F350063

General Info

Members Datasets Scaffolds Average Seq Length
237 142 474 374

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10112405|Ga0207693_101124052
Length 420
Sequence LPSTAPLAGVYDAGWGGPGSKNEAAGSGLVVKTVSIGQGKGMDEATTIYRDSGSGVASAVAPILTVIVPTLNERDNIEPLVALLSSAMPSTVWEAIFVDDDSPDGTSERVRALARHNPRIRCLQRIGRRGLATACIEGVLASASPYVAVMDADLQHDERLLPQMLQALDSGTVDLVVGSRYIAGGGIGDWSRGRARLSGLATRLARVVCKADVADPLSGFFMCRREVFEEALRQMSGQGFKVLLDLLASSPEPLRVSELPYSFRERQSGESKLDTLIAWEFGMLLADKLIGHIVPVRFALFAMIGGLGLLVHLATLWISLNVSGVGFGVAQSLATVVAMTSNFILNNQFTYRDQRLSGLPLLRGLAVFYLICGLGAVANVGVASYAFTSSQTWWLAGVAGAVVGSVWNFAMSSVFTWRRR

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
116 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
136 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
137 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
138 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
141 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
142 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.22
Nodule 0
Rhizoplane 0.84
Rhizosphere 88.61
Stem 0
Stem Tuber 0
Unclassified 4.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10112405 3300025915 Unclassified 2136
2 JGI24739J22299_10000484 3300001989 Bacteria 13988
3 rootH1_10069960 3300003316 Bacteria 3096
4 Ga0065715_10002558 3300005293 Bacteria 10039
5 Ga0070658_10000478 3300005327 Bacteria 34694
6 Ga0070658_10070175 3300005327 Bacteria 2868
7 Ga0070670_100010382 3300005331 Bacteria 7946
8 Ga0070670_100015167 3300005331 Bacteria 6613
9 Ga0070677_10002729 3300005333 Bacteria 5641
10 Ga0070680_100012073 3300005336 Bacteria 6707
11 Ga0070680_100061726 3300005336 Bacteria 3069
12 Ga0070680_100191385 3300005336 Bacteria 1724
13 Ga0070668_100026119 3300005347 Bacteria 4429
14 Ga0070668_100040177 3300005347 Bacteria 3579
15 Ga0070669_100088029 3300005353 Bacteria 2323
16 Ga0070675_100001388 3300005354 Bacteria 17768
17 Ga0070675_100018740 3300005354 Bacteria 5509
18 Ga0070671_100031324 3300005355 Bacteria 4392
19 Ga0070671_100313630 3300005355 Bacteria 1336
20 Ga0070674_100016750 3300005356 Bacteria 4597
21 Ga0070674_100147829 3300005356 Bacteria 1770
22 Ga0070667_100067204 3300005367 Bacteria 3047
23 Ga0070709_10033546 3300005434 Bacteria 3106
24 Ga0070714_100159662 3300005435 Unclassified 2039
25 Ga0070700_100075363 3300005441 Bacteria 2164
26 Ga0070663_100047834 3300005455 Bacteria 3031
27 Ga0070678_100008135 3300005456 Bacteria 6267
28 Ga0070678_100294087 3300005456 Bacteria 1378
29 Ga0070681_10001858 3300005458 Bacteria 19063
30 Ga0070681_10023501 3300005458 Bacteria 6200
31 Ga0070681_10191733 3300005458 Bacteria 1963
32 Ga0068867_100169976 3300005459 Bacteria 1726
33 Ga0070706_100193239 3300005467 Bacteria 1902
34 Ga0070698_100022249 3300005471 Bacteria 6634
35 Ga0070698_100197730 3300005471 Unclassified 1946
36 Ga0070679_100001956 3300005530 Bacteria 18491
37 Ga0070679_100020395 3300005530 Bacteria 6462
38 Ga0068853_100028972 3300005539 Bacteria 4662
39 Ga0070672_100021810 3300005543 Bacteria 4691
40 Ga0068855_100231798 3300005563 Bacteria 2067
41 Ga0070664_100155360 3300005564 Bacteria 2021
42 Ga0070664_100255616 3300005564 Bacteria 1576
43 Ga0068859_100336782 3300005617 Bacteria 1603
44 Ga0068861_100024890 3300005719 Bacteria 4334
45 Ga0068870_10021849 3300005840 Bacteria 3137
46 Ga0068860_100067820 3300005843 Bacteria 3389
47 Ga0068862_100012867 3300005844 Bacteria 6921
48 Ga0070717_10006890 3300006028 Bacteria 8391
49 Ga0070717_10171933 3300006028 Bacteria 1885
50 Ga0070712_100007764 3300006175 Bacteria 6714
51 Ga0070712_100311913 3300006175 Bacteria 1276
52 Ga0097621_100021009 3300006237 Bacteria 5040
53 Ga0075430_100013694 3300006846 Bacteria 6915
54 Ga0075431_100143103 3300006847 Bacteria 2465
55 Ga0075434_100210990 3300006871 Bacteria 1962
56 Ga0097620_100336758 3300006931 Bacteria 1603
57 Ga0099795_10006490 3300007788 Bacteria 3195
58 Ga0105240_10050959 3300009093 Bacteria 5213
59 Ga0111539_10029956 3300009094 Bacteria 6619
60 Ga0105238_10019546 3300009551 Bacteria 6899
61 Ga0105249_10203781 3300009553 Bacteria 1937
62 Ga0105239_10165442 3300010375 Bacteria 2473
63 Ga0157373_10033249 3300013100 Bacteria 3711
64 Ga0157370_10001521 3300013104 Bacteria 28675
65 Ga0157370_10009951 3300013104 Bacteria 10063
66 Ga0157369_10011319 3300013105 Bacteria 10133
67 Ga0163162_10123250 3300013306 Bacteria 2697
68 Ga0163163_10119407 3300014325 Bacteria 2670
69 Ga0157380_10001163 3300014326 Bacteria 17048
70 Ga0157380_10003164 3300014326 Bacteria 11235
71 Ga0157380_10133577 3300014326 Bacteria 2121
72 Ga0163161_10047815 3300017792 Bacteria 3089
73 Ga0213872_10000373 3300021361 Bacteria 37639
74 Ga0213876_10009786 3300021384 Bacteria 5158
75 Ga0213876_10071879 3300021384 Bacteria 1827
76 Ga0213875_10030303 3300021388 Unclassified 2562
77 Ga0209233_1000730 3300025261 Bacteria 15128
78 Ga0209257_1007968 3300025304 Bacteria 6199
79 Ga0207697_10002846 3300025315 Bacteria 8775
80 Ga0207647_10003037 3300025904 Bacteria 12616
81 Ga0207643_10051692 3300025908 Bacteria 2333
82 Ga0207705_10000119 3300025909 Bacteria 88108
83 Ga0207705_10092680 3300025909 Bacteria 2214
84 Ga0207684_10191799 3300025910 Bacteria 1763
85 Ga0207707_10002837 3300025912 Bacteria 15457
86 Ga0207707_10008948 3300025912 Bacteria 8697
87 Ga0207707_10027116 3300025912 Bacteria 5009
88 Ga0207707_10088506 3300025912 Bacteria 2705
89 Ga0207695_10081512 3300025913 Bacteria 3274
90 Ga0207693_10001504 3300025915 Bacteria 20577
91 Ga0207693_10061491 3300025915 Bacteria 2941
92 Ga0207693_10124507 3300025915 Bacteria 2025
93 Ga0207663_10093926 3300025916 Bacteria 1998
94 Ga0207663_10097556 3300025916 Bacteria 1966
95 Ga0207660_10003640 3300025917 Bacteria 10042
96 Ga0207660_10130871 3300025917 Bacteria 1910
97 Ga0207660_10147330 3300025917 Bacteria 1805
98 Ga0207657_10002263 3300025919 Bacteria 20875
99 Ga0207657_10102756 3300025919 Bacteria 2370
100 Ga0207652_10012091 3300025921 Bacteria 6970
101 Ga0207652_10031352 3300025921 Bacteria 4464
102 Ga0207652_10069901 3300025921 Bacteria 3048
103 Ga0207681_10016220 3300025923 Bacteria 4655
104 Ga0207681_10204315 3300025923 Unclassified 1519
105 Ga0207694_10017504 3300025924 Bacteria 5417
106 Ga0207650_10004146 3300025925 Bacteria 9908
107 Ga0207650_10026885 3300025925 Bacteria 4111
108 Ga0207659_10043904 3300025926 Bacteria 3143
109 Ga0207659_10054326 3300025926 Bacteria 2860
110 Ga0207664_10227884 3300025929 Unclassified 1619
111 Ga0207644_10081902 3300025931 Bacteria 2386
112 Ga0207706_10001540 3300025933 Bacteria 22831
113 Ga0207706_10019262 3300025933 Bacteria 6137
114 Ga0207706_10083572 3300025933 Bacteria 2807
115 Ga0207665_10028419 3300025939 Bacteria 3693
116 Ga0207665_10080598 3300025939 Bacteria 2239
117 Ga0207691_10003138 3300025940 Bacteria 16147
118 Ga0207679_10230972 3300025945 Bacteria 1562
119 Ga0207667_10291946 3300025949 Bacteria 1666
120 Ga0207651_10043265 3300025960 Bacteria 3004
121 Ga0207712_10124149 3300025961 Bacteria 1958
122 Ga0207668_10002919 3300025972 Bacteria 10028
123 Ga0207668_10027554 3300025972 Bacteria 3702
124 Ga0207639_10098094 3300026041 Bacteria 2361
125 Ga0207678_10151141 3300026067 Bacteria 1983
126 Ga0207648_10049590 3300026089 Bacteria 3673
127 Ga0207675_100023732 3300026118 Bacteria 5706
128 Ga0207683_10296432 3300026121 Bacteria 1479
129 Ga0209974_10017221 3300027876 Bacteria 2397
130 Ga0209974_10029921 3300027876 Bacteria 1805
131 Ga0268265_10008490 3300028380 Bacteria 6942
132 Ga0268264_10046911 3300028381 Bacteria 3591
133 Ga0307408_100107117 3300031548 Bacteria 2139
134 Ga0307408_100110313 3300031548 Bacteria 2112
135 Ga0307408_100184095 3300031548 Bacteria 1677
136 Ga0307408_100243278 3300031548 Bacteria 1480
137 Ga0307405_10023534 3300031731 Bacteria 3502
138 Ga0307405_10059691 3300031731 Bacteria 2404
139 Ga0307405_10079598 3300031731 Bacteria 2136
140 Ga0307413_10038925 3300031824 Bacteria 2760
141 Ga0307413_10050420 3300031824 Bacteria 2501
142 Ga0307413_10066062 3300031824 Bacteria 2255
143 Ga0307413_10092730 3300031824 Bacteria 1972
144 Ga0307413_10108677 3300031824 Bacteria 1851
145 Ga0307410_10002510 3300031852 Bacteria 8871
146 Ga0307410_10020906 3300031852 Bacteria 4015
147 Ga0307410_10029788 3300031852 Bacteria 3480
148 Ga0307410_10105270 3300031852 Bacteria 2030
149 Ga0307406_10063802 3300031901 Bacteria 2388
150 Ga0307407_10004555 3300031903 Bacteria 5904
151 Ga0307407_10005830 3300031903 Bacteria 5397
152 Ga0307407_10017727 3300031903 Bacteria 3582
153 Ga0307407_10062848 3300031903 Bacteria 2176
154 Ga0307412_10008903 3300031911 Bacteria 5750
155 Ga0307412_10135182 3300031911 Bacteria 1797
156 Ga0307412_10274897 3300031911 Bacteria 1320
157 Ga0307409_100022329 3300031995 Bacteria 4360
158 Ga0307409_100023933 3300031995 Bacteria 4245
159 Ga0307409_100087487 3300031995 Bacteria 2539
160 Ga0307409_100165473 3300031995 Bacteria 1940
161 Ga0307409_100213710 3300031995 Bacteria 1735
162 Ga0307416_100030793 3300032002 Bacteria 4030
163 Ga0307416_100184857 3300032002 Bacteria 1958
164 Ga0307416_100243152 3300032002 Bacteria 1745
165 Ga0307414_10020118 3300032004 Bacteria 4152
166 Ga0307414_10067834 3300032004 Bacteria 2557
167 Ga0307414_10082996 3300032004 Bacteria 2352
168 Ga0307414_10110177 3300032004 Bacteria 2093
169 Ga0307414_10114000 3300032004 Bacteria 2064
170 Ga0307414_10141548 3300032004 Bacteria 1884
171 Ga0307411_10006303 3300032005 Bacteria 5924
172 Ga0307411_10015645 3300032005 Bacteria 4268
173 Ga0307411_10023396 3300032005 Bacteria 3659
174 Ga0307411_10029847 3300032005 Bacteria 3336
175 Ga0307411_10052039 3300032005 Bacteria 2675
176 Ga0307411_10064806 3300032005 Bacteria 2448
177 Ga0307411_10086589 3300032005 Bacteria 2173
178 Ga0307411_10127154 3300032005 Bacteria 1855
179 Ga0307415_100033223 3300032126 Bacteria 3348
180 Ga0307415_100145372 3300032126 Bacteria 1817
181 Ga0307415_100186704 3300032126 Bacteria 1632
182 Ga0307415_100203650 3300032126 Bacteria 1572
183 Ga0373937_0007234 3300036401 Bacteria 9605
184 Ga0395899_0009262 3300037312 Bacteria 7559
185 Ga0395899_0020803 3300037312 Bacteria 4976
186 Ga0395900_0001580 3300037418 Bacteria 26952
187 Ga0395900_0004983 3300037418 Bacteria 13960
188 Ga0395898_0010862 3300037466 Bacteria 9509
189 Ga0395898_0065256 3300037466 Bacteria 3530
190 Ga0395905_0020646 3300037471 Bacteria 6236
191 Ga0436364_0016251 3300037853 Bacteria 31424
192 Ga0395901_0001664 3300038443 Bacteria 22942
193 Ga0395901_0010228 3300038443 Bacteria 9503
194 Ga0436365_0526755 3300039437 Bacteria 8684
195 Ga0436365_0587802 3300039437 Bacteria 2929
196 Ga0436365_0845979 3300039437 Unclassified 4222
197 Ga0436365_1517627 3300039437 Bacteria 1627
198 Ga0436365_1532051 3300039437 Unclassified 2990
199 Ga0436360_0872737 3300039438 Unclassified 2617
200 Ga0436360_1125785 3300039438 Bacteria 2739
201 Ga0436361_0038036 3300039447 Bacteria 3167
202 Ga0436361_0580915 3300039447 Bacteria 36900
203 Ga0436363_0640164 3300039450 Bacteria 1828
204 Ga0436363_0751728 3300039450 Bacteria 1583
205 Ga0439455_0012713 3300042012 Bacteria 1895
206 Ga0439458_0000900 3300042157 Bacteria 7670
207 Ga0466967_0048662 3300045976 Bacteria 3704
208 Ga0495585_0022224 3300046492 Bacteria 3642
209 Ga0495663_0005045 3300046525 Bacteria 3687
210 Ga0495663_0009322 3300046525 Bacteria 2722
211 Ga0495621_0008300 3300046539 Bacteria 3108
212 Ga0495621_0015283 3300046539 Bacteria 2445
213 Ga0495625_0113406 3300046660 Bacteria 1851
214 Ga0495659_0016088 3300046664 Bacteria 2465
215 Ga0495669_0039489 3300046684 Bacteria 2090
216 Ga0495670_0000795 3300046691 Bacteria 15178
217 Ga0495670_0019456 3300046691 Bacteria 3346
218 Ga0495670_0024745 3300046691 Bacteria 2968
219 Ga0496111_0126543 3300048914 Unclassified 1889
220 Ga0496115_0085738 3300048918 Bacteria 2569
221 Ga0496122_0006559 3300048925 Bacteria 13303
222 Ga0496123_0004266 3300048926 Bacteria 15211
223 Ga0496124_0031830 3300048927 Bacteria 4664
224 Ga0501070_0121236 3300049586 Bacteria 2161
225 Ga0501268_004489 3300049765 Bacteria 1970
226 nmdc:mga06r32_21449_c1 3300050510 Bacteria 5962
227 nmdc:mga08y16_161936_c1 3300050511 Bacteria 2325
228 Ga0495619_0197019 3300053085 Bacteria 1395
229 Ga0500643_000081 3300053087 Bacteria 101681
230 Ga0500647_0002798 3300053091 Bacteria 6635
231 Ga0500572_000284 3300053111 Bacteria 18415
232 Ga0500642_0000001 3300053130 Bacteria 1468402
233 Ga0500559_0003135 3300053136 Bacteria 8214
234 Ga0500559_0004983 3300053136 Bacteria 6171
235 Ga0500645_000784 3300053730 Bacteria 19194
236 Ga0500661_000082 3300055283 Bacteria 14988
237 2896429883 2896429255 Bacteria 2557483
238 Ga0207693_10112405
239 JGI24739J22299_10000484
240 rootH1_10069960
241 Ga0065715_10002558
242 Ga0070658_10000478
243 Ga0070658_10070175
244 Ga0070670_100010382
245 Ga0070670_100015167
246 Ga0070677_10002729
247 Ga0070680_100012073
248 Ga0070680_100061726
249 Ga0070680_100191385
250 Ga0070668_100026119
251 Ga0070668_100040177
252 Ga0070669_100088029
253 Ga0070675_100001388
254 Ga0070675_100018740
255 Ga0070671_100031324
256 Ga0070671_100313630
257 Ga0070674_100016750
258 Ga0070674_100147829
259 Ga0070667_100067204
260 Ga0070709_10033546
261 Ga0070714_100159662
262 Ga0070700_100075363
263 Ga0070663_100047834
264 Ga0070678_100008135
265 Ga0070678_100294087
266 Ga0070681_10001858
267 Ga0070681_10023501
268 Ga0070681_10191733
269 Ga0068867_100169976
270 Ga0070706_100193239
271 Ga0070698_100022249
272 Ga0070698_100197730
273 Ga0070679_100001956
274 Ga0070679_100020395
275 Ga0068853_100028972
276 Ga0070672_100021810
277 Ga0068855_100231798
278 Ga0070664_100155360
279 Ga0070664_100255616
280 Ga0068859_100336782
281 Ga0068861_100024890
282 Ga0068870_10021849
283 Ga0068860_100067820
284 Ga0068862_100012867
285 Ga0070717_10006890
286 Ga0070717_10171933
287 Ga0070712_100007764
288 Ga0070712_100311913
289 Ga0097621_100021009
290 Ga0075430_100013694
291 Ga0075431_100143103
292 Ga0075434_100210990
293 Ga0097620_100336758
294 Ga0099795_10006490
295 Ga0105240_10050959
296 Ga0111539_10029956
297 Ga0105238_10019546
298 Ga0105249_10203781
299 Ga0105239_10165442
300 Ga0157373_10033249
301 Ga0157370_10001521
302 Ga0157370_10009951
303 Ga0157369_10011319
304 Ga0163162_10123250
305 Ga0163163_10119407
306 Ga0157380_10001163
307 Ga0157380_10003164
308 Ga0157380_10133577
309 Ga0163161_10047815
310 Ga0213872_10000373
311 Ga0213876_10009786
312 Ga0213876_10071879
313 Ga0213875_10030303
314 Ga0209233_1000730
315 Ga0209257_1007968
316 Ga0207697_10002846
317 Ga0207647_10003037
318 Ga0207643_10051692
319 Ga0207705_10000119
320 Ga0207705_10092680
321 Ga0207684_10191799
322 Ga0207707_10002837
323 Ga0207707_10008948
324 Ga0207707_10027116
325 Ga0207707_10088506
326 Ga0207695_10081512
327 Ga0207693_10001504
328 Ga0207693_10061491
329 Ga0207693_10124507
330 Ga0207663_10093926
331 Ga0207663_10097556
332 Ga0207660_10003640
333 Ga0207660_10130871
334 Ga0207660_10147330
335 Ga0207657_10002263
336 Ga0207657_10102756
337 Ga0207652_10012091
338 Ga0207652_10031352
339 Ga0207652_10069901
340 Ga0207681_10016220
341 Ga0207681_10204315
342 Ga0207694_10017504
343 Ga0207650_10004146
344 Ga0207650_10026885
345 Ga0207659_10043904
346 Ga0207659_10054326
347 Ga0207664_10227884
348 Ga0207644_10081902
349 Ga0207706_10001540
350 Ga0207706_10019262
351 Ga0207706_10083572
352 Ga0207665_10028419
353 Ga0207665_10080598
354 Ga0207691_10003138
355 Ga0207679_10230972
356 Ga0207667_10291946
357 Ga0207651_10043265
358 Ga0207712_10124149
359 Ga0207668_10002919
360 Ga0207668_10027554
361 Ga0207639_10098094
362 Ga0207678_10151141
363 Ga0207648_10049590
364 Ga0207675_100023732
365 Ga0207683_10296432
366 Ga0209974_10017221
367 Ga0209974_10029921
368 Ga0268265_10008490
369 Ga0268264_10046911
370 Ga0307408_100107117
371 Ga0307408_100110313
372 Ga0307408_100184095
373 Ga0307408_100243278
374 Ga0307405_10023534
375 Ga0307405_10059691
376 Ga0307405_10079598
377 Ga0307413_10038925
378 Ga0307413_10050420
379 Ga0307413_10066062
380 Ga0307413_10092730
381 Ga0307413_10108677
382 Ga0307410_10002510
383 Ga0307410_10020906
384 Ga0307410_10029788
385 Ga0307410_10105270
386 Ga0307406_10063802
387 Ga0307407_10004555
388 Ga0307407_10005830
389 Ga0307407_10017727
390 Ga0307407_10062848
391 Ga0307412_10008903
392 Ga0307412_10135182
393 Ga0307412_10274897
394 Ga0307409_100022329
395 Ga0307409_100023933
396 Ga0307409_100087487
397 Ga0307409_100165473
398 Ga0307409_100213710
399 Ga0307416_100030793
400 Ga0307416_100184857
401 Ga0307416_100243152
402 Ga0307414_10020118
403 Ga0307414_10067834
404 Ga0307414_10082996
405 Ga0307414_10110177
406 Ga0307414_10114000
407 Ga0307414_10141548
408 Ga0307411_10006303
409 Ga0307411_10015645
410 Ga0307411_10023396
411 Ga0307411_10029847
412 Ga0307411_10052039
413 Ga0307411_10064806
414 Ga0307411_10086589
415 Ga0307411_10127154
416 Ga0307415_100033223
417 Ga0307415_100145372
418 Ga0307415_100186704
419 Ga0307415_100203650
420 Ga0373937_0007234
421 Ga0395899_0009262
422 Ga0395899_0020803
423 Ga0395900_0001580
424 Ga0395900_0004983
425 Ga0395898_0010862
426 Ga0395898_0065256
427 Ga0395905_0020646
428 Ga0436364_0016251
429 Ga0395901_0001664
430 Ga0395901_0010228
431 Ga0436365_0526755
432 Ga0436365_0587802
433 Ga0436365_0845979
434 Ga0436365_1517627
435 Ga0436365_1532051
436 Ga0436360_0872737
437 Ga0436360_1125785
438 Ga0436361_0038036
439 Ga0436361_0580915
440 Ga0436363_0640164
441 Ga0436363_0751728
442 Ga0439455_0012713
443 Ga0439458_0000900
444 Ga0466967_0048662
445 Ga0495585_0022224
446 Ga0495663_0005045
447 Ga0495663_0009322
448 Ga0495621_0008300
449 Ga0495621_0015283
450 Ga0495625_0113406
451 Ga0495659_0016088
452 Ga0495669_0039489
453 Ga0495670_0000795
454 Ga0495670_0019456
455 Ga0495670_0024745
456 Ga0496111_0126543
457 Ga0496115_0085738
458 Ga0496122_0006559
459 Ga0496123_0004266
460 Ga0496124_0031830
461 Ga0501070_0121236
462 Ga0501268_004489
463 nmdc:mga06r32_21449_c1
464 nmdc:mga08y16_161936_c1
465 Ga0495619_0197019
466 Ga0500643_000081
467 Ga0500647_0002798
468 Ga0500572_000284
469 Ga0500642_0000001
470 Ga0500559_0003135
471 Ga0500559_0004983
472 Ga0500645_000784
473 Ga0500661_000082
474 2896429883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

65

232

0.97

PF04138

GtrA

GtrA-like protein

300

417

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p8g-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 - apo form 0.7039 14 240
5jud-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with uridine-diphosphate (udp) - gpgs*udp 0.7038 14 240
2y4m-assembly1.cif.gz_A mannosylglycerate synthase in complex with gdp-mannose 0.7021 17 246
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7003 13 220
3ckq-assembly1.cif.gz_A-2 crystal structure of a mycobacterial protein 0.6981 14 240
ID Description Score Start End Superfamily
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9136 16 237 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8907 16 237 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8628 16 244 3.90.550.10
af_P77682_7_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8401 253 368 1.20.1280.290
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8323 16 198 3.90.550.10
ID Description Score Start End GO Terms
AF-F7S7D9-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.9925 13 121 GO:0004582
GO:0009247
GO:0016020
AF-A0A840AX79-F1-model_v4 Glycosyltransferase involved in cell wall biosynthesis 0.9916 12 123 GO:0004582
GO:0009247
GO:0016020
AF-F7S7D9-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.941 13 121 GO:0004582
GO:0009247
GO:0016020
AF-A0A6V7W3L0-F1-model_v4 Dolichol-phosphate mannosyltransferase subunit 1 (EC 2.4.1.83) 0.9377 13 127 GO:0004582
GO:0005789
GO:0006488
GO:0006506
GO:0035269
AF-A0A4Q3GIW8-F1-model_v4 deleted 0.9332 12 370

Map