F350405

General Info

Members Datasets Scaffolds Average Seq Length
237 174 474 115

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0318589|Ga0501083_0318589_76_465
Length 129
Sequence MAKTQLAEEGEPASKPLAWLHGEIKTPPFTAEGRQEAGMLLRLLQQGEQLGMPQAEPVPDVGKRCGALRIRDADHSWRIMYRMDPDVVLIIEVYPKKTRKIPDEVIARCRERLKRYDEAMRAAQRRTGR

Samples

Sample ID Description Type Environment
1 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
98 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
121 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
122 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
123 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
124 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
139 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
140 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
141 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
142 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
143 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
144 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
145 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
146 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
147 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
148 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
151 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
152 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
153 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
157 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
167 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
173 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
174 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0.84
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 1.27
Rhizosphere 91.98
Stem 0
Stem Tuber 0
Unclassified 45.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501083_0318589 3300049744 Bacteria 1011
2 rootH2_10011877 3300003320 Bacteria 1224
3 rootH1_10091700 3300003323 Bacteria 5461
4 rootH1_10320043 3300003323 Unclassified 1169
5 Ga0065715_10360290 3300005293 Unclassified 936
6 Ga0065715_10376395 3300005293 Unclassified 914
7 Ga0070680_100021358 3300005336 Bacteria 5144
8 Ga0070689_100215641 3300005340 Unclassified 1573
9 Ga0070689_100323989 3300005340 Bacteria 1287
10 Ga0070661_100271848 3300005344 Bacteria 1313
11 Ga0070671_100140922 3300005355 Unclassified 2035
12 Ga0070705_100205571 3300005440 Bacteria 1353
13 Ga0070708_101006252 3300005445 Unclassified 782
14 Ga0070678_100154813 3300005456 Unclassified 1850
15 Ga0070662_100352772 3300005457 Unclassified 1206
16 Ga0070662_101675066 3300005457 Unclassified 549
17 Ga0070681_10531922 3300005458 Bacteria 1089
18 Ga0070681_10629601 3300005458 Unclassified 987
19 Ga0070706_100447908 3300005467 Unclassified 1201
20 Ga0070706_101903116 3300005467 Unclassified 540
21 Ga0070707_100001099 3300005468 Bacteria 26704
22 Ga0070707_100077857 3300005468 Bacteria 3199
23 Ga0070707_100220289 3300005468 Bacteria 1848
24 Ga0070707_100655904 3300005468 Bacteria 1012
25 Ga0070698_100237875 3300005471 Unclassified 1754
26 Ga0070699_100668933 3300005518 Unclassified 948
27 Ga0070699_100772762 3300005518 Unclassified 879
28 Ga0070699_100864524 3300005518 Bacteria 828
29 Ga0070679_100504739 3300005530 Bacteria 1153
30 Ga0070684_100079203 3300005535 Bacteria 2904
31 Ga0070697_100058340 3300005536 Bacteria 3142
32 Ga0070697_100480834 3300005536 Unclassified 1084
33 Ga0068853_100830994 3300005539 Bacteria 885
34 Ga0070686_101270518 3300005544 Unclassified 614
35 Ga0070695_100178467 3300005545 Bacteria 1503
36 Ga0070696_100441148 3300005546 Bacteria 1026
37 Ga0070696_100483330 3300005546 Unclassified 982
38 Ga0070696_101328416 3300005546 Unclassified 611
39 Ga0070704_100006535 3300005549 Bacteria 6875
40 Ga0070704_100245696 3300005549 Unclassified 1467
41 Ga0068855_100620761 3300005563 Bacteria 1164
42 Ga0070664_100922455 3300005564 Unclassified 819
43 Ga0068854_100408166 3300005578 Bacteria 1125
44 Ga0068852_100959124 3300005616 Unclassified 873
45 Ga0068861_101196246 3300005719 Unclassified 735
46 Ga0068862_100385975 3300005844 Unclassified 1307
47 Ga0070715_10144175 3300006163 Bacteria 1160
48 Ga0075362_10225198 3300006177 Bacteria 917
49 Ga0075427_10070245 3300006194 Unclassified 623
50 Ga0075430_100307992 3300006846 Unclassified 1310
51 Ga0075431_100068541 3300006847 Unclassified 3661
52 Ga0075433_10616111 3300006852 Unclassified 952
53 Ga0075433_10763721 3300006852 Unclassified 845
54 Ga0075433_10868058 3300006852 Bacteria 787
55 Ga0075433_11340668 3300006852 Unclassified 619
56 Ga0075434_101737898 3300006871 Unclassified 631
57 Ga0075436_100205182 3300006914 Unclassified 1396
58 Ga0075435_100064998 3300007076 Bacteria 2965
59 Ga0075435_100894162 3300007076 Unclassified 774
60 Ga0075435_101311177 3300007076 Unclassified 634
61 Ga0105240_10602507 3300009093 Unclassified 1209
62 Ga0105240_10680296 3300009093 Bacteria 1125
63 Ga0111539_11086680 3300009094 Unclassified 930
64 Ga0105245_10122244 3300009098 Bacteria 2433
65 Ga0114129_10670990 3300009147 Bacteria 1336
66 Ga0114129_10672728 3300009147 Unclassified 1334
67 Ga0114129_11825764 3300009147 Bacteria 739
68 Ga0114129_12858812 3300009147 Unclassified 572
69 Ga0105243_10447415 3300009148 Bacteria 1211
70 Ga0105248_10223434 3300009177 Bacteria 2120
71 Ga0105248_11924957 3300009177 Unclassified 671
72 Ga0105237_10469474 3300009545 Bacteria 1264
73 Ga0105237_11617646 3300009545 Bacteria 655
74 Ga0105249_10242466 3300009553 Bacteria 1783
75 Ga0105249_11749439 3300009553 Unclassified 694
76 Ga0157373_10207961 3300013100 Bacteria 1380
77 Ga0157370_10266091 3300013104 Bacteria 1584
78 Ga0157378_10286178 3300013297 Unclassified 1591
79 Ga0163162_10949483 3300013306 Unclassified 971
80 Ga0163162_11307778 3300013306 Unclassified 824
81 Ga0157372_10089584 3300013307 Bacteria 3496
82 Ga0157375_10717480 3300013308 Bacteria 1153
83 Ga0157375_11922624 3300013308 Unclassified 702
84 Ga0157375_12091927 3300013308 Unclassified 674
85 Ga0163163_10056922 3300014325 Bacteria 3865
86 Ga0157379_10436206 3300014968 Unclassified 1208
87 Ga0206354_10053365 3300020081 Bacteria 864
88 Ga0213875_10031618 3300021388 Bacteria 2503
89 Ga0213875_10096720 3300021388 Viruses 1377
90 Ga0207692_10651602 3300025898 Bacteria 680
91 Ga0207684_10111578 3300025910 Unclassified 2340
92 Ga0207684_10450057 3300025910 Unclassified 1105
93 Ga0207684_10694880 3300025910 Bacteria 865
94 Ga0207695_10019350 3300025913 Bacteria 7840
95 Ga0207663_11710888 3300025916 Unclassified 506
96 Ga0207660_10364686 3300025917 Unclassified 1159
97 Ga0207652_10002631 3300025921 Bacteria 15072
98 Ga0207646_10080846 3300025922 Bacteria 2906
99 Ga0207687_10190436 3300025927 Unclassified 1596
100 Ga0207644_10276857 3300025931 Unclassified 1346
101 Ga0207711_11340741 3300025941 Unclassified 658
102 Ga0207661_10611678 3300025944 Unclassified 1000
103 Ga0207667_10893784 3300025949 Unclassified 880
104 Ga0207641_10203557 3300026088 Bacteria 1826
105 Ga0207683_10615625 3300026121 Unclassified 1005
106 Ga0209998_10016196 3300027717 Bacteria 1568
107 Ga0207428_10515247 3300027907 Bacteria 867
108 Ga0265319_1173127 3300028563 Unclassified 665
109 Ga0265324_10000531 3300029957 Bacteria 26139
110 Ga0265760_10056043 3300031090 Bacteria 1192
111 Ga0265316_10097183 3300031344 Bacteria 2242
112 Ga0307513_10741771 3300031456 Unclassified 687
113 Ga0307408_102232328 3300031548 Unclassified 529
114 Ga0265314_10255292 3300031711 Bacteria 1004
115 Ga0265342_10040135 3300031712 Bacteria 2840
116 Ga0307405_10951878 3300031731 Bacteria 730
117 Ga0307413_10603501 3300031824 Unclassified 899
118 Ga0307413_11221471 3300031824 Unclassified 654
119 Ga0307410_10764750 3300031852 Unclassified 819
120 Ga0307407_10197158 3300031903 Bacteria 1346
121 Ga0307412_10460165 3300031911 Bacteria 1050
122 Ga0307409_100519533 3300031995 Bacteria 1163
123 Ga0307409_102714389 3300031995 Bacteria 523
124 Ga0307416_101365038 3300032002 Bacteria 814
125 Ga0307414_11882262 3300032004 Unclassified 558
126 Ga0307415_100200602 3300032126 Viruses 1583
127 Ga0373923_0026539 3300035111 Bacteria 2305
128 Ga0373942_0300395 3300035207 Bacteria 557
129 Ga0373937_1090499 3300036401 Unclassified 747
130 Ga0316584_0620891 3300036712 Unclassified 748
131 Ga0316584_0873513 3300036712 Unclassified 607
132 Ga0436364_0310104 3300037853 Bacteria 5306
133 Ga0436364_0344683 3300037853 Viruses 1377
134 Ga0451798_0891857 3300041458 Bacteria 587
135 Ga0451837_1516070 3300041494 Unclassified 726
136 Ga0451853_2428516 3300041512 Unclassified 1430
137 Ga0439441_080478 3300042001 Unclassified 709
138 Ga0451577_0000580 3300042876 Bacteria 58982
139 Ga0451577_0381796 3300042876 Bacteria 1279
140 Ga0451577_1337473 3300042876 Unclassified 636
141 Ga0466969_0065567 3300044656 Bacteria 1755
142 Ga0453683_0974844 3300044673 Unclassified 562
143 Ga0453683_1145039 3300044673 Unclassified 520
144 Ga0466961_0107245 3300044693 Bacteria 1758
145 Ga0466961_0985526 3300044693 Unclassified 501
146 Ga0453684_0001612 3300044712 Bacteria 61939
147 Ga0453684_1402890 3300044712 Bacteria 724
148 Ga0466971_0005739 3300044719 Bacteria 5396
149 Ga0466970_0196251 3300044765 Bacteria 1122
150 Ga0466959_0027529 3300045049 Bacteria 4216
151 Ga0451576_1361513 3300045051 Unclassified 739
152 Ga0466967_0106809 3300045976 Bacteria 2567
153 Ga0495629_0463426 3300046459 Unclassified 857
154 Ga0495630_1272158 3300046517 Unclassified 555
155 Ga0495656_0245462 3300046615 Unclassified 903
156 Ga0495625_0261918 3300046660 Bacteria 1118
157 Ga0495588_0386555 3300046674 Unclassified 735
158 Ga0495658_0303554 3300046683 Bacteria 1010
159 Ga0495680_0613476 3300047322 Unclassified 727
160 Ga0496110_0204952 3300048913 Bacteria 1792
161 Ga0496114_0041662 3300048917 Bacteria 3806
162 Ga0501292_001919 3300049515 Bacteria 2619
163 Ga0501296_002143 3300049519 Bacteria 2037
164 Ga0501298_001191 3300049521 Bacteria 3772
165 Ga0501300_004465 3300049523 Bacteria 2073
166 Ga0501302_000744 3300049525 Bacteria 1739
167 Ga0501031_0242902 3300049568 Bacteria 1170
168 Ga0501031_0374747 3300049568 Bacteria 921
169 Ga0501036_0165902 3300049572 Bacteria 1861
170 Ga0501037_0932010 3300049573 Unclassified 568
171 Ga0501038_0427707 3300049574 Bacteria 1021
172 Ga0501039_0063435 3300049575 Bacteria 2863
173 Ga0501039_0601159 3300049575 Unclassified 862
174 Ga0501039_0638351 3300049575 Unclassified 834
175 Ga0501040_1038795 3300049576 Unclassified 594
176 Ga0501042_0262713 3300049578 Bacteria 1246
177 Ga0501042_0551758 3300049578 Unclassified 837
178 Ga0501046_0120254 3300049580 Bacteria 1998
179 Ga0501048_0065204 3300049582 Bacteria 2575
180 Ga0501048_0918126 3300049582 Unclassified 630
181 Ga0501070_0284429 3300049586 Bacteria 1349
182 Ga0501072_0181289 3300049588 Unclassified 1680
183 Ga0501072_0443382 3300049588 Unclassified 1028
184 Ga0501072_0687064 3300049588 Unclassified 805
185 Ga0501073_0458053 3300049589 Bacteria 882
186 Ga0501076_0180740 3300049592 Bacteria 1720
187 Ga0501076_0236236 3300049592 Unclassified 1494
188 Ga0501076_1562645 3300049592 Bacteria 541
189 Ga0501199_028020 3300049650 Unclassified 683
190 Ga0501201_008935 3300049651 Bacteria 970
191 Ga0501216_016489 3300049660 Bacteria 1254
192 Ga0501228_041642 3300049666 Bacteria 600
193 Ga0501235_088553 3300049669 Bacteria 746
194 Ga0501257_263482 3300049686 Unclassified 514
195 Ga0501260_002499 3300049689 Bacteria 1593
196 Ga0501261_032642 3300049690 Bacteria 793
197 Ga0501221_253204 3300049704 Bacteria 506
198 Ga0501225_0117164 3300049705 Bacteria 789
199 Ga0501234_046162 3300049707 Bacteria 720
200 Ga0501081_0242740 3300049743 Bacteria 1314
201 Ga0501081_0676071 3300049743 Unclassified 775
202 Ga0501265_021220 3300049762 Unclassified 880
203 Ga0501278_017692 3300049774 Bacteria 632
204 Ga0501282_015725 3300049778 Bacteria 822
205 Ga0501283_015978 3300049779 Bacteria 1160
206 Ga0501035_0900431 3300049822 Unclassified 701
207 Ga0501045_0525899 3300049824 Bacteria 878
208 Ga0501045_1146064 3300049824 Unclassified 568
209 Ga0501204_057165 3300049850 Unclassified 612
210 nmdc:mga03683_199856_c1 3300050489 Bacteria 917
211 nmdc:mga05p37_1018595_c1 3300050507 Unclassified 877
212 nmdc:mga05p37_835596_c1 3300050507 Unclassified 1002
213 nmdc:mga05p37_890140_c1 3300050507 Unclassified 961
214 nmdc:mga0qj67_261994_c1 3300050509 Bacteria 1402
215 nmdc:mga08y16_426934_c1 3300050511 Unclassified 1354
216 nmdc:mga08y16_618837_c1 3300050511 Bacteria 1090
217 nmdc:mga08y16_848650_c1 3300050511 Unclassified 903
218 nmdc:mga0n895_724864_c1 3300050512 Unclassified 989
219 nmdc:mga0rr50_1426392_c1 3300050513 Unclassified 586
220 nmdc:mga0rr50_36945_c1 3300050513 Bacteria 3522
221 nmdc:mga0rr50_41147_c1 3300050513 Bacteria 3365
222 nmdc:mga0rr50_49995_c1 3300050513 Bacteria 3096
223 nmdc:mga08x19_156698_c1 3300050514 Unclassified 1545
224 nmdc:mga0a205_1125121_c1 3300050515 Unclassified 633
225 nmdc:mga0a205_136571_c1 3300050515 Bacteria 2353
226 nmdc:mga0a205_153754_c1 3300050515 Bacteria 757
227 nmdc:mga0a205_19316_c1 3300050515 Bacteria 6423
228 Ga0495619_1172219 3300053085 Unclassified 509
229 Ga0500628_000168 3300053129 Bacteria 12552
230 Ga0500642_0017917 3300053130 Bacteria 2726
231 Ga0501084_0177599 3300054114 Bacteria 1797
232 Ga0590071_078190 3300059421 Bacteria 821
233 Ga0501082_1437314 3300060353 Unclassified 602
234 Ga0466962_0046214 3300061719 Bacteria 2080
235 Ga0530510_0765468 3300061734 Unclassified 736
236 2688392501 2687453341 Bacteria 6534136
237 2913943971 2913939268 Bacteria 8559644
238 Ga0501083_0318589
239 rootH2_10011877
240 rootH1_10091700
241 rootH1_10320043
242 Ga0065715_10360290
243 Ga0065715_10376395
244 Ga0070680_100021358
245 Ga0070689_100215641
246 Ga0070689_100323989
247 Ga0070661_100271848
248 Ga0070671_100140922
249 Ga0070705_100205571
250 Ga0070708_101006252
251 Ga0070678_100154813
252 Ga0070662_100352772
253 Ga0070662_101675066
254 Ga0070681_10531922
255 Ga0070681_10629601
256 Ga0070706_100447908
257 Ga0070706_101903116
258 Ga0070707_100001099
259 Ga0070707_100077857
260 Ga0070707_100220289
261 Ga0070707_100655904
262 Ga0070698_100237875
263 Ga0070699_100668933
264 Ga0070699_100772762
265 Ga0070699_100864524
266 Ga0070679_100504739
267 Ga0070684_100079203
268 Ga0070697_100058340
269 Ga0070697_100480834
270 Ga0068853_100830994
271 Ga0070686_101270518
272 Ga0070695_100178467
273 Ga0070696_100441148
274 Ga0070696_100483330
275 Ga0070696_101328416
276 Ga0070704_100006535
277 Ga0070704_100245696
278 Ga0068855_100620761
279 Ga0070664_100922455
280 Ga0068854_100408166
281 Ga0068852_100959124
282 Ga0068861_101196246
283 Ga0068862_100385975
284 Ga0070715_10144175
285 Ga0075362_10225198
286 Ga0075427_10070245
287 Ga0075430_100307992
288 Ga0075431_100068541
289 Ga0075433_10616111
290 Ga0075433_10763721
291 Ga0075433_10868058
292 Ga0075433_11340668
293 Ga0075434_101737898
294 Ga0075436_100205182
295 Ga0075435_100064998
296 Ga0075435_100894162
297 Ga0075435_101311177
298 Ga0105240_10602507
299 Ga0105240_10680296
300 Ga0111539_11086680
301 Ga0105245_10122244
302 Ga0114129_10670990
303 Ga0114129_10672728
304 Ga0114129_11825764
305 Ga0114129_12858812
306 Ga0105243_10447415
307 Ga0105248_10223434
308 Ga0105248_11924957
309 Ga0105237_10469474
310 Ga0105237_11617646
311 Ga0105249_10242466
312 Ga0105249_11749439
313 Ga0157373_10207961
314 Ga0157370_10266091
315 Ga0157378_10286178
316 Ga0163162_10949483
317 Ga0163162_11307778
318 Ga0157372_10089584
319 Ga0157375_10717480
320 Ga0157375_11922624
321 Ga0157375_12091927
322 Ga0163163_10056922
323 Ga0157379_10436206
324 Ga0206354_10053365
325 Ga0213875_10031618
326 Ga0213875_10096720
327 Ga0207692_10651602
328 Ga0207684_10111578
329 Ga0207684_10450057
330 Ga0207684_10694880
331 Ga0207695_10019350
332 Ga0207663_11710888
333 Ga0207660_10364686
334 Ga0207652_10002631
335 Ga0207646_10080846
336 Ga0207687_10190436
337 Ga0207644_10276857
338 Ga0207711_11340741
339 Ga0207661_10611678
340 Ga0207667_10893784
341 Ga0207641_10203557
342 Ga0207683_10615625
343 Ga0209998_10016196
344 Ga0207428_10515247
345 Ga0265319_1173127
346 Ga0265324_10000531
347 Ga0265760_10056043
348 Ga0265316_10097183
349 Ga0307513_10741771
350 Ga0307408_102232328
351 Ga0265314_10255292
352 Ga0265342_10040135
353 Ga0307405_10951878
354 Ga0307413_10603501
355 Ga0307413_11221471
356 Ga0307410_10764750
357 Ga0307407_10197158
358 Ga0307412_10460165
359 Ga0307409_100519533
360 Ga0307409_102714389
361 Ga0307416_101365038
362 Ga0307414_11882262
363 Ga0307415_100200602
364 Ga0373923_0026539
365 Ga0373942_0300395
366 Ga0373937_1090499
367 Ga0316584_0620891
368 Ga0316584_0873513
369 Ga0436364_0310104
370 Ga0436364_0344683
371 Ga0451798_0891857
372 Ga0451837_1516070
373 Ga0451853_2428516
374 Ga0439441_080478
375 Ga0451577_0000580
376 Ga0451577_0381796
377 Ga0451577_1337473
378 Ga0466969_0065567
379 Ga0453683_0974844
380 Ga0453683_1145039
381 Ga0466961_0107245
382 Ga0466961_0985526
383 Ga0453684_0001612
384 Ga0453684_1402890
385 Ga0466971_0005739
386 Ga0466970_0196251
387 Ga0466959_0027529
388 Ga0451576_1361513
389 Ga0466967_0106809
390 Ga0495629_0463426
391 Ga0495630_1272158
392 Ga0495656_0245462
393 Ga0495625_0261918
394 Ga0495588_0386555
395 Ga0495658_0303554
396 Ga0495680_0613476
397 Ga0496110_0204952
398 Ga0496114_0041662
399 Ga0501292_001919
400 Ga0501296_002143
401 Ga0501298_001191
402 Ga0501300_004465
403 Ga0501302_000744
404 Ga0501031_0242902
405 Ga0501031_0374747
406 Ga0501036_0165902
407 Ga0501037_0932010
408 Ga0501038_0427707
409 Ga0501039_0063435
410 Ga0501039_0601159
411 Ga0501039_0638351
412 Ga0501040_1038795
413 Ga0501042_0262713
414 Ga0501042_0551758
415 Ga0501046_0120254
416 Ga0501048_0065204
417 Ga0501048_0918126
418 Ga0501070_0284429
419 Ga0501072_0181289
420 Ga0501072_0443382
421 Ga0501072_0687064
422 Ga0501073_0458053
423 Ga0501076_0180740
424 Ga0501076_0236236
425 Ga0501076_1562645
426 Ga0501199_028020
427 Ga0501201_008935
428 Ga0501216_016489
429 Ga0501228_041642
430 Ga0501235_088553
431 Ga0501257_263482
432 Ga0501260_002499
433 Ga0501261_032642
434 Ga0501221_253204
435 Ga0501225_0117164
436 Ga0501234_046162
437 Ga0501081_0242740
438 Ga0501081_0676071
439 Ga0501265_021220
440 Ga0501278_017692
441 Ga0501282_015725
442 Ga0501283_015978
443 Ga0501035_0900431
444 Ga0501045_0525899
445 Ga0501045_1146064
446 Ga0501204_057165
447 nmdc:mga03683_199856_c1
448 nmdc:mga05p37_1018595_c1
449 nmdc:mga05p37_835596_c1
450 nmdc:mga05p37_890140_c1
451 nmdc:mga0qj67_261994_c1
452 nmdc:mga08y16_426934_c1
453 nmdc:mga08y16_618837_c1
454 nmdc:mga08y16_848650_c1
455 nmdc:mga0n895_724864_c1
456 nmdc:mga0rr50_1426392_c1
457 nmdc:mga0rr50_36945_c1
458 nmdc:mga0rr50_41147_c1
459 nmdc:mga0rr50_49995_c1
460 nmdc:mga08x19_156698_c1
461 nmdc:mga0a205_1125121_c1
462 nmdc:mga0a205_136571_c1
463 nmdc:mga0a205_153754_c1
464 nmdc:mga0a205_19316_c1
465 Ga0495619_1172219
466 Ga0500628_000168
467 Ga0500642_0017917
468 Ga0501084_0177599
469 Ga0590071_078190
470 Ga0501082_1437314
471 Ga0466962_0046214
472 Ga0530510_0765468
473 2688392501
474 2913943971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05973

Gp49

Phage derived protein Gp49-like (DUF891)

28

114

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b5n-assembly4.cif.gz_D crystal structure of the ddb1 bpb domain 0.8255 55 88
6dkq-assembly1.cif.gz_A crystal structure of the shr hemoglobin interacting domain 2 0.7963 56 88
4exr-assembly1.cif.gz_A-2 crystal structure of a putative lipoprotein (cd1622) from clostridium difficile 630 at 1.85 a resolution 0.7917 56 87
8dov-assembly1.cif.gz_J crystal structure of the shr hemoglobin interacting domain 2 (hid2) in complex with hemoglobin 0.771 56 88
4h5j-assembly1.cif.gz_A crystal structure of the guanine nucleotide exchange factor sec12 (p64 form) 0.7358 52 90
ID Description Score Start End Superfamily
2b5nD00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8255 55 88 2.130.10.10
af_Q08956_119_457_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7986 55 86 2.130.10.10
af_Q57852_48_524_2.140.10.30 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Dipeptidylpeptidase IV, N-terminal domain 0.7802 56 85 2.140.10.30
af_Q4G061_490_685_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7797 55 88 2.130.10.10
af_P9WJA5_1_125_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.7792 4 110 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A2T1CNT5-F1-model_v4 Transposase 1.001 9 109
AF-A0A7W1IKL1-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9988 20 109
AF-A0A7X7IQK5-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9982 4 109
AF-A0A2S8STC5-F1-model_v4 Phage-related protein 0.9975 4 109
AF-A0A1Z4LDW6-F1-model_v4 deleted 0.9965 3 109

Map