F348947
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 236 | 166 | 236 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10007270|Ga0081455_1000727012 |
| Length | 230 |
| Sequence | MNEDHPVRFSVEYPDRPLNRLTTALRIFTIIPIAIVLASIGGYAGQGDYSTSGDAPTIVIGGTGLLFLPPLLMILFREKYPRWWFDWNLELLRFTNRVGTYFALMSDRYPSTDEHQWVRLDFPYPDAKRDLNRWLPLVKWLLAIPHYIVLAILYLVVILMVIGAWFAILFTGRYPRGIFEFVEGVIRWHNRVVGYALIMVTDRYPPFSLSQSETPPPVEPAAPEGAPPAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 102 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 104 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 105 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 106 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 107 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 108 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 109 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 110 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 111 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 112 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 113 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 114 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 121 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 122 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 123 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 124 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 125 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 126 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 127 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 136 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 137 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 138 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 139 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 140 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 141 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 142 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 143 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 144 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 145 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 158 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 165 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.27 |
| Nodule | 0 |
| Rhizoplane | 3.39 |
| Rhizosphere | 91.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10209524 | 3300005328 | Bacteria | 1282 |
| 2 | Ga0070683_100205888 | 3300005329 | Bacteria | 1869 |
| 3 | Ga0070683_100213430 | 3300005329 | Bacteria | 1834 |
| 4 | Ga0070683_100278059 | 3300005329 | Bacteria | 1593 |
| 5 | Ga0070690_100348126 | 3300005330 | Bacteria | 1075 |
| 6 | Ga0070666_10500623 | 3300005335 | Bacteria | 881 |
| 7 | Ga0070682_100280859 | 3300005337 | Bacteria | 1214 |
| 8 | Ga0068868_100081167 | 3300005338 | Bacteria | 2599 |
| 9 | Ga0070660_100237162 | 3300005339 | Bacteria | 1485 |
| 10 | Ga0070660_100469988 | 3300005339 | Bacteria | 1044 |
| 11 | Ga0070691_10027311 | 3300005341 | Bacteria | 2663 |
| 12 | Ga0070692_10014805 | 3300005345 | Bacteria | 3673 |
| 13 | Ga0070668_100067919 | 3300005347 | Bacteria | 2770 |
| 14 | Ga0070668_100244494 | 3300005347 | Bacteria | 1487 |
| 15 | Ga0070668_100365786 | 3300005347 | Bacteria | 1224 |
| 16 | Ga0070669_100189277 | 3300005353 | Bacteria | 1614 |
| 17 | Ga0070659_100724029 | 3300005366 | Bacteria | 861 |
| 18 | Ga0070703_10005682 | 3300005406 | Bacteria | 3490 |
| 19 | Ga0070714_100023827 | 3300005435 | Bacteria | 5034 |
| 20 | Ga0070714_100062535 | 3300005435 | Bacteria | 3200 |
| 21 | Ga0070710_10046141 | 3300005437 | Bacteria | 2425 |
| 22 | Ga0070705_100022903 | 3300005440 | Bacteria | 3345 |
| 23 | Ga0070700_100030648 | 3300005441 | Bacteria | 3217 |
| 24 | Ga0070694_100145358 | 3300005444 | Bacteria | 1726 |
| 25 | Ga0070678_100169144 | 3300005456 | Bacteria | 1778 |
| 26 | Ga0070707_100006232 | 3300005468 | Bacteria | 11102 |
| 27 | Ga0070698_100001207 | 3300005471 | Bacteria | 28694 |
| 28 | Ga0070699_100155597 | 3300005518 | Bacteria | 2023 |
| 29 | Ga0070697_100012760 | 3300005536 | Bacteria | 6581 |
| 30 | Ga0068853_100048760 | 3300005539 | Bacteria | 3638 |
| 31 | Ga0068853_100972430 | 3300005539 | Bacteria | 817 |
| 32 | Ga0070686_100010405 | 3300005544 | Bacteria | 5243 |
| 33 | Ga0070695_100017086 | 3300005545 | Bacteria | 4400 |
| 34 | Ga0070696_100085123 | 3300005546 | Bacteria | 2244 |
| 35 | Ga0070696_100256355 | 3300005546 | Bacteria | 1325 |
| 36 | Ga0070693_100033245 | 3300005547 | Bacteria | 2844 |
| 37 | Ga0070693_100417781 | 3300005547 | Bacteria | 934 |
| 38 | Ga0070664_100895980 | 3300005564 | Bacteria | 832 |
| 39 | Ga0068854_100057214 | 3300005578 | Bacteria | 2812 |
| 40 | Ga0070702_100035453 | 3300005615 | Bacteria | 2756 |
| 41 | Ga0070702_100153624 | 3300005615 | Bacteria | 1480 |
| 42 | Ga0068852_100147783 | 3300005616 | Bacteria | 2182 |
| 43 | Ga0068859_100143527 | 3300005617 | Bacteria | 2461 |
| 44 | Ga0068866_10007362 | 3300005718 | Bacteria | 4608 |
| 45 | Ga0068866_10033746 | 3300005718 | Bacteria | 2486 |
| 46 | Ga0068861_100045404 | 3300005719 | Bacteria | 3308 |
| 47 | Ga0068861_100278719 | 3300005719 | Bacteria | 1439 |
| 48 | Ga0068870_10128267 | 3300005840 | Bacteria | 1470 |
| 49 | Ga0068863_100582812 | 3300005841 | Unclassified | 1106 |
| 50 | Ga0068858_100693319 | 3300005842 | Bacteria | 991 |
| 51 | Ga0068862_100695402 | 3300005844 | Bacteria | 985 |
| 52 | Ga0081455_10007270 | 3300005937 | Bacteria | 11686 |
| 53 | Ga0081455_10030412 | 3300005937 | Bacteria | 4904 |
| 54 | Ga0081538_10003436 | 3300005981 | Bacteria | 14952 |
| 55 | Ga0081538_10008008 | 3300005981 | Bacteria | 9037 |
| 56 | Ga0081538_10037987 | 3300005981 | Bacteria | 3113 |
| 57 | Ga0081538_10130693 | 3300005981 | Bacteria | 1181 |
| 58 | Ga0081538_10164286 | 3300005981 | Bacteria | 980 |
| 59 | Ga0081540_1006688 | 3300005983 | Bacteria | 8339 |
| 60 | Ga0081539_10001489 | 3300005985 | Bacteria | 39599 |
| 61 | Ga0075432_10074398 | 3300006058 | Bacteria | 1224 |
| 62 | Ga0070712_100201382 | 3300006175 | Bacteria | 1564 |
| 63 | Ga0075367_10163164 | 3300006178 | Bacteria | 1386 |
| 64 | Ga0075428_100107667 | 3300006844 | Bacteria | 3038 |
| 65 | Ga0075430_100032232 | 3300006846 | Bacteria | 4449 |
| 66 | Ga0075431_100295011 | 3300006847 | Bacteria | 1639 |
| 67 | Ga0075433_11058943 | 3300006852 | Bacteria | 706 |
| 68 | Ga0068865_100035947 | 3300006881 | Bacteria | 3335 |
| 69 | Ga0068865_100327781 | 3300006881 | Bacteria | 1234 |
| 70 | Ga0097620_100143521 | 3300006931 | Bacteria | 2461 |
| 71 | Ga0099794_10026245 | 3300007265 | Bacteria | 2691 |
| 72 | Ga0105240_10091935 | 3300009093 | Bacteria | 3706 |
| 73 | Ga0111539_10068187 | 3300009094 | Bacteria | 4200 |
| 74 | Ga0111539_10619630 | 3300009094 | Bacteria | 1260 |
| 75 | Ga0105245_10116917 | 3300009098 | Bacteria | 2487 |
| 76 | Ga0105245_10713220 | 3300009098 | Bacteria | 1037 |
| 77 | Ga0114129_10049372 | 3300009147 | Bacteria | 5912 |
| 78 | Ga0114129_10221306 | 3300009147 | Bacteria | 2553 |
| 79 | Ga0105243_10069589 | 3300009148 | Bacteria | 2839 |
| 80 | Ga0105243_10095023 | 3300009148 | Bacteria | 2463 |
| 81 | Ga0105243_10513942 | 3300009148 | Bacteria | 1137 |
| 82 | Ga0105249_10044852 | 3300009553 | Bacteria | 4020 |
| 83 | Ga0105249_10172835 | 3300009553 | Bacteria | 2096 |
| 84 | Ga0105239_10206077 | 3300010375 | Bacteria | 2203 |
| 85 | Ga0105246_10397965 | 3300011119 | Bacteria | 1143 |
| 86 | Ga0157371_10191367 | 3300013102 | Bacteria | 1465 |
| 87 | Ga0163162_10063630 | 3300013306 | Bacteria | 3733 |
| 88 | Ga0157375_10145385 | 3300013308 | Bacteria | 2501 |
| 89 | Ga0157380_10140210 | 3300014326 | Bacteria | 2076 |
| 90 | Ga0157379_10000630 | 3300014968 | Bacteria | 28429 |
| 91 | Ga0207653_10005184 | 3300025885 | Bacteria | 4075 |
| 92 | Ga0207692_10076645 | 3300025898 | Bacteria | 1777 |
| 93 | Ga0207642_10028157 | 3300025899 | Bacteria | 2310 |
| 94 | Ga0207688_10054590 | 3300025901 | Bacteria | 2242 |
| 95 | Ga0207688_10066743 | 3300025901 | Bacteria | 2036 |
| 96 | Ga0207688_10127955 | 3300025901 | Bacteria | 1487 |
| 97 | Ga0207680_10410618 | 3300025903 | Bacteria | 958 |
| 98 | Ga0207645_10150184 | 3300025907 | Bacteria | 1520 |
| 99 | Ga0207707_10764750 | 3300025912 | Bacteria | 807 |
| 100 | Ga0207693_10218449 | 3300025915 | Bacteria | 1498 |
| 101 | Ga0207660_10598086 | 3300025917 | Bacteria | 898 |
| 102 | Ga0207660_10763658 | 3300025917 | Bacteria | 789 |
| 103 | Ga0207657_10009457 | 3300025919 | Bacteria | 9793 |
| 104 | Ga0207657_10178624 | 3300025919 | Bacteria | 1717 |
| 105 | Ga0207646_10001161 | 3300025922 | Bacteria | 33425 |
| 106 | Ga0207646_10259834 | 3300025922 | Bacteria | 1569 |
| 107 | Ga0207681_10060852 | 3300025923 | Bacteria | 2594 |
| 108 | Ga0207659_10151122 | 3300025926 | Bacteria | 1813 |
| 109 | Ga0207664_10058324 | 3300025929 | Bacteria | 3071 |
| 110 | Ga0207664_10564260 | 3300025929 | Bacteria | 1022 |
| 111 | Ga0207690_10266220 | 3300025932 | Bacteria | 1330 |
| 112 | Ga0207706_10005070 | 3300025933 | Bacteria | 12301 |
| 113 | Ga0207709_10031678 | 3300025935 | Bacteria | 3091 |
| 114 | Ga0207709_10413499 | 3300025935 | Bacteria | 1034 |
| 115 | Ga0207665_10039164 | 3300025939 | Bacteria | 3159 |
| 116 | Ga0207691_10395243 | 3300025940 | Bacteria | 1179 |
| 117 | Ga0207711_10377801 | 3300025941 | Bacteria | 1315 |
| 118 | Ga0207689_10186533 | 3300025942 | Bacteria | 1711 |
| 119 | Ga0207661_10040103 | 3300025944 | Bacteria | 3679 |
| 120 | Ga0207667_10463772 | 3300025949 | Bacteria | 1286 |
| 121 | Ga0207712_10071348 | 3300025961 | Bacteria | 2498 |
| 122 | Ga0207668_10095110 | 3300025972 | Bacteria | 2199 |
| 123 | Ga0207668_10431090 | 3300025972 | Bacteria | 1121 |
| 124 | Ga0207640_10044604 | 3300025981 | Bacteria | 2842 |
| 125 | Ga0207640_10191535 | 3300025981 | Bacteria | 1542 |
| 126 | Ga0207677_10138661 | 3300026023 | Bacteria | 1859 |
| 127 | Ga0207639_10040738 | 3300026041 | Bacteria | 3469 |
| 128 | Ga0207708_10001405 | 3300026075 | Bacteria | 18051 |
| 129 | Ga0207708_10003806 | 3300026075 | Bacteria | 11122 |
| 130 | Ga0207708_10183356 | 3300026075 | Bacteria | 1662 |
| 131 | Ga0207708_10502425 | 3300026075 | Bacteria | 1016 |
| 132 | Ga0207648_10012865 | 3300026089 | Bacteria | 7814 |
| 133 | Ga0207648_10263333 | 3300026089 | Bacteria | 1539 |
| 134 | Ga0207675_100021201 | 3300026118 | Bacteria | 6054 |
| 135 | Ga0207675_100021425 | 3300026118 | Bacteria | 6021 |
| 136 | Ga0207675_100054003 | 3300026118 | Bacteria | 3748 |
| 137 | Ga0207683_10039769 | 3300026121 | Bacteria | 4103 |
| 138 | Ga0207698_10715630 | 3300026142 | Bacteria | 997 |
| 139 | Ga0207698_10854252 | 3300026142 | Bacteria | 915 |
| 140 | Ga0268265_10452920 | 3300028380 | Bacteria | 1199 |
| 141 | Ga0265319_1000006 | 3300028563 | Bacteria | 228868 |
| 142 | Ga0307405_10087155 | 3300031731 | Bacteria | 2057 |
| 143 | Ga0307413_10118283 | 3300031824 | Bacteria | 1789 |
| 144 | Ga0307413_10497199 | 3300031824 | Bacteria | 978 |
| 145 | Ga0307410_10038056 | 3300031852 | Bacteria | 3148 |
| 146 | Ga0307410_10368172 | 3300031852 | Bacteria | 1153 |
| 147 | Ga0307410_10921952 | 3300031852 | Bacteria | 749 |
| 148 | Ga0307406_10023775 | 3300031901 | Bacteria | 3651 |
| 149 | Ga0307406_10032538 | 3300031901 | Bacteria | 3185 |
| 150 | Ga0307407_10041070 | 3300031903 | Bacteria | 2584 |
| 151 | Ga0307409_100002361 | 3300031995 | Bacteria | 9817 |
| 152 | Ga0307409_100032986 | 3300031995 | Bacteria | 3762 |
| 153 | Ga0307409_100089039 | 3300031995 | Bacteria | 2522 |
| 154 | Ga0307416_100020134 | 3300032002 | Bacteria | 4752 |
| 155 | Ga0307416_100807231 | 3300032002 | Bacteria | 1034 |
| 156 | Ga0307414_10511037 | 3300032004 | Bacteria | 1065 |
| 157 | Ga0307411_10708222 | 3300032005 | Bacteria | 878 |
| 158 | Ga0307415_100010152 | 3300032126 | Bacteria | 5319 |
| 159 | Ga0307415_100437520 | 3300032126 | Bacteria | 1127 |
| 160 | Ga0373961_0019183 | 3300035241 | Bacteria | 1794 |
| 161 | Ga0373931_0134441 | 3300035691 | Bacteria | 1427 |
| 162 | Ga0395899_0006949 | 3300037312 | Bacteria | 8766 |
| 163 | Ga0395899_0105324 | 3300037312 | Bacteria | 2032 |
| 164 | Ga0395900_0002485 | 3300037418 | Bacteria | 20252 |
| 165 | Ga0395900_0026154 | 3300037418 | Bacteria | 5975 |
| 166 | Ga0395900_0089576 | 3300037418 | Bacteria | 3162 |
| 167 | Ga0395898_0009813 | 3300037466 | Bacteria | 10033 |
| 168 | Ga0395898_0013840 | 3300037466 | Bacteria | 8291 |
| 169 | Ga0395898_0112582 | 3300037466 | Bacteria | 2608 |
| 170 | Ga0395898_0431434 | 3300037466 | Bacteria | 1256 |
| 171 | Ga0395898_0495637 | 3300037466 | Bacteria | 1162 |
| 172 | Ga0395898_0535530 | 3300037466 | Bacteria | 1113 |
| 173 | Ga0395905_0020168 | 3300037471 | Bacteria | 6314 |
| 174 | Ga0395905_0024552 | 3300037471 | Bacteria | 5688 |
| 175 | Ga0395905_0090173 | 3300037471 | Bacteria | 2874 |
| 176 | Ga0436364_1249082 | 3300037853 | Bacteria | 3777 |
| 177 | Ga0395901_0001878 | 3300038443 | Bacteria | 21664 |
| 178 | Ga0395901_0002002 | 3300038443 | Bacteria | 20963 |
| 179 | Ga0395901_0034355 | 3300038443 | Bacteria | 5236 |
| 180 | Ga0395901_0133842 | 3300038443 | Bacteria | 2605 |
| 181 | Ga0395901_0259942 | 3300038443 | Bacteria | 1807 |
| 182 | Ga0400485_19226 | 3300038735 | Bacteria | 11624 |
| 183 | Ga0400486_29975 | 3300038742 | Bacteria | 11815 |
| 184 | Ga0436365_1298002 | 3300039437 | Bacteria | 1296 |
| 185 | Ga0436363_0556933 | 3300039450 | Bacteria | 1028 |
| 186 | Ga0436362_0197462 | 3300039453 | Bacteria | 1224 |
| 187 | Ga0466959_0271369 | 3300045049 | Bacteria | 1166 |
| 188 | Ga0466958_0060386 | 3300045836 | Bacteria | 2308 |
| 189 | Ga0495584_0178283 | 3300046491 | Bacteria | 1080 |
| 190 | Ga0495594_0158111 | 3300046499 | Bacteria | 1288 |
| 191 | Ga0495596_0044552 | 3300046500 | Bacteria | 1746 |
| 192 | Ga0495608_0296429 | 3300046511 | Bacteria | 1002 |
| 193 | Ga0495616_0108253 | 3300046513 | Bacteria | 1294 |
| 194 | Ga0495659_0107885 | 3300046664 | Bacteria | 1085 |
| 195 | Ga0496100_0577705 | 3300048903 | Bacteria | 871 |
| 196 | Ga0496101_0498823 | 3300048904 | Bacteria | 962 |
| 197 | Ga0496102_0000044 | 3300048905 | Bacteria | 187834 |
| 198 | Ga0496102_0044217 | 3300048905 | Bacteria | 4041 |
| 199 | Ga0496103_0000123 | 3300048906 | Bacteria | 83794 |
| 200 | Ga0496106_0099437 | 3300048909 | Bacteria | 2255 |
| 201 | Ga0496107_0321825 | 3300048910 | Bacteria | 1151 |
| 202 | Ga0496114_0569430 | 3300048917 | Bacteria | 1000 |
| 203 | Ga0496117_0122545 | 3300048920 | Bacteria | 1594 |
| 204 | Ga0496118_0037771 | 3300048921 | Bacteria | 3880 |
| 205 | Ga0496119_0005652 | 3300048922 | Bacteria | 11869 |
| 206 | Ga0496121_0069682 | 3300048924 | Bacteria | 2837 |
| 207 | Ga0496126_0178791 | 3300048929 | Bacteria | 1803 |
| 208 | Ga0501034_0004805 | 3300049571 | Bacteria | 14939 |
| 209 | Ga0501036_0136645 | 3300049572 | Bacteria | 2069 |
| 210 | Ga0501038_0383408 | 3300049574 | Bacteria | 1090 |
| 211 | Ga0501040_0371686 | 3300049576 | Bacteria | 1025 |
| 212 | Ga0501046_0287607 | 3300049580 | Bacteria | 1203 |
| 213 | Ga0501069_0078787 | 3300049585 | Bacteria | 1854 |
| 214 | Ga0501071_0045233 | 3300049587 | Bacteria | 3160 |
| 215 | Ga0501071_0478693 | 3300049587 | Bacteria | 954 |
| 216 | Ga0501072_0027825 | 3300049588 | Bacteria | 4411 |
| 217 | Ga0501075_0088028 | 3300049591 | Bacteria | 2354 |
| 218 | Ga0501075_0118631 | 3300049591 | Bacteria | 2012 |
| 219 | Ga0501076_0817559 | 3300049592 | Bacteria | 769 |
| 220 | Ga0501081_0465972 | 3300049743 | Bacteria | 939 |
| 221 | Ga0501045_0168708 | 3300049824 | Bacteria | 1630 |
| 222 | nmdc:mga06z11_220377_c1 | 3300050494 | Bacteria | 1108 |
| 223 | nmdc:mga05p37_200387_c1 | 3300050507 | Bacteria | 2418 |
| 224 | nmdc:mga05p37_54520_c1 | 3300050507 | Bacteria | 4919 |
| 225 | nmdc:mga09592_180886_c1 | 3300050508 | Bacteria | 1824 |
| 226 | nmdc:mga0qj67_92952_c1 | 3300050509 | Bacteria | 2425 |
| 227 | nmdc:mga0qj67_98715_c1 | 3300050509 | Bacteria | 2352 |
| 228 | nmdc:mga08y16_231686_c1 | 3300050511 | Bacteria | 1910 |
| 229 | nmdc:mga08y16_337725_c1 | 3300050511 | Bacteria | 1549 |
| 230 | nmdc:mga08y16_652445_c1 | 3300050511 | Bacteria | 1056 |
| 231 | nmdc:mga08y16_67411_c1 | 3300050511 | Bacteria | 3733 |
| 232 | nmdc:mga0a205_170381_c1 | 3300050515 | Bacteria | 2073 |
| 233 | Ga0495619_0102609 | 3300053085 | Bacteria | 1948 |
| 234 | Ga0500646_0000834 | 3300053090 | Bacteria | 8534 |
| 235 | Ga0501084_0140672 | 3300054114 | Bacteria | 2032 |
| 236 | Ga0530510_0235565 | 3300061734 | Bacteria | 1362 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005335 | Ga0070666_10500623 | Ga0070666_105006232 | 154 |
| 2 | 3300005617 | Ga0068859_100143527 | Ga0068859_1001435273 | 154 |
| 3 | 3300006931 | Ga0097620_100143521 | Ga0097620_1001435213 | 154 |
| 4 | 3300045049 | Ga0466959_0271369 | Ga0466959_0271369_480_1148 | 163 |
| 5 | 3300032002 | Ga0307416_100807231 | Ga0307416_1008072312 | 166 |
| 6 | 3300006178 | Ga0075367_10163164 | Ga0075367_101631642 | 168 |
| 7 | 3300050494 | nmdc:mga06z11_220377_c1 | nmdc:mga06z11_220377_c1_239_874 | 168 |
| 8 | 3300005435 | Ga0070714_100062535 | Ga0070714_1000625352 | 171 |
| 9 | 3300048909 | Ga0496106_0099437 | Ga0496106_0099437_21_626 | 171 |
| 10 | 3300005329 | Ga0070683_100278059 | Ga0070683_1002780592 | 173 |
| 11 | 3300050511 | nmdc:mga08y16_652445_c1 | nmdc:mga08y16_652445_c1_180_794 | 174 |
| 12 | 3300005330 | Ga0070690_100348126 | Ga0070690_1003481262 | 177 |
| 13 | 3300005337 | Ga0070682_100280859 | Ga0070682_1002808592 | 177 |
| 14 | 3300005338 | Ga0068868_100081167 | Ga0068868_1000811674 | 177 |
| 15 | 3300005339 | Ga0070660_100469988 | Ga0070660_1004699882 | 177 |
| 16 | 3300005345 | Ga0070692_10014805 | Ga0070692_100148055 | 177 |
| 17 | 3300005347 | Ga0070668_100365786 | Ga0070668_1003657862 | 177 |
| 18 | 3300005353 | Ga0070669_100189277 | Ga0070669_1001892772 | 177 |
| 19 | 3300005406 | Ga0070703_10005682 | Ga0070703_100056822 | 177 |
| 20 | 3300005440 | Ga0070705_100022903 | Ga0070705_1000229031 | 177 |
| 21 | 3300005441 | Ga0070700_100030648 | Ga0070700_1000306482 | 177 |
| 22 | 3300005444 | Ga0070694_100145358 | Ga0070694_1001453583 | 177 |
| 23 | 3300005539 | Ga0068853_100048760 | Ga0068853_1000487604 | 177 |
| 24 | 3300005544 | Ga0070686_100010405 | Ga0070686_1000104054 | 177 |
| 25 | 3300005545 | Ga0070695_100017086 | Ga0070695_1000170864 | 177 |
| 26 | 3300005546 | Ga0070696_100256355 | Ga0070696_1002563553 | 177 |
| 27 | 3300005547 | Ga0070693_100033245 | Ga0070693_1000332453 | 177 |
| 28 | 3300005578 | Ga0068854_100057214 | Ga0068854_1000572143 | 177 |
| 29 | 3300005615 | Ga0070702_100035453 | Ga0070702_1000354534 | 177 |
| 30 | 3300005718 | Ga0068866_10007362 | Ga0068866_100073624 | 177 |
| 31 | 3300005842 | Ga0068858_100693319 | Ga0068858_1006933192 | 177 |
| 32 | 3300005844 | Ga0068862_100695402 | Ga0068862_1006954021 | 177 |
| 33 | 3300006881 | Ga0068865_100035947 | Ga0068865_1000359472 | 177 |
| 34 | 3300009093 | Ga0105240_10091935 | Ga0105240_100919355 | 177 |
| 35 | 3300009148 | Ga0105243_10095023 | Ga0105243_100950233 | 177 |
| 36 | 3300009553 | Ga0105249_10044852 | Ga0105249_100448522 | 177 |
| 37 | 3300013102 | Ga0157371_10191367 | Ga0157371_101913673 | 177 |
| 38 | 3300013308 | Ga0157375_10145385 | Ga0157375_101453853 | 177 |
| 39 | 3300025885 | Ga0207653_10005184 | Ga0207653_100051845 | 177 |
| 40 | 3300025899 | Ga0207642_10028157 | Ga0207642_100281573 | 177 |
| 41 | 3300025903 | Ga0207680_10410618 | Ga0207680_104106182 | 177 |
| 42 | 3300025907 | Ga0207645_10150184 | Ga0207645_101501843 | 177 |
| 43 | 3300025917 | Ga0207660_10598086 | Ga0207660_105980861 | 177 |
| 44 | 3300025919 | Ga0207657_10009457 | Ga0207657_100094577 | 177 |
| 45 | 3300025923 | Ga0207681_10060852 | Ga0207681_100608525 | 177 |
| 46 | 3300025932 | Ga0207690_10266220 | Ga0207690_102662202 | 177 |
| 47 | 3300025933 | Ga0207706_10005070 | Ga0207706_100050707 | 177 |
| 48 | 3300025935 | Ga0207709_10031678 | Ga0207709_100316784 | 177 |
| 49 | 3300025941 | Ga0207711_10377801 | Ga0207711_103778012 | 177 |
| 50 | 3300025949 | Ga0207667_10463772 | Ga0207667_104637722 | 177 |
| 51 | 3300025972 | Ga0207668_10095110 | Ga0207668_100951105 | 177 |
| 52 | 3300025981 | Ga0207640_10044604 | Ga0207640_100446043 | 177 |
| 53 | 3300026041 | Ga0207639_10040738 | Ga0207639_100407382 | 177 |
| 54 | 3300026075 | Ga0207708_10003806 | Ga0207708_100038066 | 177 |
| 55 | 3300026089 | Ga0207648_10012865 | Ga0207648_100128657 | 177 |
| 56 | 3300026118 | Ga0207675_100021201 | Ga0207675_1000212012 | 177 |
| 57 | 3300026142 | Ga0207698_10854252 | Ga0207698_108542521 | 177 |
| 58 | 3300028380 | Ga0268265_10452920 | Ga0268265_104529203 | 177 |
| 59 | 3300037312 | Ga0395899_0006949 | Ga0395899_0006949_7711_8358 | 177 |
| 60 | 3300037418 | Ga0395900_0002485 | Ga0395900_0002485_10719_11366 | 177 |
| 61 | 3300037466 | Ga0395898_0013840 | Ga0395898_0013840_6946_7593 | 177 |
| 62 | 3300037471 | Ga0395905_0020168 | Ga0395905_0020168_961_1608 | 177 |
| 63 | 3300038443 | Ga0395901_0002002 | Ga0395901_0002002_1463_2110 | 177 |
| 64 | 3300046499 | Ga0495594_0158111 | Ga0495594_0158111_23_652 | 177 |
| 65 | 3300046664 | Ga0495659_0107885 | Ga0495659_0107885_186_815 | 177 |
| 66 | 3300048904 | Ga0496101_0498823 | Ga0496101_0498823_70_699 | 177 |
| 67 | 3300048905 | Ga0496102_0044217 | Ga0496102_0044217_1349_1978 | 177 |
| 68 | 3300048910 | Ga0496107_0321825 | Ga0496107_0321825_240_869 | 177 |
| 69 | 3300053090 | Ga0500646_0000834 | Ga0500646_0000834_2410_3039 | 177 |
| 70 | 3300005981 | Ga0081538_10164286 | Ga0081538_101642861 | 178 |
| 71 | 3300005471 | Ga0070698_100001207 | Ga0070698_1000012072 | 179 |
| 72 | 3300005518 | Ga0070699_100155597 | Ga0070699_1001555972 | 179 |
| 73 | 3300005841 | Ga0068863_100582812 | Ga0068863_1005828122 | 179 |
| 74 | 3300006881 | Ga0068865_100327781 | Ga0068865_1003277812 | 179 |
| 75 | 3300025922 | Ga0207646_10259834 | Ga0207646_102598342 | 179 |
| 76 | 3300037418 | Ga0395900_0026154 | Ga0395900_0026154_1329_1970 | 179 |
| 77 | 3300037471 | Ga0395905_0090173 | Ga0395905_0090173_13_654 | 179 |
| 78 | 3300038443 | Ga0395901_0034355 | Ga0395901_0034355_2835_3476 | 179 |
| 79 | 3300039453 | Ga0436362_0197462 | Ga0436362_0197462_225_866 | 179 |
| 80 | 3300005437 | Ga0070710_10046141 | Ga0070710_100461412 | 180 |
| 81 | 3300026142 | Ga0207698_10715630 | Ga0207698_107156302 | 180 |
| 82 | 3300037466 | Ga0395898_0431434 | Ga0395898_0431434_490_1125 | 180 |
| 83 | 3300037853 | Ga0436364_1249082 | Ga0436364_1249082_1745_2431 | 180 |
| 84 | 3300005435 | Ga0070714_100023827 | Ga0070714_1000238272 | 181 |
| 85 | 3300005937 | Ga0081455_10030412 | Ga0081455_100304127 | 181 |
| 86 | 3300025898 | Ga0207692_10076645 | Ga0207692_100766451 | 181 |
| 87 | 3300025929 | Ga0207664_10058324 | Ga0207664_100583244 | 181 |
| 88 | 3300054114 | Ga0501084_0140672 | Ga0501084_0140672_972_1574 | 181 |
| 89 | 3300005983 | Ga0081540_1006688 | Ga0081540_10066888 | 182 |
| 90 | 3300006175 | Ga0070712_100201382 | Ga0070712_1002013823 | 182 |
| 91 | 3300025915 | Ga0207693_10218449 | Ga0207693_102184492 | 182 |
| 92 | 3300025939 | Ga0207665_10039164 | Ga0207665_100391643 | 182 |
| 93 | 3300049580 | Ga0501046_0287607 | Ga0501046_0287607_301_960 | 182 |
| 94 | 3300026075 | Ga0207708_10502425 | Ga0207708_105024252 | 183 |
| 95 | 3300005985 | Ga0081539_10001489 | Ga0081539_1000148938 | 184 |
| 96 | 3300038742 | Ga0400486_29975 | Ga0400486_29975_10857_11492 | 184 |
| 97 | 3300061734 | Ga0530510_0235565 | Ga0530510_0235565_504_1148 | 184 |
| 98 | 3300031852 | Ga0307410_10921952 | Ga0307410_109219521 | 185 |
| 99 | 3300032005 | Ga0307411_10708222 | Ga0307411_107082221 | 185 |
| 100 | 3300039450 | Ga0436363_0556933 | Ga0436363_0556933_13_624 | 185 |
| 101 | 3300049576 | Ga0501040_0371686 | Ga0501040_0371686_330_938 | 185 |
| 102 | 3300049587 | Ga0501071_0478693 | Ga0501071_0478693_15_623 | 185 |
| 103 | 3300005718 | Ga0068866_10033746 | Ga0068866_100337462 | 186 |
| 104 | 3300009094 | Ga0111539_10619630 | Ga0111539_106196302 | 186 |
| 105 | 3300026075 | Ga0207708_10183356 | Ga0207708_101833562 | 186 |
| 106 | 3300046500 | Ga0495596_0044552 | Ga0495596_0044552_571_1206 | 186 |
| 107 | 3300005329 | Ga0070683_100205888 | Ga0070683_1002058882 | 187 |
| 108 | 3300005615 | Ga0070702_100153624 | Ga0070702_1001536241 | 187 |
| 109 | 3300031731 | Ga0307405_10087155 | Ga0307405_100871552 | 187 |
| 110 | 3300031852 | Ga0307410_10038056 | Ga0307410_100380562 | 187 |
| 111 | 3300031901 | Ga0307406_10023775 | Ga0307406_100237753 | 187 |
| 112 | 3300031995 | Ga0307409_100002361 | Ga0307409_1000023618 | 187 |
| 113 | 3300032002 | Ga0307416_100020134 | Ga0307416_1000201347 | 187 |
| 114 | 3300037466 | Ga0395898_0535530 | Ga0395898_0535530_50_685 | 187 |
| 115 | 3300038735 | Ga0400485_19226 | Ga0400485_19226_10666_11301 | 187 |
| 116 | 3300025929 | Ga0207664_10564260 | Ga0207664_105642602 | 188 |
| 117 | 3300045836 | Ga0466958_0060386 | Ga0466958_0060386_130_753 | 188 |
| 118 | 3300049571 | Ga0501034_0004805 | Ga0501034_0004805_4297_4935 | 188 |
| 119 | 3300050508 | nmdc:mga09592_180886_c1 | nmdc:mga09592_180886_c1_718_1377 | 188 |
| 120 | 3300005329 | Ga0070683_100213430 | Ga0070683_1002134302 | 189 |
| 121 | 3300005339 | Ga0070660_100237162 | Ga0070660_1002371622 | 189 |
| 122 | 3300005468 | Ga0070707_100006232 | Ga0070707_1000062328 | 189 |
| 123 | 3300005536 | Ga0070697_100012760 | Ga0070697_1000127605 | 189 |
| 124 | 3300005539 | Ga0068853_100972430 | Ga0068853_1009724301 | 189 |
| 125 | 3300005564 | Ga0070664_100895980 | Ga0070664_1008959801 | 189 |
| 126 | 3300005616 | Ga0068852_100147783 | Ga0068852_1001477834 | 189 |
| 127 | 3300006058 | Ga0075432_10074398 | Ga0075432_100743981 | 189 |
| 128 | 3300007265 | Ga0099794_10026245 | Ga0099794_100262453 | 189 |
| 129 | 3300009098 | Ga0105245_10713220 | Ga0105245_107132202 | 189 |
| 130 | 3300009148 | Ga0105243_10069589 | Ga0105243_100695894 | 189 |
| 131 | 3300025901 | Ga0207688_10054590 | Ga0207688_100545902 | 189 |
| 132 | 3300025922 | Ga0207646_10001161 | Ga0207646_1000116131 | 189 |
| 133 | 3300025926 | Ga0207659_10151122 | Ga0207659_101511222 | 189 |
| 134 | 3300025935 | Ga0207709_10413499 | Ga0207709_104134992 | 189 |
| 135 | 3300025942 | Ga0207689_10186533 | Ga0207689_101865332 | 189 |
| 136 | 3300026023 | Ga0207677_10138661 | Ga0207677_101386612 | 189 |
| 137 | 3300026089 | Ga0207648_10263333 | Ga0207648_102633332 | 189 |
| 138 | 3300026121 | Ga0207683_10039769 | Ga0207683_100397693 | 189 |
| 139 | 3300005456 | Ga0070678_100169144 | Ga0070678_1001691442 | 190 |
| 140 | 3300006852 | Ga0075433_11058943 | Ga0075433_110589431 | 190 |
| 141 | 3300009094 | Ga0111539_10068187 | Ga0111539_100681873 | 190 |
| 142 | 3300009147 | Ga0114129_10221306 | Ga0114129_102213063 | 190 |
| 143 | 3300011119 | Ga0105246_10397965 | Ga0105246_103979652 | 190 |
| 144 | 3300014968 | Ga0157379_10000630 | Ga0157379_1000063024 | 190 |
| 145 | 3300025919 | Ga0207657_10178624 | Ga0207657_101786242 | 190 |
| 146 | 3300025944 | Ga0207661_10040103 | Ga0207661_100401032 | 190 |
| 147 | 3300028563 | Ga0265319_1000006 | Ga0265319_1000006226 | 190 |
| 148 | 3300035241 | Ga0373961_0019183 | Ga0373961_0019183_1012_1638 | 190 |
| 149 | 3300035691 | Ga0373931_0134441 | Ga0373931_0134441_85_711 | 190 |
| 150 | 3300038443 | Ga0395901_0259942 | Ga0395901_0259942_206_844 | 190 |
| 151 | 3300046491 | Ga0495584_0178283 | Ga0495584_0178283_443_1069 | 190 |
| 152 | 3300046513 | Ga0495616_0108253 | Ga0495616_0108253_583_1209 | 190 |
| 153 | 3300048905 | Ga0496102_0000044 | Ga0496102_0000044_57271_57897 | 190 |
| 154 | 3300048906 | Ga0496103_0000123 | Ga0496103_0000123_26662_27288 | 190 |
| 155 | 3300048920 | Ga0496117_0122545 | Ga0496117_0122545_956_1582 | 190 |
| 156 | 3300048921 | Ga0496118_0037771 | Ga0496118_0037771_605_1231 | 190 |
| 157 | 3300048922 | Ga0496119_0005652 | Ga0496119_0005652_4954_5580 | 190 |
| 158 | 3300048924 | Ga0496121_0069682 | Ga0496121_0069682_316_942 | 190 |
| 159 | 3300050507 | nmdc:mga05p37_200387_c1 | nmdc:mga05p37_200387_c1_487_1113 | 190 |
| 160 | 3300050509 | nmdc:mga0qj67_98715_c1 | nmdc:mga0qj67_98715_c1_1142_1768 | 190 |
| 161 | 3300050511 | nmdc:mga08y16_67411_c1 | nmdc:mga08y16_67411_c1_2501_3127 | 190 |
| 162 | 3300050515 | nmdc:mga0a205_170381_c1 | nmdc:mga0a205_170381_c1_1086_1712 | 190 |
| 163 | 3300005347 | Ga0070668_100244494 | Ga0070668_1002444942 | 191 |
| 164 | 3300005719 | Ga0068861_100278719 | Ga0068861_1002787192 | 191 |
| 165 | 3300005840 | Ga0068870_10128267 | Ga0068870_101282673 | 191 |
| 166 | 3300009148 | Ga0105243_10513942 | Ga0105243_105139422 | 191 |
| 167 | 3300014326 | Ga0157380_10140210 | Ga0157380_101402102 | 191 |
| 168 | 3300025901 | Ga0207688_10127955 | Ga0207688_101279552 | 191 |
| 169 | 3300025912 | Ga0207707_10764750 | Ga0207707_107647502 | 191 |
| 170 | 3300025917 | Ga0207660_10763658 | Ga0207660_107636581 | 191 |
| 171 | 3300025940 | Ga0207691_10395243 | Ga0207691_103952432 | 191 |
| 172 | 3300025972 | Ga0207668_10431090 | Ga0207668_104310902 | 191 |
| 173 | 3300026075 | Ga0207708_10001405 | Ga0207708_100014052 | 191 |
| 174 | 3300026118 | Ga0207675_100054003 | Ga0207675_1000540032 | 191 |
| 175 | 3300031824 | Ga0307413_10118283 | Ga0307413_101182834 | 191 |
| 176 | 3300031824 | Ga0307413_10497199 | Ga0307413_104971991 | 191 |
| 177 | 3300031852 | Ga0307410_10368172 | Ga0307410_103681721 | 191 |
| 178 | 3300031901 | Ga0307406_10032538 | Ga0307406_100325385 | 191 |
| 179 | 3300031903 | Ga0307407_10041070 | Ga0307407_100410705 | 191 |
| 180 | 3300031995 | Ga0307409_100032986 | Ga0307409_1000329866 | 191 |
| 181 | 3300031995 | Ga0307409_100089039 | Ga0307409_1000890393 | 191 |
| 182 | 3300032004 | Ga0307414_10511037 | Ga0307414_105110371 | 191 |
| 183 | 3300032126 | Ga0307415_100010152 | Ga0307415_1000101525 | 191 |
| 184 | 3300032126 | Ga0307415_100437520 | Ga0307415_1004375202 | 191 |
| 185 | 3300037466 | Ga0395898_0112582 | Ga0395898_0112582_613_1323 | 191 |
| 186 | 3300037466 | Ga0395898_0495637 | Ga0395898_0495637_194_862 | 191 |
| 187 | 3300038443 | Ga0395901_0133842 | Ga0395901_0133842_619_1329 | 191 |
| 188 | 3300039437 | Ga0436365_1298002 | Ga0436365_1298002_302_988 | 191 |
| 189 | 3300046511 | Ga0495608_0296429 | Ga0495608_0296429_162_848 | 191 |
| 190 | 3300048903 | Ga0496100_0577705 | Ga0496100_0577705_228_860 | 191 |
| 191 | 3300048917 | Ga0496114_0569430 | Ga0496114_0569430_305_934 | 191 |
| 192 | 3300048929 | Ga0496126_0178791 | Ga0496126_0178791_834_1463 | 191 |
| 193 | 3300049572 | Ga0501036_0136645 | Ga0501036_0136645_1079_1723 | 191 |
| 194 | 3300049591 | Ga0501075_0088028 | Ga0501075_0088028_370_1014 | 191 |
| 195 | 3300049743 | Ga0501081_0465972 | Ga0501081_0465972_34_678 | 191 |
| 196 | 3300049824 | Ga0501045_0168708 | Ga0501045_0168708_859_1503 | 191 |
| 197 | 3300050511 | nmdc:mga08y16_231686_c1 | nmdc:mga08y16_231686_c1_729_1361 | 191 |
| 198 | 3300053085 | Ga0495619_0102609 | Ga0495619_0102609_658_1311 | 191 |
| 199 | 3300005981 | Ga0081538_10008008 | Ga0081538_100080083 | 193 |
| 200 | 3300006844 | Ga0075428_100107667 | Ga0075428_1001076672 | 193 |
| 201 | 3300006846 | Ga0075430_100032232 | Ga0075430_1000322327 | 193 |
| 202 | 3300006847 | Ga0075431_100295011 | Ga0075431_1002950112 | 193 |
| 203 | 3300009147 | Ga0114129_10049372 | Ga0114129_100493727 | 193 |
| 204 | 3300050507 | nmdc:mga05p37_54520_c1 | nmdc:mga05p37_54520_c1_3713_4372 | 193 |
| 205 | 3300050509 | nmdc:mga0qj67_92952_c1 | nmdc:mga0qj67_92952_c1_1326_1985 | 193 |
| 206 | 3300050511 | nmdc:mga08y16_337725_c1 | nmdc:mga08y16_337725_c1_10_690 | 193 |
| 207 | 3300005547 | Ga0070693_100417781 | Ga0070693_1004177811 | 194 |
| 208 | 3300005981 | Ga0081538_10003436 | Ga0081538_100034363 | 195 |
| 209 | 3300037312 | Ga0395899_0105324 | Ga0395899_0105324_793_1470 | 195 |
| 210 | 3300037418 | Ga0395900_0089576 | Ga0395900_0089576_1355_2032 | 195 |
| 211 | 3300037466 | Ga0395898_0009813 | Ga0395898_0009813_8117_8794 | 195 |
| 212 | 3300037471 | Ga0395905_0024552 | Ga0395905_0024552_2626_3303 | 195 |
| 213 | 3300038443 | Ga0395901_0001878 | Ga0395901_0001878_19784_20461 | 195 |
| 214 | 3300005328 | Ga0070676_10209524 | Ga0070676_102095241 | 197 |
| 215 | 3300005341 | Ga0070691_10027311 | Ga0070691_100273113 | 197 |
| 216 | 3300005347 | Ga0070668_100067919 | Ga0070668_1000679191 | 197 |
| 217 | 3300005366 | Ga0070659_100724029 | Ga0070659_1007240291 | 197 |
| 218 | 3300005546 | Ga0070696_100085123 | Ga0070696_1000851232 | 197 |
| 219 | 3300005719 | Ga0068861_100045404 | Ga0068861_1000454043 | 197 |
| 220 | 3300005937 | Ga0081455_10007270 | Ga0081455_1000727012 | 197 |
| 221 | 3300005981 | Ga0081538_10037987 | Ga0081538_100379875 | 197 |
| 222 | 3300005981 | Ga0081538_10130693 | Ga0081538_101306932 | 197 |
| 223 | 3300009098 | Ga0105245_10116917 | Ga0105245_101169174 | 197 |
| 224 | 3300009553 | Ga0105249_10172835 | Ga0105249_101728352 | 197 |
| 225 | 3300010375 | Ga0105239_10206077 | Ga0105239_102060772 | 197 |
| 226 | 3300013306 | Ga0163162_10063630 | Ga0163162_100636303 | 197 |
| 227 | 3300025901 | Ga0207688_10066743 | Ga0207688_100667432 | 197 |
| 228 | 3300025961 | Ga0207712_10071348 | Ga0207712_100713482 | 197 |
| 229 | 3300025981 | Ga0207640_10191535 | Ga0207640_101915351 | 197 |
| 230 | 3300026118 | Ga0207675_100021425 | Ga0207675_1000214252 | 197 |
| 231 | 3300049574 | Ga0501038_0383408 | Ga0501038_0383408_43_729 | 197 |
| 232 | 3300049585 | Ga0501069_0078787 | Ga0501069_0078787_593_1279 | 197 |
| 233 | 3300049587 | Ga0501071_0045233 | Ga0501071_0045233_1955_2641 | 197 |
| 234 | 3300049588 | Ga0501072_0027825 | Ga0501072_0027825_570_1256 | 197 |
| 235 | 3300049591 | Ga0501075_0118631 | Ga0501075_0118631_1311_1997 | 197 |
| 236 | 3300049592 | Ga0501076_0817559 | Ga0501076_0817559_66_752 | 197 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar