F350214

General Info

Members Datasets Scaffolds Average Seq Length
237 169 474 189

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0320270|Ga0436362_0320270_22_708
Length 228
Sequence VVVPQIRRLAKQQRGCVAAWIGGGAKRLRNQAREVNPVTKERMEAFSDGVLAVFITIMVLDMKPPHDTQLAAMRPLIPVFLSYVLSFIYVGIYWNNHXXLLHAAEQVSGGALWANLHLMFWLSLIPFTTAWVGENHVKAWPVALYGIVLLCAAIAYYILTRVLIHLHGQGSTLAKSVGEDKKGKISIAVYAVAVPLAFVQPWIANVGYVIVAVMWLVPDRRIEREIAE

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
101 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
116 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
138 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
139 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
140 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
141 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
142 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
143 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
144 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
145 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
146 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
147 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
148 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
149 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
150 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
151 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
152 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
153 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
154 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
155 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
156 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
157 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
158 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
159 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
160 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
161 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
162 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 1.69
Rhizosphere 89.45
Stem 0
Stem Tuber 0
Unclassified 5.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_0320270 3300039453 Bacteria 725
2 Ga0065715_10133133 3300005293 Bacteria 1968
3 Ga0065715_10147606 3300005293 Bacteria 1768
4 Ga0070680_100031465 3300005336 Bacteria 4266
5 Ga0070680_100316705 3300005336 Bacteria 1324
6 Ga0070714_100121694 3300005435 Bacteria 2322
7 Ga0070714_100324836 3300005435 Bacteria 1440
8 Ga0070713_100190419 3300005436 Bacteria 1848
9 Ga0070710_10017814 3300005437 Bacteria 3645
10 Ga0070711_100168945 3300005439 Bacteria 1665
11 Ga0070705_100032442 3300005440 Bacteria 2901
12 Ga0070705_100115154 3300005440 Bacteria 1726
13 Ga0070700_100000413 3300005441 Bacteria 21902
14 Ga0070694_100017752 3300005444 Bacteria 4498
15 Ga0070694_100271911 3300005444 Bacteria 1289
16 Ga0070708_100523226 3300005445 Bacteria 1119
17 Ga0070663_100040988 3300005455 Bacteria 3245
18 Ga0070681_10002076 3300005458 Bacteria 18189
19 Ga0070681_10070077 3300005458 Bacteria 3472
20 Ga0070681_10189594 3300005458 Bacteria 1976
21 Ga0070699_100001790 3300005518 Bacteria 19555
22 Ga0070679_100030759 3300005530 Bacteria 5302
23 Ga0070679_100499521 3300005530 Bacteria 1160
24 Ga0070684_100114548 3300005535 Bacteria 2420
25 Ga0070697_100231878 3300005536 Bacteria 1575
26 Ga0068853_100269377 3300005539 Bacteria 1568
27 Ga0070695_100016888 3300005545 Bacteria 4424
28 Ga0070695_100029697 3300005545 Bacteria 3399
29 Ga0070695_100070346 3300005545 Bacteria 2289
30 Ga0070696_100071624 3300005546 Bacteria 2439
31 Ga0070696_100290555 3300005546 Bacteria 1249
32 Ga0070693_100737289 3300005547 Bacteria 725
33 Ga0068855_100000726 3300005563 Bacteria 40509
34 Ga0068855_100118134 3300005563 Bacteria 3037
35 Ga0068856_100038082 3300005614 Bacteria 4719
36 Ga0068856_100367550 3300005614 Bacteria 1457
37 Ga0068852_100052469 3300005616 Bacteria 3504
38 Ga0068859_100043432 3300005617 Bacteria 4516
39 Ga0068859_100098253 3300005617 Bacteria 2982
40 Ga0068851_10228176 3300005834 Bacteria 1049
41 Ga0068863_100634403 3300005841 Unclassified 1059
42 Ga0068858_100603244 3300005842 Bacteria 1065
43 Ga0081455_10000040 3300005937 Bacteria 134280
44 Ga0081455_10207466 3300005937 Bacteria 1462
45 Ga0081539_10012944 3300005985 Bacteria 6346
46 Ga0070717_10330444 3300006028 Bacteria 1360
47 Ga0070715_10053917 3300006163 Bacteria 1739
48 Ga0070712_100103763 3300006175 Bacteria 2108
49 Ga0068871_100214151 3300006358 Bacteria 1667
50 Ga0075434_100010145 3300006871 Bacteria 8824
51 Ga0097620_100043432 3300006931 Bacteria 4516
52 Ga0097620_100098254 3300006931 Bacteria 2982
53 Ga0075435_100601811 3300007076 Bacteria 953
54 Ga0105240_10001839 3300009093 Bacteria 35551
55 Ga0105240_10438351 3300009093 Bacteria 1464
56 Ga0105247_10990613 3300009101 Unclassified 656
57 Ga0105243_10000379 3300009148 Bacteria 47774
58 Ga0105241_10094748 3300009174 Bacteria 2361
59 Ga0105241_10151394 3300009174 Bacteria 1898
60 Ga0105242_10000402 3300009176 Bacteria 34387
61 Ga0105248_10033518 3300009177 Bacteria 5738
62 Ga0105248_10625442 3300009177 Bacteria 1215
63 Ga0105237_10028555 3300009545 Bacteria 5681
64 Ga0105237_10611304 3300009545 Bacteria 1097
65 Ga0105238_10003248 3300009551 Bacteria 16228
66 Ga0157373_10457173 3300013100 Bacteria 919
67 Ga0157370_10165508 3300013104 Bacteria 2056
68 Ga0157370_10168329 3300013104 Bacteria 2037
69 Ga0157369_10342195 3300013105 Bacteria 1554
70 Ga0157372_10012877 3300013307 Bacteria 8917
71 Ga0157372_10530142 3300013307 Bacteria 1373
72 Ga0157372_11129912 3300013307 Bacteria 906
73 Ga0157372_11632701 3300013307 Bacteria 742
74 Ga0157380_11542771 3300014326 Bacteria 718
75 Ga0213873_10007503 3300021358 Bacteria 2188
76 Ga0213876_10026791 3300021384 Bacteria 3040
77 Ga0213875_10020655 3300021388 Bacteria 3159
78 Ga0213875_10026266 3300021388 Bacteria 2771
79 Ga0213875_10163505 3300021388 Bacteria 1044
80 Ga0207705_10732356 3300025909 Bacteria 768
81 Ga0207654_10020667 3300025911 Bacteria 3494
82 Ga0207654_10091442 3300025911 Bacteria 1856
83 Ga0207707_10006371 3300025912 Bacteria 10300
84 Ga0207695_10003697 3300025913 Bacteria 21319
85 Ga0207671_10383251 3300025914 Bacteria 1117
86 Ga0207671_10715439 3300025914 Bacteria 796
87 Ga0207693_10038549 3300025915 Bacteria 3763
88 Ga0207663_10258403 3300025916 Bacteria 1285
89 Ga0207660_10079848 3300025917 Bacteria 2400
90 Ga0207660_10238055 3300025917 Bacteria 1433
91 Ga0207660_10316768 3300025917 Bacteria 1245
92 Ga0207649_10655335 3300025920 Bacteria 811
93 Ga0207652_10089258 3300025921 Bacteria 2707
94 Ga0207646_10740800 3300025922 Bacteria 877
95 Ga0207694_10194114 3300025924 Bacteria 1650
96 Ga0207700_10889821 3300025928 Bacteria 797
97 Ga0207664_10090335 3300025929 Bacteria 2510
98 Ga0207664_10374034 3300025929 Bacteria 1264
99 Ga0207644_10016535 3300025931 Bacteria 4963
100 Ga0207706_10275756 3300025933 Bacteria 1467
101 Ga0207686_10000025 3300025934 Bacteria 169534
102 Ga0207686_10134922 3300025934 Bacteria 1698
103 Ga0207709_10000024 3300025935 Bacteria 369177
104 Ga0207670_10132994 3300025936 Bacteria 1825
105 Ga0207711_10026176 3300025941 Bacteria 4893
106 Ga0207711_10072130 3300025941 Bacteria 2999
107 Ga0207689_10038022 3300025942 Bacteria 3988
108 Ga0207679_10688794 3300025945 Unclassified 927
109 Ga0207667_10000500 3300025949 Bacteria 51747
110 Ga0207658_10300688 3300025986 Bacteria 1382
111 Ga0207658_11177116 3300025986 Bacteria 701
112 Ga0207677_10107326 3300026023 Bacteria 2071
113 Ga0207703_10909179 3300026035 Bacteria 843
114 Ga0207678_10007903 3300026067 Bacteria 9381
115 Ga0207708_10000646 3300026075 Bacteria 26763
116 Ga0207702_10071975 3300026078 Bacteria 2979
117 Ga0207702_10198243 3300026078 Bacteria 1859
118 Ga0207641_10490335 3300026088 Unclassified 1192
119 Ga0207676_10013350 3300026095 Bacteria 5900
120 Ga0207674_10018114 3300026116 Bacteria 7663
121 Ga0207698_10025619 3300026142 Bacteria 4158
122 Ga0207698_10076262 3300026142 Bacteria 2683
123 Ga0209588_1180407 3300027671 Bacteria 662
124 Ga0268264_10328032 3300028381 Bacteria 1449
125 Ga0265331_10000049 3300031250 Bacteria 182618
126 Ga0307408_100003432 3300031548 Bacteria 10854
127 Ga0307405_10035714 3300031731 Bacteria 2971
128 Ga0307410_10013839 3300031852 Bacteria 4723
129 Ga0307410_10175600 3300031852 Bacteria 1618
130 Ga0307406_10000345 3300031901 Bacteria 27032
131 Ga0307412_10007699 3300031911 Bacteria 6121
132 Ga0307416_100124750 3300032002 Bacteria 2304
133 Ga0307414_10001908 3300032004 Bacteria 10786
134 Ga0307411_10007589 3300032005 Bacteria 5544
135 Ga0307415_100003155 3300032126 Bacteria 8350
136 Ga0373934_0000683 3300035086 Bacteria 12041
137 Ga0373940_0017422 3300035088 Bacteria 1791
138 Ga0373951_0025232 3300035091 Unclassified 1380
139 Ga0373953_0075607 3300035117 Bacteria 1395
140 Ga0373956_0005010 3300035119 Bacteria 5305
141 Ga0373957_0006735 3300035120 Bacteria 3637
142 Ga0316574_0183437 3300035398 Bacteria 1346
143 Ga0373937_0001327 3300036401 Bacteria 20712
144 Ga0373937_1348136 3300036401 Bacteria 661
145 Ga0395900_0312170 3300037418 Bacteria 1555
146 Ga0395898_0149664 3300037466 Bacteria 2234
147 Ga0395898_0177448 3300037466 Bacteria 2036
148 Ga0436364_0243094 3300037853 Bacteria 1585
149 Ga0436364_0642601 3300037853 Bacteria 767
150 Ga0436364_0913987 3300037853 Bacteria 1228
151 Ga0436364_1032867 3300037853 Bacteria 3473
152 Ga0436364_1156845 3300037853 Bacteria 1064
153 Ga0395901_0297075 3300038443 Bacteria 1675
154 Ga0395901_0466072 3300038443 Bacteria 1290
155 Ga0436365_0407548 3300039437 Bacteria 868
156 Ga0436365_0489686 3300039437 Bacteria 918
157 Ga0436365_0681052 3300039437 Bacteria 960
158 Ga0436365_0787439 3300039437 Bacteria 1090
159 Ga0436365_1565458 3300039437 Bacteria 1040
160 Ga0436360_0045500 3300039438 Bacteria 2948
161 Ga0436360_0973115 3300039438 Bacteria 1162
162 Ga0436360_0995992 3300039438 Bacteria 1894
163 Ga0436360_1215655 3300039438 Bacteria 999
164 Ga0436360_1364437 3300039438 Bacteria 937
165 Ga0436361_0264951 3300039447 Bacteria 1290
166 Ga0436361_0500168 3300039447 Bacteria 41610
167 Ga0436361_0514232 3300039447 Bacteria 1104
168 Ga0436361_0658215 3300039447 Bacteria 1132
169 Ga0436363_0197903 3300039450 Bacteria 961
170 Ga0436363_0305530 3300039450 Bacteria 1392
171 Ga0436363_0458337 3300039450 Bacteria 1532
172 Ga0436363_1213493 3300039450 Bacteria 1468
173 Ga0436363_1401783 3300039450 Bacteria 808
174 Ga0436363_1617608 3300039450 Bacteria 1410
175 Ga0436362_0014875 3300039453 Bacteria 763
176 Ga0436362_0546098 3300039453 Bacteria 1081
177 Ga0436362_0609258 3300039453 Bacteria 1224
178 Ga0436362_0657899 3300039453 Bacteria 1008
179 Ga0436362_0825185 3300039453 Bacteria 931
180 Ga0436362_1080755 3300039453 Bacteria 1164
181 Ga0436362_1113979 3300039453 Bacteria 728
182 Ga0439455_0026409 3300042012 Bacteria 1418
183 Ga0439458_0008190 3300042157 Bacteria 2323
184 Ga0453683_0230454 3300044673 Bacteria 1179
185 Ga0451576_0528999 3300045051 Bacteria 1239
186 Ga0466967_0545801 3300045976 Bacteria 1141
187 Ga0495653_0005890 3300046463 Bacteria 10033
188 Ga0495580_0614944 3300046472 Bacteria 717
189 Ga0495582_0162058 3300046473 Bacteria 1272
190 Ga0495583_0070864 3300046506 Bacteria 1532
191 Ga0495630_0536790 3300046517 Bacteria 897
192 Ga0495666_0276381 3300046526 Bacteria 762
193 Ga0495587_0009691 3300046536 Bacteria 6161
194 Ga0495667_0162160 3300046559 Bacteria 1438
195 Ga0495668_0000339 3300046616 Bacteria 62659
196 Ga0495581_0123338 3300047315 Bacteria 1508
197 Ga0495604_0168150 3300047317 Bacteria 1544
198 Ga0495672_0012398 3300047320 Bacteria 5951
199 Ga0495672_0279585 3300047320 Bacteria 798
200 Ga0495602_0011806 3300048088 Bacteria 9019
201 Ga0496100_0203849 3300048903 Bacteria 1443
202 Ga0496104_1114964 3300048907 Unclassified 693
203 Ga0496107_0453388 3300048910 Bacteria 953
204 Ga0496112_0531017 3300048915 Bacteria 1111
205 Ga0501296_001432 3300049519 Bacteria 2416
206 Ga0501298_006463 3300049521 Bacteria 1917
207 Ga0501299_022862 3300049522 Bacteria 1156
208 Ga0501198_001660 3300049649 Bacteria 2936
209 Ga0501202_008374 3300049652 Bacteria 1884
210 Ga0501207_003391 3300049654 Bacteria 2122
211 Ga0501208_005029 3300049655 Bacteria 1599
212 Ga0501216_000851 3300049660 Unclassified 3852
213 Ga0501223_000598 3300049663 Bacteria 8659
214 Ga0501224_004167 3300049664 Bacteria 2043
215 Ga0501227_000833 3300049665 Bacteria 6721
216 Ga0501230_002995 3300049667 Bacteria 2204
217 Ga0501233_001400 3300049668 Unclassified 4120
218 Ga0501235_000777 3300049669 Bacteria 6501
219 Ga0501240_004493 3300049673 Bacteria 1622
220 Ga0501243_001349 3300049675 Unclassified 3507
221 Ga0501221_004640 3300049704 Unclassified 2278
222 Ga0501225_0000653 3300049705 Bacteria 10797
223 Ga0501234_001083 3300049707 Bacteria 4302
224 Ga0501245_001951 3300049708 Unclassified 2721
225 Ga0501266_030465 3300049763 Unclassified 768
226 Ga0501273_001885 3300049770 Bacteria 2069
227 Ga0501279_029330 3300049775 Bacteria 811
228 Ga0501283_035765 3300049779 Bacteria 846
229 Ga0501204_012351 3300049850 Bacteria 1025
230 Ga0501226_001308 3300049853 Bacteria 3216
231 nmdc:mga09592_15581_c1 3300050508 Bacteria 6211
232 nmdc:mga08y16_367052_c1 3300050511 Bacteria 1477
233 nmdc:mga0n895_84950_c1 3300050512 Bacteria 3159
234 nmdc:mga0rr50_378015_c1 3300050513 Bacteria 1194
235 nmdc:mga0a205_131621_c1 3300050515 Bacteria 2402
236 Ga0495619_0278562 3300053085 Bacteria 1159
237 Ga0500564_001786 3300053138 Bacteria 7617
238 Ga0436362_0320270
239 Ga0065715_10133133
240 Ga0065715_10147606
241 Ga0070680_100031465
242 Ga0070680_100316705
243 Ga0070714_100121694
244 Ga0070714_100324836
245 Ga0070713_100190419
246 Ga0070710_10017814
247 Ga0070711_100168945
248 Ga0070705_100032442
249 Ga0070705_100115154
250 Ga0070700_100000413
251 Ga0070694_100017752
252 Ga0070694_100271911
253 Ga0070708_100523226
254 Ga0070663_100040988
255 Ga0070681_10002076
256 Ga0070681_10070077
257 Ga0070681_10189594
258 Ga0070699_100001790
259 Ga0070679_100030759
260 Ga0070679_100499521
261 Ga0070684_100114548
262 Ga0070697_100231878
263 Ga0068853_100269377
264 Ga0070695_100016888
265 Ga0070695_100029697
266 Ga0070695_100070346
267 Ga0070696_100071624
268 Ga0070696_100290555
269 Ga0070693_100737289
270 Ga0068855_100000726
271 Ga0068855_100118134
272 Ga0068856_100038082
273 Ga0068856_100367550
274 Ga0068852_100052469
275 Ga0068859_100043432
276 Ga0068859_100098253
277 Ga0068851_10228176
278 Ga0068863_100634403
279 Ga0068858_100603244
280 Ga0081455_10000040
281 Ga0081455_10207466
282 Ga0081539_10012944
283 Ga0070717_10330444
284 Ga0070715_10053917
285 Ga0070712_100103763
286 Ga0068871_100214151
287 Ga0075434_100010145
288 Ga0097620_100043432
289 Ga0097620_100098254
290 Ga0075435_100601811
291 Ga0105240_10001839
292 Ga0105240_10438351
293 Ga0105247_10990613
294 Ga0105243_10000379
295 Ga0105241_10094748
296 Ga0105241_10151394
297 Ga0105242_10000402
298 Ga0105248_10033518
299 Ga0105248_10625442
300 Ga0105237_10028555
301 Ga0105237_10611304
302 Ga0105238_10003248
303 Ga0157373_10457173
304 Ga0157370_10165508
305 Ga0157370_10168329
306 Ga0157369_10342195
307 Ga0157372_10012877
308 Ga0157372_10530142
309 Ga0157372_11129912
310 Ga0157372_11632701
311 Ga0157380_11542771
312 Ga0213873_10007503
313 Ga0213876_10026791
314 Ga0213875_10020655
315 Ga0213875_10026266
316 Ga0213875_10163505
317 Ga0207705_10732356
318 Ga0207654_10020667
319 Ga0207654_10091442
320 Ga0207707_10006371
321 Ga0207695_10003697
322 Ga0207671_10383251
323 Ga0207671_10715439
324 Ga0207693_10038549
325 Ga0207663_10258403
326 Ga0207660_10079848
327 Ga0207660_10238055
328 Ga0207660_10316768
329 Ga0207649_10655335
330 Ga0207652_10089258
331 Ga0207646_10740800
332 Ga0207694_10194114
333 Ga0207700_10889821
334 Ga0207664_10090335
335 Ga0207664_10374034
336 Ga0207644_10016535
337 Ga0207706_10275756
338 Ga0207686_10000025
339 Ga0207686_10134922
340 Ga0207709_10000024
341 Ga0207670_10132994
342 Ga0207711_10026176
343 Ga0207711_10072130
344 Ga0207689_10038022
345 Ga0207679_10688794
346 Ga0207667_10000500
347 Ga0207658_10300688
348 Ga0207658_11177116
349 Ga0207677_10107326
350 Ga0207703_10909179
351 Ga0207678_10007903
352 Ga0207708_10000646
353 Ga0207702_10071975
354 Ga0207702_10198243
355 Ga0207641_10490335
356 Ga0207676_10013350
357 Ga0207674_10018114
358 Ga0207698_10025619
359 Ga0207698_10076262
360 Ga0209588_1180407
361 Ga0268264_10328032
362 Ga0265331_10000049
363 Ga0307408_100003432
364 Ga0307405_10035714
365 Ga0307410_10013839
366 Ga0307410_10175600
367 Ga0307406_10000345
368 Ga0307412_10007699
369 Ga0307416_100124750
370 Ga0307414_10001908
371 Ga0307411_10007589
372 Ga0307415_100003155
373 Ga0373934_0000683
374 Ga0373940_0017422
375 Ga0373951_0025232
376 Ga0373953_0075607
377 Ga0373956_0005010
378 Ga0373957_0006735
379 Ga0316574_0183437
380 Ga0373937_0001327
381 Ga0373937_1348136
382 Ga0395900_0312170
383 Ga0395898_0149664
384 Ga0395898_0177448
385 Ga0436364_0243094
386 Ga0436364_0642601
387 Ga0436364_0913987
388 Ga0436364_1032867
389 Ga0436364_1156845
390 Ga0395901_0297075
391 Ga0395901_0466072
392 Ga0436365_0407548
393 Ga0436365_0489686
394 Ga0436365_0681052
395 Ga0436365_0787439
396 Ga0436365_1565458
397 Ga0436360_0045500
398 Ga0436360_0973115
399 Ga0436360_0995992
400 Ga0436360_1215655
401 Ga0436360_1364437
402 Ga0436361_0264951
403 Ga0436361_0500168
404 Ga0436361_0514232
405 Ga0436361_0658215
406 Ga0436363_0197903
407 Ga0436363_0305530
408 Ga0436363_0458337
409 Ga0436363_1213493
410 Ga0436363_1401783
411 Ga0436363_1617608
412 Ga0436362_0014875
413 Ga0436362_0546098
414 Ga0436362_0609258
415 Ga0436362_0657899
416 Ga0436362_0825185
417 Ga0436362_1080755
418 Ga0436362_1113979
419 Ga0439455_0026409
420 Ga0439458_0008190
421 Ga0453683_0230454
422 Ga0451576_0528999
423 Ga0466967_0545801
424 Ga0495653_0005890
425 Ga0495580_0614944
426 Ga0495582_0162058
427 Ga0495583_0070864
428 Ga0495630_0536790
429 Ga0495666_0276381
430 Ga0495587_0009691
431 Ga0495667_0162160
432 Ga0495668_0000339
433 Ga0495581_0123338
434 Ga0495604_0168150
435 Ga0495672_0012398
436 Ga0495672_0279585
437 Ga0495602_0011806
438 Ga0496100_0203849
439 Ga0496104_1114964
440 Ga0496107_0453388
441 Ga0496112_0531017
442 Ga0501296_001432
443 Ga0501298_006463
444 Ga0501299_022862
445 Ga0501198_001660
446 Ga0501202_008374
447 Ga0501207_003391
448 Ga0501208_005029
449 Ga0501216_000851
450 Ga0501223_000598
451 Ga0501224_004167
452 Ga0501227_000833
453 Ga0501230_002995
454 Ga0501233_001400
455 Ga0501235_000777
456 Ga0501240_004493
457 Ga0501243_001349
458 Ga0501221_004640
459 Ga0501225_0000653
460 Ga0501234_001083
461 Ga0501245_001951
462 Ga0501266_030465
463 Ga0501273_001885
464 Ga0501279_029330
465 Ga0501283_035765
466 Ga0501204_012351
467 Ga0501226_001308
468 nmdc:mga09592_15581_c1
469 nmdc:mga08y16_367052_c1
470 nmdc:mga0n895_84950_c1
471 nmdc:mga0rr50_378015_c1
472 nmdc:mga0a205_131621_c1
473 Ga0495619_0278562
474 Ga0500564_001786

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06736

TMEM175

Endosomal/lysosomal potassium channel TMEM175

42

126

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.8522 3 182
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.8144 3 182
6w8n-assembly1.cif.gz_B structure of a trans-membrane protein 0.8022 1 175
6w8p-assembly1.cif.gz_B structure of membrane protein with ions 0.7761 5 174
7lf6-assembly1.cif.gz_B structure of lysosomal membrane protein 0.7686 1 189
ID Description Score Start End Superfamily
af_Q54MH2_519_615_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6388 38 130 1.20.120.230
af_Q54MH2_519_615_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6117 38 130 1.20.120.230
1sj8A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5965 36 154 1.20.120.230
af_K7LQJ6_1_283_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5793 3 149 1.25.10.10
1sj8A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5728 36 154 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A5B7SMU3-F1-model_v4 DUF1211 domain-containing protein 0.976 1 186 GO:0005267
GO:0015252
GO:0016020
AF-A0A6I3XDT1-F1-model_v4 DUF1211 domain-containing protein 0.9751 1 188 GO:0005267
GO:0015252
GO:0016020
AF-A0A0P0CU12-F1-model_v4 DUF1211 domain-containing protein 0.9707 1 186 GO:0005267
GO:0015252
GO:0016020
AF-A0A529ZQU9-F1-model_v4 DUF1211 domain-containing protein 0.9703 1 124 GO:0005267
GO:0015252
GO:0016020
AF-A0A1I4Q9F2-F1-model_v4 Uncharacterized membrane protein 0.9679 3 170 GO:0005267
GO:0015252
GO:0016020

Map