F350200

General Info

Members Datasets Scaffolds Average Seq Length
237 148 474 372

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0292850|Ga0436364_0292850_6277_7614
Length 445
Sequence MASVEQIIALLGGPEAAARLTGVSGEAIRKWRQARAVPSKHWPAVIAATGLSLADLSPDPVEADGPPQGATAVLVLADGTTFWGRGFGAQTSGRVGEICFNTGITGYQETLTDPSYAGQLITFTFPHIGNVGATLEDDEATNVAALGLVVKQDVTEPSNWRAMTTLDGWLRSKDVAGIAGLDTRALTLRIRDGGPPHGVLSYPPDGRFDLAALQAQAQAWPGLEGMDLAKQVSCTQTYTWTEGTWAWPDRHDTPEPRHHVVAVDYGAKRNILRSLAAAGCRVTVVPATASAEDILRHAPDGVFLSNGPGDPAATAQYAVPAIQGVLERGVPLFGICLGHQLLALALGGKTYKLDRGHRGANQPVKDLQTGRVEITSQNHGFAVDETSLPDGVRVTHRSLFDGSNEGIACEGRPAFSVQYHPEASPGPSDSSHLFRRFVGLMEQNA

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
27 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
38 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
44 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
47 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
54 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
55 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
56 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
57 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
58 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
70 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
71 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
72 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
73 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
74 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
75 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
76 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
77 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
78 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
79 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
80 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
81 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
82 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
83 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
148 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0.42
Rhizoplane 0.42
Rhizosphere 89.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0292850 3300037853 Bacteria 11814
2 JGI25406J46586_10000149 3300003203 Bacteria 30772
3 JGI25406J46586_10011600 3300003203 Bacteria 3859
4 JGI25407J50210_10011432 3300003373 Bacteria 2268
5 Ga0070668_100090463 3300005347 Bacteria 2411
6 Ga0070714_100045771 3300005435 Bacteria 3709
7 Ga0070713_100397253 3300005436 Bacteria 1287
8 Ga0070710_10130087 3300005437 Bacteria 1534
9 Ga0070711_100022585 3300005439 Bacteria 4080
10 Ga0070684_100085616 3300005535 Bacteria 2795
11 Ga0070664_100053745 3300005564 Bacteria 3415
12 Ga0068856_100096104 3300005614 Bacteria 2951
13 Ga0068861_100037569 3300005719 Bacteria 3600
14 Ga0081455_10093311 3300005937 Bacteria 2433
15 Ga0081455_10101068 3300005937 Bacteria 2315
16 Ga0081538_10001976 3300005981 Bacteria 20508
17 Ga0081538_10004520 3300005981 Bacteria 12806
18 Ga0081538_10019971 3300005981 Bacteria 4953
19 Ga0081538_10034244 3300005981 Bacteria 3361
20 Ga0081538_10045227 3300005981 Bacteria 2733
21 Ga0081539_10000072 3300005985 Bacteria 232726
22 Ga0081539_10005564 3300005985 Bacteria 12759
23 Ga0081539_10041872 3300005985 Bacteria 2673
24 Ga0081539_10077831 3300005985 Bacteria 1753
25 Ga0075363_100098406 3300006048 Bacteria 1617
26 Ga0075430_100007249 3300006846 Bacteria 9366
27 Ga0075431_100002185 3300006847 Bacteria 18706
28 Ga0075433_10091581 3300006852 Bacteria 2688
29 Ga0075434_100137847 3300006871 Bacteria 2459
30 Ga0075429_100005729 3300006880 Bacteria 10720
31 Ga0114129_10068652 3300009147 Bacteria 4942
32 Ga0105249_10038625 3300009553 Bacteria 4332
33 Ga0163162_10092223 3300013306 Bacteria 3112
34 Ga0163162_10157702 3300013306 Bacteria 2390
35 Ga0182008_10038621 3300014497 Bacteria 2387
36 Ga0213871_10014584 3300021441 Bacteria 1867
37 Ga0207707_10178675 3300025912 Bacteria 1853
38 Ga0207695_10318324 3300025913 Bacteria 1445
39 Ga0207700_10086070 3300025928 Bacteria 2469
40 Ga0207700_10242089 3300025928 Bacteria 1538
41 Ga0207706_10007061 3300025933 Bacteria 10386
42 Ga0207679_10143274 3300025945 Bacteria 1934
43 Ga0207667_10186505 3300025949 Bacteria 2129
44 Ga0207702_10092789 3300026078 Bacteria 2647
45 Ga0207675_100010645 3300026118 Bacteria 8617
46 Ga0207683_10193557 3300026121 Bacteria 1847
47 Ga0207698_10232223 3300026142 Bacteria 1675
48 Ga0207428_10001285 3300027907 Bacteria 26877
49 Ga0265339_10000757 3300031249 Bacteria 24968
50 Ga0265327_10010218 3300031251 Bacteria 6629
51 Ga0265327_10063081 3300031251 Bacteria 1883
52 Ga0265316_10051345 3300031344 Bacteria 3240
53 Ga0307408_100008004 3300031548 Bacteria 6988
54 Ga0307408_100021716 3300031548 Bacteria 4348
55 Ga0307408_100070175 3300031548 Bacteria 2586
56 Ga0265314_10001909 3300031711 Bacteria 22269
57 Ga0265314_10026413 3300031711 Bacteria 4362
58 Ga0316576_10011611 3300031727 Bacteria 5783
59 Ga0316576_10020002 3300031727 Bacteria 4597
60 Ga0307405_10016569 3300031731 Bacteria 4021
61 Ga0307405_10016882 3300031731 Bacteria 3992
62 Ga0307405_10032547 3300031731 Bacteria 3083
63 Ga0307405_10042841 3300031731 Bacteria 2757
64 Ga0307410_10039508 3300031852 Bacteria 3098
65 Ga0307410_10082061 3300031852 Bacteria 2267
66 Ga0307410_10091978 3300031852 Bacteria 2155
67 Ga0307406_10009488 3300031901 Bacteria 5459
68 Ga0307406_10052051 3300031901 Bacteria 2602
69 Ga0307406_10092067 3300031901 Bacteria 2043
70 Ga0307407_10020236 3300031903 Bacteria 3405
71 Ga0307409_100002233 3300031995 Bacteria 10003
72 Ga0307409_100006553 3300031995 Bacteria 6858
73 Ga0307409_100016469 3300031995 Bacteria 4891
74 Ga0307409_100181595 3300031995 Bacteria 1863
75 Ga0307416_100000342 3300032002 Bacteria 24167
76 Ga0307416_100007036 3300032002 Bacteria 7101
77 Ga0307416_100017993 3300032002 Bacteria 4963
78 Ga0307416_100026778 3300032002 Bacteria 4255
79 Ga0307416_100215836 3300032002 Bacteria 1835
80 Ga0307414_10182305 3300032004 Bacteria 1690
81 Ga0307411_10027406 3300032005 Bacteria 3447
82 Ga0307415_100003790 3300032126 Bacteria 7748
83 Ga0307415_100021019 3300032126 Bacteria 4000
84 Ga0307415_100028537 3300032126 Bacteria 3552
85 Ga0307415_100029989 3300032126 Bacteria 3483
86 Ga0316583_10005860 3300032133 Bacteria 4420
87 Ga0373951_0027210 3300035091 Bacteria 1334
88 Ga0373957_0028318 3300035120 Bacteria 2041
89 Ga0373946_0058672 3300035171 Bacteria 1631
90 Ga0316574_0019338 3300035398 Bacteria 4016
91 Ga0373935_0064016 3300035692 Bacteria 2357
92 Ga0373933_0012739 3300035724 Bacteria 4649
93 Ga0373937_0013587 3300036401 Bacteria 7173
94 Ga0373937_0191581 3300036401 Bacteria 1921
95 Ga0316582_0006305 3300036647 Bacteria 6215
96 Ga0316584_0029530 3300036712 Bacteria 4047
97 Ga0373925_0016441 3300037068 Bacteria 5360
98 Ga0395900_0100823 3300037418 Bacteria 2966
99 Ga0395898_0061792 3300037466 Bacteria 3639
100 Ga0395905_0102527 3300037471 Bacteria 2686
101 Ga0395905_0402914 3300037471 Bacteria 1263
102 Ga0316581_0041818 3300037588 Bacteria 1397
103 Ga0395901_0008282 3300038443 Bacteria 10504
104 Ga0395901_0029580 3300038443 Bacteria 5641
105 Ga0395901_0058517 3300038443 Bacteria 4008
106 Ga0395901_0236912 3300038443 Bacteria 1904
107 Ga0400484_38929 3300038725 Bacteria 3432
108 Ga0400490_09629 3300038726 Bacteria 62048
109 Ga0400490_45076 3300038726 Bacteria 1977
110 Ga0400485_12678 3300038735 Bacteria 46924
111 Ga0400486_12309 3300038742 Bacteria 67151
112 Ga0400486_20940 3300038742 Bacteria 27565
113 Ga0400486_27013 3300038742 Bacteria 8448
114 Ga0400483_004498 3300039062 Bacteria 2051
115 Ga0400483_036496 3300039062 Bacteria 7686
116 Ga0400483_067736 3300039062 Bacteria 77755
117 Ga0400483_087780 3300039062 Bacteria 4483
118 Ga0400483_132177 3300039062 Bacteria 7053
119 Ga0400483_142498 3300039062 Bacteria 6824
120 Ga0400483_161386 3300039062 Bacteria 8266
121 Ga0400483_178636 3300039062 Bacteria 3725
122 Ga0400483_216587 3300039062 Bacteria 13413
123 Ga0400483_220019 3300039062 Bacteria 77762
124 Ga0400483_267618 3300039062 Bacteria 5202
125 Ga0400483_282200 3300039062 Bacteria 12229
126 Ga0400489_45608 3300039093 Bacteria 10795
127 Ga0400489_80862 3300039093 Bacteria 53053
128 Ga0400487_60636 3300039110 Bacteria 1944
129 Ga0439448_0001752 3300042005 Bacteria 5734
130 Ga0439448_0035625 3300042005 Bacteria 1594
131 Ga0439463_001069 3300042016 Bacteria 7394
132 Ga0450913_000135 3300042117 Bacteria 2212
133 Ga0450902_001001 3300042137 Bacteria 3721
134 Ga0439444_0000688 3300042437 Bacteria 3973
135 Ga0439464_0004222 3300042439 Bacteria 3663
136 Ga0439464_0043291 3300042439 Bacteria 1287
137 Ga0439460_0019790 3300042461 Bacteria 1826
138 Ga0450916_007164 3300042530 Bacteria 1333
139 Ga0451577_0001521 3300042876 Bacteria 30541
140 Ga0451577_0361762 3300042876 Bacteria 1316
141 Ga0439440_0000874 3300042993 Bacteria 5257
142 Ga0453683_0023643 3300044673 Bacteria 3915
143 Ga0453684_0010534 3300044712 Bacteria 15785
144 Ga0453684_0045615 3300044712 Bacteria 5843
145 Ga0453684_0524933 3300044712 Bacteria 1307
146 Ga0451576_0008812 3300045051 Bacteria 11788
147 Ga0451576_0080684 3300045051 Bacteria 3384
148 Ga0451576_0356001 3300045051 Bacteria 1533
149 Ga0495592_0203907 3300046454 Bacteria 1333
150 Ga0495603_0005555 3300046455 Bacteria 7527
151 Ga0495651_0057373 3300046462 Bacteria 2989
152 Ga0495653_0001325 3300046463 Bacteria 19205
153 Ga0495616_0074133 3300046513 Bacteria 1641
154 Ga0495618_0000115 3300046514 Bacteria 58375
155 Ga0495628_0050032 3300046516 Bacteria 3307
156 Ga0495642_0047265 3300046528 Bacteria 1762
157 Ga0495640_0087731 3300046533 Bacteria 2057
158 Ga0495586_0052852 3300046535 Bacteria 2200
159 Ga0495645_0000012 3300046543 Bacteria 209044
160 Ga0495645_0088896 3300046543 Bacteria 2209
161 Ga0495599_0082709 3300046678 Bacteria 2005
162 Ga0495684_0010634 3300047471 Bacteria 7111
163 Ga0496103_0128531 3300048906 Bacteria 1617
164 Ga0501031_0043842 3300049568 Bacteria 2918
165 Ga0501031_0180164 3300049568 Bacteria 1380
166 Ga0501032_0064093 3300049569 Bacteria 2460
167 Ga0501032_0129945 3300049569 Bacteria 1662
168 Ga0501033_0022718 3300049570 Bacteria 4730
169 Ga0501033_0031092 3300049570 Bacteria 4014
170 Ga0501034_0017198 3300049571 Bacteria 7418
171 Ga0501036_0000400 3300049572 Bacteria 30501
172 Ga0501037_0038890 3300049573 Bacteria 3503
173 Ga0501038_0015960 3300049574 Bacteria 6825
174 Ga0501038_0054278 3300049574 Bacteria 3446
175 Ga0501039_0000517 3300049575 Bacteria 27904
176 Ga0501039_0002771 3300049575 Bacteria 13073
177 Ga0501040_0006551 3300049576 Bacteria 7561
178 Ga0501040_0012660 3300049576 Bacteria 5532
179 Ga0501040_0015046 3300049576 Bacteria 5112
180 Ga0501041_0095040 3300049577 Bacteria 1841
181 Ga0501041_0204992 3300049577 Bacteria 1236
182 Ga0501042_0000452 3300049578 Bacteria 21094
183 Ga0501043_0040813 3300049579 Bacteria 3647
184 Ga0501046_0004957 3300049580 Bacteria 11951
185 Ga0501046_0016671 3300049580 Bacteria 6146
186 Ga0501048_0000152 3300049582 Bacteria 42533
187 Ga0501048_0345329 3300049582 Bacteria 1061
188 Ga0501068_0018413 3300049584 Bacteria 4045
189 Ga0501069_0022890 3300049585 Bacteria 3403
190 Ga0501070_0112063 3300049586 Bacteria 2255
191 Ga0501071_0001732 3300049587 Bacteria 12818
192 Ga0501071_0129081 3300049587 Bacteria 1877
193 Ga0501072_0000416 3300049588 Bacteria 30457
194 Ga0501072_0156440 3300049588 Bacteria 1817
195 Ga0501074_0000766 3300049590 Bacteria 20219
196 Ga0501074_0020545 3300049590 Bacteria 4799
197 Ga0501075_0014101 3300049591 Bacteria 5724
198 Ga0501076_0000258 3300049592 Bacteria 32629
199 Ga0501076_0004627 3300049592 Bacteria 9799
200 Ga0501076_0033167 3300049592 Bacteria 4032
201 Ga0501077_0009061 3300049593 Bacteria 6177
202 Ga0501079_0000402 3300049741 Bacteria 27959
203 Ga0501079_0002596 3300049741 Bacteria 13124
204 Ga0501080_0055368 3300049742 Bacteria 3694
205 Ga0501081_0000939 3300049743 Bacteria 17297
206 Ga0501081_0005126 3300049743 Bacteria 8432
207 Ga0501081_0034777 3300049743 Bacteria 3429
208 Ga0501035_0016586 3300049822 Bacteria 6792
209 Ga0501035_0237524 3300049822 Bacteria 1551
210 Ga0501044_0158199 3300049823 Bacteria 2244
211 Ga0501045_0000125 3300049824 Bacteria 40131
212 Ga0501045_0000156 3300049824 Bacteria 36940
213 Ga0501045_0067195 3300049824 Bacteria 2632
214 nmdc:mga05p37_4191_c1 3300050507 Bacteria 16844
215 nmdc:mga09592_19781_c1 3300050508 Bacteria 5531
216 nmdc:mga0qj67_1782_c1 3300050509 Bacteria 15242
217 nmdc:mga06r32_7441_c1 3300050510 Bacteria 9854
218 nmdc:mga08y16_21189_c1 3300050511 Bacteria 6864
219 nmdc:mga0n895_12933_c1 3300050512 Bacteria 7503
220 nmdc:mga0n895_138644_c1 3300050512 Bacteria 2460
221 nmdc:mga0rr50_268004_c1 3300050513 Bacteria 1422
222 nmdc:mga0a205_13246_c1 3300050515 Bacteria 7669
223 nmdc:mga0a205_5224_c1 3300050515 Bacteria 11684
224 Ga0495601_0024246 3300053077 Bacteria 3736
225 Ga0495612_0000033 3300053078 Bacteria 77643
226 Ga0495619_0030950 3300053085 Bacteria 3466
227 Ga0501084_0000500 3300054114 Bacteria 30054
228 Ga0501084_0003054 3300054114 Bacteria 13568
229 Ga0501084_0082658 3300054114 Bacteria 2695
230 Ga0590075_006413 3300059424 Bacteria 2790
231 Ga0590077_001356 3300059426 Bacteria 5781
232 Ga0501082_0000501 3300060353 Bacteria 34701
233 Ga0501082_0004633 3300060353 Bacteria 11998
234 Ga0501082_0011321 3300060353 Bacteria 7667
235 Ga0530510_0000266 3300061734 Bacteria 32748
236 Ga0530510_0018717 3300061734 Bacteria 4912
237 8019548873 8019547302 Bacteria 7996444
238 Ga0436364_0292850
239 JGI25406J46586_10000149
240 JGI25406J46586_10011600
241 JGI25407J50210_10011432
242 Ga0070668_100090463
243 Ga0070714_100045771
244 Ga0070713_100397253
245 Ga0070710_10130087
246 Ga0070711_100022585
247 Ga0070684_100085616
248 Ga0070664_100053745
249 Ga0068856_100096104
250 Ga0068861_100037569
251 Ga0081455_10093311
252 Ga0081455_10101068
253 Ga0081538_10001976
254 Ga0081538_10004520
255 Ga0081538_10019971
256 Ga0081538_10034244
257 Ga0081538_10045227
258 Ga0081539_10000072
259 Ga0081539_10005564
260 Ga0081539_10041872
261 Ga0081539_10077831
262 Ga0075363_100098406
263 Ga0075430_100007249
264 Ga0075431_100002185
265 Ga0075433_10091581
266 Ga0075434_100137847
267 Ga0075429_100005729
268 Ga0114129_10068652
269 Ga0105249_10038625
270 Ga0163162_10092223
271 Ga0163162_10157702
272 Ga0182008_10038621
273 Ga0213871_10014584
274 Ga0207707_10178675
275 Ga0207695_10318324
276 Ga0207700_10086070
277 Ga0207700_10242089
278 Ga0207706_10007061
279 Ga0207679_10143274
280 Ga0207667_10186505
281 Ga0207702_10092789
282 Ga0207675_100010645
283 Ga0207683_10193557
284 Ga0207698_10232223
285 Ga0207428_10001285
286 Ga0265339_10000757
287 Ga0265327_10010218
288 Ga0265327_10063081
289 Ga0265316_10051345
290 Ga0307408_100008004
291 Ga0307408_100021716
292 Ga0307408_100070175
293 Ga0265314_10001909
294 Ga0265314_10026413
295 Ga0316576_10011611
296 Ga0316576_10020002
297 Ga0307405_10016569
298 Ga0307405_10016882
299 Ga0307405_10032547
300 Ga0307405_10042841
301 Ga0307410_10039508
302 Ga0307410_10082061
303 Ga0307410_10091978
304 Ga0307406_10009488
305 Ga0307406_10052051
306 Ga0307406_10092067
307 Ga0307407_10020236
308 Ga0307409_100002233
309 Ga0307409_100006553
310 Ga0307409_100016469
311 Ga0307409_100181595
312 Ga0307416_100000342
313 Ga0307416_100007036
314 Ga0307416_100017993
315 Ga0307416_100026778
316 Ga0307416_100215836
317 Ga0307414_10182305
318 Ga0307411_10027406
319 Ga0307415_100003790
320 Ga0307415_100021019
321 Ga0307415_100028537
322 Ga0307415_100029989
323 Ga0316583_10005860
324 Ga0373951_0027210
325 Ga0373957_0028318
326 Ga0373946_0058672
327 Ga0316574_0019338
328 Ga0373935_0064016
329 Ga0373933_0012739
330 Ga0373937_0013587
331 Ga0373937_0191581
332 Ga0316582_0006305
333 Ga0316584_0029530
334 Ga0373925_0016441
335 Ga0395900_0100823
336 Ga0395898_0061792
337 Ga0395905_0102527
338 Ga0395905_0402914
339 Ga0316581_0041818
340 Ga0395901_0008282
341 Ga0395901_0029580
342 Ga0395901_0058517
343 Ga0395901_0236912
344 Ga0400484_38929
345 Ga0400490_09629
346 Ga0400490_45076
347 Ga0400485_12678
348 Ga0400486_12309
349 Ga0400486_20940
350 Ga0400486_27013
351 Ga0400483_004498
352 Ga0400483_036496
353 Ga0400483_067736
354 Ga0400483_087780
355 Ga0400483_132177
356 Ga0400483_142498
357 Ga0400483_161386
358 Ga0400483_178636
359 Ga0400483_216587
360 Ga0400483_220019
361 Ga0400483_267618
362 Ga0400483_282200
363 Ga0400489_45608
364 Ga0400489_80862
365 Ga0400487_60636
366 Ga0439448_0001752
367 Ga0439448_0035625
368 Ga0439463_001069
369 Ga0450913_000135
370 Ga0450902_001001
371 Ga0439444_0000688
372 Ga0439464_0004222
373 Ga0439464_0043291
374 Ga0439460_0019790
375 Ga0450916_007164
376 Ga0451577_0001521
377 Ga0451577_0361762
378 Ga0439440_0000874
379 Ga0453683_0023643
380 Ga0453684_0010534
381 Ga0453684_0045615
382 Ga0453684_0524933
383 Ga0451576_0008812
384 Ga0451576_0080684
385 Ga0451576_0356001
386 Ga0495592_0203907
387 Ga0495603_0005555
388 Ga0495651_0057373
389 Ga0495653_0001325
390 Ga0495616_0074133
391 Ga0495618_0000115
392 Ga0495628_0050032
393 Ga0495642_0047265
394 Ga0495640_0087731
395 Ga0495586_0052852
396 Ga0495645_0000012
397 Ga0495645_0088896
398 Ga0495599_0082709
399 Ga0495684_0010634
400 Ga0496103_0128531
401 Ga0501031_0043842
402 Ga0501031_0180164
403 Ga0501032_0064093
404 Ga0501032_0129945
405 Ga0501033_0022718
406 Ga0501033_0031092
407 Ga0501034_0017198
408 Ga0501036_0000400
409 Ga0501037_0038890
410 Ga0501038_0015960
411 Ga0501038_0054278
412 Ga0501039_0000517
413 Ga0501039_0002771
414 Ga0501040_0006551
415 Ga0501040_0012660
416 Ga0501040_0015046
417 Ga0501041_0095040
418 Ga0501041_0204992
419 Ga0501042_0000452
420 Ga0501043_0040813
421 Ga0501046_0004957
422 Ga0501046_0016671
423 Ga0501048_0000152
424 Ga0501048_0345329
425 Ga0501068_0018413
426 Ga0501069_0022890
427 Ga0501070_0112063
428 Ga0501071_0001732
429 Ga0501071_0129081
430 Ga0501072_0000416
431 Ga0501072_0156440
432 Ga0501074_0000766
433 Ga0501074_0020545
434 Ga0501075_0014101
435 Ga0501076_0000258
436 Ga0501076_0004627
437 Ga0501076_0033167
438 Ga0501077_0009061
439 Ga0501079_0000402
440 Ga0501079_0002596
441 Ga0501080_0055368
442 Ga0501081_0000939
443 Ga0501081_0005126
444 Ga0501081_0034777
445 Ga0501035_0016586
446 Ga0501035_0237524
447 Ga0501044_0158199
448 Ga0501045_0000125
449 Ga0501045_0000156
450 Ga0501045_0067195
451 nmdc:mga05p37_4191_c1
452 nmdc:mga09592_19781_c1
453 nmdc:mga0qj67_1782_c1
454 nmdc:mga06r32_7441_c1
455 nmdc:mga08y16_21189_c1
456 nmdc:mga0n895_12933_c1
457 nmdc:mga0n895_138644_c1
458 nmdc:mga0rr50_268004_c1
459 nmdc:mga0a205_13246_c1
460 nmdc:mga0a205_5224_c1
461 Ga0495601_0024246
462 Ga0495612_0000033
463 Ga0495619_0030950
464 Ga0501084_0000500
465 Ga0501084_0003054
466 Ga0501084_0082658
467 Ga0590075_006413
468 Ga0590077_001356
469 Ga0501082_0000501
470 Ga0501082_0004633
471 Ga0501082_0011321
472 Ga0530510_0000266
473 Ga0530510_0018717
474 8019548873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

261

440

0.97

PF00988

CPSase_sm_chain

Carbamoyl-phosphate synthase small chain, CPSase domain

74

200

0.96

PF07722

Peptidase_C26

Peptidase C26

267

378

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c30-assembly1.cif.gz_B crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s 0.9639 68 442
1a9x-assembly1.cif.gz_B carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis 0.9639 70 442
1jdb-assembly1.cif.gz_F carbamoyl phosphate synthetase from escherichia coli 0.9633 68 442
1cs0-assembly4.cif.gz_B crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde 0.9631 68 442
1m6v-assembly1.cif.gz_D crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase 0.9611 68 442
ID Description Score Start End Superfamily
af_Q58425_140_353_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9643 216 439 3.40.50.880
1a9xD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9587 219 443 3.40.50.880
af_P0A6F1_2_151_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9566 70 218 3.50.30.20
af_Q58425_140_353_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9467 216 439 3.40.50.880
1a9xD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9463 219 443 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A4V2ZNY1-F1-model_v4 deleted 0.992 327 408
AF-A0A530QES6-F1-model_v4 carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) 0.991 320 409 GO:0005524
GO:0016874
AF-A0A526YJ70-F1-model_v4 carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) 0.986 198 354 GO:0005524
GO:0016874
AF-A0A7C7UXU0-F1-model_v4 carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) (Arginine-specific carbamoyl phosphate synthetase, glutamine chain) 0.9835 68 413 GO:0004088
GO:0005524
GO:0006207
GO:0006526
GO:0006541
GO:0044205
AF-A0A537SI43-F1-model_v4 carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) (Arginine-specific carbamoyl phosphate synthetase, glutamine chain) 0.9812 129 442 GO:0004088
GO:0005524
GO:0006207
GO:0006526
GO:0006541
GO:0044205

Map