265318_10005288
349 Ga0265322_10003077
350 Ga0265336_10004967
351 Ga0265338_10007434
352 Ga0265338_10035344
353 Ga0265338_10060487
354 Ga0265338_10071889
355 Ga0265338_10170179
356 Ga0265324_10000019
357 Ga0265324_10025771
358 Ga0265330_10000105
359 Ga0265330_10000371
360 Ga0265330_10001269
361 Ga0265330_10002478
362 Ga0265330_10003357
363 Ga0265330_10023430
364 Ga0265332_10000781
365 Ga0265332_10000889
366 Ga0265328_10023188
367 Ga0265328_10063318
368 Ga0265320_10000017
369 Ga0265320_10001679
370 Ga0265320_10001917
371 Ga0265320_10002783
372 Ga0265320_10018637
373 Ga0265325_10000480
374 Ga0265325_10076723
375 Ga0265329_10000077
376 Ga0265329_10000359
377 Ga0265329_10000616
378 Ga0265329_10008518
379 Ga0265340_10000950
380 Ga0265340_10044202
381 Ga0265340_10053809
382 Ga0265339_10000019
383 Ga0265339_10006947
384 Ga0265339_10007285
385 Ga0265339_10012776
386 Ga0265339_10023061
387 Ga0265331_10000027
388 Ga0265331_10001963
389 Ga0265331_10002051
390 Ga0265331_10008133
391 Ga0265316_10000067
392 Ga0265316_10000227
393 Ga0265316_10005799
394 Ga0265316_10007995
395 Ga0265316_10024846
396 Ga0265316_10044479
397 Ga0307509_10088625
398 Ga0265313_10000236
399 Ga0265313_10003339
400 Ga0265313_10029440
401 Ga0265313_10070369
402 Ga0265314_10000008
403 Ga0265314_10000069
404 Ga0265314_10002405
405 Ga0265314_10008822
406 Ga0265314_10011735
407 Ga0265342_10001604
408 Ga0265342_10002425
409 Ga0265342_10003143
410 Ga0265342_10004051
411 Ga0265342_10008132
412 Ga0265342_10011649
413 Ga0265342_10013735
414 Ga0265342_10049536
415 Ga0265342_10059742
416 Ga0316576_10008404
417 Ga0316578_10013865
418 Ga0373934_0046104
419 Ga0373954_0007470
420 Ga0373955_0023003
421 Ga0373924_0009151
422 Ga0373933_0005943
423 Ga0373933_0064093
424 Ga0373933_0080800
425 Ga0373947_0020140
426 Ga0373937_0001783
427 Ga0373937_0004140
428 Ga0373937_0094723
429 Ga0373937_0245553
430 Ga0373937_0366211
431 Ga0373925_0055120
432 Ga0436365_0497434
433 Ga0436361_1102108
434 Ga0451577_0047136
435 Ga0453684_0000999
436 Ga0453684_0012946
437 Ga0453684_0054755
438 Ga0453684_0080232
439 Ga0451576_0010366
440 Ga0495628_0086997
441 Ga0495630_0100090
442 Ga0495586_0030694
443 Ga0495634_0001845
444 Ga0495674_0006079
445 Ga0495680_0090071
446 Ga0496100_0224042
447 Ga0496101_0086954
448 Ga0496104_0333449
449 Ga0496108_0079253
450 Ga0496112_0093286
451 Ga0496114_0003117
452 Ga0496114_0033660
453 Ga0496114_0063715
454 Ga0496115_0047157
455 Ga0496115_0050494
456 Ga0501067_0000175
457 Ga0501067_0016914
458 Ga0501068_0093024
459 Ga0501069_0050167
460 Ga0501070_0000575
461 Ga0501073_0017282
462 Ga0501073_0021295
463 Ga0501073_0029225
464 Ga0501074_0053482
465 Ga0501079_0224369
466 Ga0501080_0002642
467 Ga0501080_0023529
468 Ga0501083_0000882
469 Ga0501083_0002278
470 nmdc:mga09592_201965_c1
471 nmdc:mga08y16_14140_c1
472 Ga0495601_0135753
473 Ga0495595_0037313
474 Ga0501082_0000739
475 Ga0501082_0008751
476 Ga0530510_0087365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kqb-assembly1.cif.gz_A crystal structure of the golgi casein kinase with mn/adp bound 0.7749 79 352
4kqa-assembly3.cif.gz_C crystal structure of the golgi casein kinase 0.7495 79 352
4kqa-assembly1.cif.gz_A crystal structure of the golgi casein kinase 0.7349 79 352
4kqa-assembly2.cif.gz_B crystal structure of the golgi casein kinase 0.7113 51 352
5yh0-assembly1.cif.gz_G the structure of drfam20c1 0.6958 45 352
ID Description Score Start End Superfamily
af_P50082_176_558_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.725 88 122 2.130.10.10
af_Q09850_29_248_2.70.98.30 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5;Golgi alpha-mannosidase II; domain 4 0.6956 87 125 2.70.98.30
3f7wA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.693 81 118 3.30.200.20
af_Q9UT45_73_285_2.70.98.30 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5;Golgi alpha-mannosidase II; domain 4 0.6596 87 122 2.70.98.30
af_I1JC52_284_399_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6368 95 122 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A7W0VBT8-F1-model_v4 FAM20 C-terminal domain-containing protein 0.9209 178 355
AF-D0LNN8-F1-model_v4 PI3K/PI4K catalytic domain-containing protein 0.901 46 355 GO:0016020
GO:0016773
AF-A0A7V4GFT0-F1-model_v4 FAM20 C-terminal domain-containing protein 0.8795 46 355
AF-A0A661MNQ0-F1-model_v4 Uncharacterized protein 0.8766 52 355
AF-A0A661MNQ0-F1-model_v4 Uncharacterized protein 0.8738 52 355

Map