F348947

General Info

Members Datasets Scaffolds Average Seq Length
236 166 236 202

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10007270|Ga0081455_1000727012
Length 230
Sequence MNEDHPVRFSVEYPDRPLNRLTTALRIFTIIPIAIVLASIGGYAGQGDYSTSGDAPTIVIGGTGLLFLPPLLMILFREKYPRWWFDWNLELLRFTNRVGTYFALMSDRYPSTDEHQWVRLDFPYPDAKRDLNRWLPLVKWLLAIPHYIVLAILYLVVILMVIGAWFAILFTGRYPRGIFEFVEGVIRWHNRVVGYALIMVTDRYPPFSLSQSETPPPVEPAAPEGAPPAA

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
121 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 3.39
Rhizosphere 91.1
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10209524 3300005328 Bacteria 1282
2 Ga0070683_100205888 3300005329 Bacteria 1869
3 Ga0070683_100213430 3300005329 Bacteria 1834
4 Ga0070683_100278059 3300005329 Bacteria 1593
5 Ga0070690_100348126 3300005330 Bacteria 1075
6 Ga0070666_10500623 3300005335 Bacteria 881
7 Ga0070682_100280859 3300005337 Bacteria 1214
8 Ga0068868_100081167 3300005338 Bacteria 2599
9 Ga0070660_100237162 3300005339 Bacteria 1485
10 Ga0070660_100469988 3300005339 Bacteria 1044
11 Ga0070691_10027311 3300005341 Bacteria 2663
12 Ga0070692_10014805 3300005345 Bacteria 3673
13 Ga0070668_100067919 3300005347 Bacteria 2770
14 Ga0070668_100244494 3300005347 Bacteria 1487
15 Ga0070668_100365786 3300005347 Bacteria 1224
16 Ga0070669_100189277 3300005353 Bacteria 1614
17 Ga0070659_100724029 3300005366 Bacteria 861
18 Ga0070703_10005682 3300005406 Bacteria 3490
19 Ga0070714_100023827 3300005435 Bacteria 5034
20 Ga0070714_100062535 3300005435 Bacteria 3200
21 Ga0070710_10046141 3300005437 Bacteria 2425
22 Ga0070705_100022903 3300005440 Bacteria 3345
23 Ga0070700_100030648 3300005441 Bacteria 3217
24 Ga0070694_100145358 3300005444 Bacteria 1726
25 Ga0070678_100169144 3300005456 Bacteria 1778
26 Ga0070707_100006232 3300005468 Bacteria 11102
27 Ga0070698_100001207 3300005471 Bacteria 28694
28 Ga0070699_100155597 3300005518 Bacteria 2023
29 Ga0070697_100012760 3300005536 Bacteria 6581
30 Ga0068853_100048760 3300005539 Bacteria 3638
31 Ga0068853_100972430 3300005539 Bacteria 817
32 Ga0070686_100010405 3300005544 Bacteria 5243
33 Ga0070695_100017086 3300005545 Bacteria 4400
34 Ga0070696_100085123 3300005546 Bacteria 2244
35 Ga0070696_100256355 3300005546 Bacteria 1325
36 Ga0070693_100033245 3300005547 Bacteria 2844
37 Ga0070693_100417781 3300005547 Bacteria 934
38 Ga0070664_100895980 3300005564 Bacteria 832
39 Ga0068854_100057214 3300005578 Bacteria 2812
40 Ga0070702_100035453 3300005615 Bacteria 2756
41 Ga0070702_100153624 3300005615 Bacteria 1480
42 Ga0068852_100147783 3300005616 Bacteria 2182
43 Ga0068859_100143527 3300005617 Bacteria 2461
44 Ga0068866_10007362 3300005718 Bacteria 4608
45 Ga0068866_10033746 3300005718 Bacteria 2486
46 Ga0068861_100045404 3300005719 Bacteria 3308
47 Ga0068861_100278719 3300005719 Bacteria 1439
48 Ga0068870_10128267 3300005840 Bacteria 1470
49 Ga0068863_100582812 3300005841 Unclassified 1106
50 Ga0068858_100693319 3300005842 Bacteria 991
51 Ga0068862_100695402 3300005844 Bacteria 985
52 Ga0081455_10007270 3300005937 Bacteria 11686
53 Ga0081455_10030412 3300005937 Bacteria 4904
54 Ga0081538_10003436 3300005981 Bacteria 14952
55 Ga0081538_10008008 3300005981 Bacteria 9037
56 Ga0081538_10037987 3300005981 Bacteria 3113
57 Ga0081538_10130693 3300005981 Bacteria 1181
58 Ga0081538_10164286 3300005981 Bacteria 980
59 Ga0081540_1006688 3300005983 Bacteria 8339
60 Ga0081539_10001489 3300005985 Bacteria 39599
61 Ga0075432_10074398 3300006058 Bacteria 1224
62 Ga0070712_100201382 3300006175 Bacteria 1564
63 Ga0075367_10163164 3300006178 Bacteria 1386
64 Ga0075428_100107667 3300006844 Bacteria 3038
65 Ga0075430_100032232 3300006846 Bacteria 4449
66 Ga0075431_100295011 3300006847 Bacteria 1639
67 Ga0075433_11058943 3300006852 Bacteria 706
68 Ga0068865_100035947 3300006881 Bacteria 3335
69 Ga0068865_100327781 3300006881 Bacteria 1234
70 Ga0097620_100143521 3300006931 Bacteria 2461
71 Ga0099794_10026245 3300007265 Bacteria 2691
72 Ga0105240_10091935 3300009093 Bacteria 3706
73 Ga0111539_10068187 3300009094 Bacteria 4200
74 Ga0111539_10619630 3300009094 Bacteria 1260
75 Ga0105245_10116917 3300009098 Bacteria 2487
76 Ga0105245_10713220 3300009098 Bacteria 1037
77 Ga0114129_10049372 3300009147 Bacteria 5912
78 Ga0114129_10221306 3300009147 Bacteria 2553
79 Ga0105243_10069589 3300009148 Bacteria 2839
80 Ga0105243_10095023 3300009148 Bacteria 2463
81 Ga0105243_10513942 3300009148 Bacteria 1137
82 Ga0105249_10044852 3300009553 Bacteria 4020
83 Ga0105249_10172835 3300009553 Bacteria 2096
84 Ga0105239_10206077 3300010375 Bacteria 2203
85 Ga0105246_10397965 3300011119 Bacteria 1143
86 Ga0157371_10191367 3300013102 Bacteria 1465
87 Ga0163162_10063630 3300013306 Bacteria 3733
88 Ga0157375_10145385 3300013308 Bacteria 2501
89 Ga0157380_10140210 3300014326 Bacteria 2076
90 Ga0157379_10000630 3300014968 Bacteria 28429
91 Ga0207653_10005184 3300025885 Bacteria 4075
92 Ga0207692_10076645 3300025898 Bacteria 1777
93 Ga0207642_10028157 3300025899 Bacteria 2310
94 Ga0207688_10054590 3300025901 Bacteria 2242
95 Ga0207688_10066743 3300025901 Bacteria 2036
96 Ga0207688_10127955 3300025901 Bacteria 1487
97 Ga0207680_10410618 3300025903 Bacteria 958
98 Ga0207645_10150184 3300025907 Bacteria 1520
99 Ga0207707_10764750 3300025912 Bacteria 807
100 Ga0207693_10218449 3300025915 Bacteria 1498
101 Ga0207660_10598086 3300025917 Bacteria 898
102 Ga0207660_10763658 3300025917 Bacteria 789
103 Ga0207657_10009457 3300025919 Bacteria 9793
104 Ga0207657_10178624 3300025919 Bacteria 1717
105 Ga0207646_10001161 3300025922 Bacteria 33425
106 Ga0207646_10259834 3300025922 Bacteria 1569
107 Ga0207681_10060852 3300025923 Bacteria 2594
108 Ga0207659_10151122 3300025926 Bacteria 1813
109 Ga0207664_10058324 3300025929 Bacteria 3071
110 Ga0207664_10564260 3300025929 Bacteria 1022
111 Ga0207690_10266220 3300025932 Bacteria 1330
112 Ga0207706_10005070 3300025933 Bacteria 12301
113 Ga0207709_10031678 3300025935 Bacteria 3091
114 Ga0207709_10413499 3300025935 Bacteria 1034
115 Ga0207665_10039164 3300025939 Bacteria 3159
116 Ga0207691_10395243 3300025940 Bacteria 1179
117 Ga0207711_10377801 3300025941 Bacteria 1315
118 Ga0207689_10186533 3300025942 Bacteria 1711
119 Ga0207661_10040103 3300025944 Bacteria 3679
120 Ga0207667_10463772 3300025949 Bacteria 1286
121 Ga0207712_10071348 3300025961 Bacteria 2498
122 Ga0207668_10095110 3300025972 Bacteria 2199
123 Ga0207668_10431090 3300025972 Bacteria 1121
124 Ga0207640_10044604 3300025981 Bacteria 2842
125 Ga0207640_10191535 3300025981 Bacteria 1542
126 Ga0207677_10138661 3300026023 Bacteria 1859
127 Ga0207639_10040738 3300026041 Bacteria 3469
128 Ga0207708_10001405 3300026075 Bacteria 18051
129 Ga0207708_10003806 3300026075 Bacteria 11122
130 Ga0207708_10183356 3300026075 Bacteria 1662
131 Ga0207708_10502425 3300026075 Bacteria 1016
132 Ga0207648_10012865 3300026089 Bacteria 7814
133 Ga0207648_10263333 3300026089 Bacteria 1539
134 Ga0207675_100021201 3300026118 Bacteria 6054
135 Ga0207675_100021425 3300026118 Bacteria 6021
136 Ga0207675_100054003 3300026118 Bacteria 3748
137 Ga0207683_10039769 3300026121 Bacteria 4103
138 Ga0207698_10715630 3300026142 Bacteria 997
139 Ga0207698_10854252 3300026142 Bacteria 915
140 Ga0268265_10452920 3300028380 Bacteria 1199
141 Ga0265319_1000006 3300028563 Bacteria 228868
142 Ga0307405_10087155 3300031731 Bacteria 2057
143 Ga0307413_10118283 3300031824 Bacteria 1789
144 Ga0307413_10497199 3300031824 Bacteria 978
145 Ga0307410_10038056 3300031852 Bacteria 3148
146 Ga0307410_10368172 3300031852 Bacteria 1153
147 Ga0307410_10921952 3300031852 Bacteria 749
148 Ga0307406_10023775 3300031901 Bacteria 3651
149 Ga0307406_10032538 3300031901 Bacteria 3185
150 Ga0307407_10041070 3300031903 Bacteria 2584
151 Ga0307409_100002361 3300031995 Bacteria 9817
152 Ga0307409_100032986 3300031995 Bacteria 3762
153 Ga0307409_100089039 3300031995 Bacteria 2522
154 Ga0307416_100020134 3300032002 Bacteria 4752
155 Ga0307416_100807231 3300032002 Bacteria 1034
156 Ga0307414_10511037 3300032004 Bacteria 1065
157 Ga0307411_10708222 3300032005 Bacteria 878
158 Ga0307415_100010152 3300032126 Bacteria 5319
159 Ga0307415_100437520 3300032126 Bacteria 1127
160 Ga0373961_0019183 3300035241 Bacteria 1794
161 Ga0373931_0134441 3300035691 Bacteria 1427
162 Ga0395899_0006949 3300037312 Bacteria 8766
163 Ga0395899_0105324 3300037312 Bacteria 2032
164 Ga0395900_0002485 3300037418 Bacteria 20252
165 Ga0395900_0026154 3300037418 Bacteria 5975
166 Ga0395900_0089576 3300037418 Bacteria 3162
167 Ga0395898_0009813 3300037466 Bacteria 10033
168 Ga0395898_0013840 3300037466 Bacteria 8291
169 Ga0395898_0112582 3300037466 Bacteria 2608
170 Ga0395898_0431434 3300037466 Bacteria 1256
171 Ga0395898_0495637 3300037466 Bacteria 1162
172 Ga0395898_0535530 3300037466 Bacteria 1113
173 Ga0395905_0020168 3300037471 Bacteria 6314
174 Ga0395905_0024552 3300037471 Bacteria 5688
175 Ga0395905_0090173 3300037471 Bacteria 2874
176 Ga0436364_1249082 3300037853 Bacteria 3777
177 Ga0395901_0001878 3300038443 Bacteria 21664
178 Ga0395901_0002002 3300038443 Bacteria 20963
179 Ga0395901_0034355 3300038443 Bacteria 5236
180 Ga0395901_0133842 3300038443 Bacteria 2605
181 Ga0395901_0259942 3300038443 Bacteria 1807
182 Ga0400485_19226 3300038735 Bacteria 11624
183 Ga0400486_29975 3300038742 Bacteria 11815
184 Ga0436365_1298002 3300039437 Bacteria 1296
185 Ga0436363_0556933 3300039450 Bacteria 1028
186 Ga0436362_0197462 3300039453 Bacteria 1224
187 Ga0466959_0271369 3300045049 Bacteria 1166
188 Ga0466958_0060386 3300045836 Bacteria 2308
189 Ga0495584_0178283 3300046491 Bacteria 1080
190 Ga0495594_0158111 3300046499 Bacteria 1288
191 Ga0495596_0044552 3300046500 Bacteria 1746
192 Ga0495608_0296429 3300046511 Bacteria 1002
193 Ga0495616_0108253 3300046513 Bacteria 1294
194 Ga0495659_0107885 3300046664 Bacteria 1085
195 Ga0496100_0577705 3300048903 Bacteria 871
196 Ga0496101_0498823 3300048904 Bacteria 962
197 Ga0496102_0000044 3300048905 Bacteria 187834
198 Ga0496102_0044217 3300048905 Bacteria 4041
199 Ga0496103_0000123 3300048906 Bacteria 83794
200 Ga0496106_0099437 3300048909 Bacteria 2255
201 Ga0496107_0321825 3300048910 Bacteria 1151
202 Ga0496114_0569430 3300048917 Bacteria 1000
203 Ga0496117_0122545 3300048920 Bacteria 1594
204 Ga0496118_0037771 3300048921 Bacteria 3880
205 Ga0496119_0005652 3300048922 Bacteria 11869
206 Ga0496121_0069682 3300048924 Bacteria 2837
207 Ga0496126_0178791 3300048929 Bacteria 1803
208 Ga0501034_0004805 3300049571 Bacteria 14939
209 Ga0501036_0136645 3300049572 Bacteria 2069
210 Ga0501038_0383408 3300049574 Bacteria 1090
211 Ga0501040_0371686 3300049576 Bacteria 1025
212 Ga0501046_0287607 3300049580 Bacteria 1203
213 Ga0501069_0078787 3300049585 Bacteria 1854
214 Ga0501071_0045233 3300049587 Bacteria 3160
215 Ga0501071_0478693 3300049587 Bacteria 954
216 Ga0501072_0027825 3300049588 Bacteria 4411
217 Ga0501075_0088028 3300049591 Bacteria 2354
218 Ga0501075_0118631 3300049591 Bacteria 2012
219 Ga0501076_0817559 3300049592 Bacteria 769
220 Ga0501081_0465972 3300049743 Bacteria 939
221 Ga0501045_0168708 3300049824 Bacteria 1630
222 nmdc:mga06z11_220377_c1 3300050494 Bacteria 1108
223 nmdc:mga05p37_200387_c1 3300050507 Bacteria 2418
224 nmdc:mga05p37_54520_c1 3300050507 Bacteria 4919
225 nmdc:mga09592_180886_c1 3300050508 Bacteria 1824
226 nmdc:mga0qj67_92952_c1 3300050509 Bacteria 2425
227 nmdc:mga0qj67_98715_c1 3300050509 Bacteria 2352
228 nmdc:mga08y16_231686_c1 3300050511 Bacteria 1910
229 nmdc:mga08y16_337725_c1 3300050511 Bacteria 1549
230 nmdc:mga08y16_652445_c1 3300050511 Bacteria 1056
231 nmdc:mga08y16_67411_c1 3300050511 Bacteria 3733
232 nmdc:mga0a205_170381_c1 3300050515 Bacteria 2073
233 Ga0495619_0102609 3300053085 Bacteria 1948
234 Ga0500646_0000834 3300053090 Bacteria 8534
235 Ga0501084_0140672 3300054114 Bacteria 2032
236 Ga0530510_0235565 3300061734 Bacteria 1362

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005335 Ga0070666_10500623 Ga0070666_105006232 154
2 3300005617 Ga0068859_100143527 Ga0068859_1001435273 154
3 3300006931 Ga0097620_100143521 Ga0097620_1001435213 154
4 3300045049 Ga0466959_0271369 Ga0466959_0271369_480_1148 163
5 3300032002 Ga0307416_100807231 Ga0307416_1008072312 166
6 3300006178 Ga0075367_10163164 Ga0075367_101631642 168
7 3300050494 nmdc:mga06z11_220377_c1 nmdc:mga06z11_220377_c1_239_874 168
8 3300005435 Ga0070714_100062535 Ga0070714_1000625352 171
9 3300048909 Ga0496106_0099437 Ga0496106_0099437_21_626 171
10 3300005329 Ga0070683_100278059 Ga0070683_1002780592 173
11 3300050511 nmdc:mga08y16_652445_c1 nmdc:mga08y16_652445_c1_180_794 174
12 3300005330 Ga0070690_100348126 Ga0070690_1003481262 177
13 3300005337 Ga0070682_100280859 Ga0070682_1002808592 177
14 3300005338 Ga0068868_100081167 Ga0068868_1000811674 177
15 3300005339 Ga0070660_100469988 Ga0070660_1004699882 177
16 3300005345 Ga0070692_10014805 Ga0070692_100148055 177
17 3300005347 Ga0070668_100365786 Ga0070668_1003657862 177
18 3300005353 Ga0070669_100189277 Ga0070669_1001892772 177
19 3300005406 Ga0070703_10005682 Ga0070703_100056822 177
20 3300005440 Ga0070705_100022903 Ga0070705_1000229031 177
21 3300005441 Ga0070700_100030648 Ga0070700_1000306482 177
22 3300005444 Ga0070694_100145358 Ga0070694_1001453583 177
23 3300005539 Ga0068853_100048760 Ga0068853_1000487604 177
24 3300005544 Ga0070686_100010405 Ga0070686_1000104054 177
25 3300005545 Ga0070695_100017086 Ga0070695_1000170864 177
26 3300005546 Ga0070696_100256355 Ga0070696_1002563553 177
27 3300005547 Ga0070693_100033245 Ga0070693_1000332453 177
28 3300005578 Ga0068854_100057214 Ga0068854_1000572143 177
29 3300005615 Ga0070702_100035453 Ga0070702_1000354534 177
30 3300005718 Ga0068866_10007362 Ga0068866_100073624 177
31 3300005842 Ga0068858_100693319 Ga0068858_1006933192 177
32 3300005844 Ga0068862_100695402 Ga0068862_1006954021 177
33 3300006881 Ga0068865_100035947 Ga0068865_1000359472 177
34 3300009093 Ga0105240_10091935 Ga0105240_100919355 177
35 3300009148 Ga0105243_10095023 Ga0105243_100950233 177
36 3300009553 Ga0105249_10044852 Ga0105249_100448522 177
37 3300013102 Ga0157371_10191367 Ga0157371_101913673 177
38 3300013308 Ga0157375_10145385 Ga0157375_101453853 177
39 3300025885 Ga0207653_10005184 Ga0207653_100051845 177
40 3300025899 Ga0207642_10028157 Ga0207642_100281573 177
41 3300025903 Ga0207680_10410618 Ga0207680_104106182 177
42 3300025907 Ga0207645_10150184 Ga0207645_101501843 177
43 3300025917 Ga0207660_10598086 Ga0207660_105980861 177
44 3300025919 Ga0207657_10009457 Ga0207657_100094577 177
45 3300025923 Ga0207681_10060852 Ga0207681_100608525 177
46 3300025932 Ga0207690_10266220 Ga0207690_102662202 177
47 3300025933 Ga0207706_10005070 Ga0207706_100050707 177
48 3300025935 Ga0207709_10031678 Ga0207709_100316784 177
49 3300025941 Ga0207711_10377801 Ga0207711_103778012 177
50 3300025949 Ga0207667_10463772 Ga0207667_104637722 177
51 3300025972 Ga0207668_10095110 Ga0207668_100951105 177
52 3300025981 Ga0207640_10044604 Ga0207640_100446043 177
53 3300026041 Ga0207639_10040738 Ga0207639_100407382 177
54 3300026075 Ga0207708_10003806 Ga0207708_100038066 177
55 3300026089 Ga0207648_10012865 Ga0207648_100128657 177
56 3300026118 Ga0207675_100021201 Ga0207675_1000212012 177
57 3300026142 Ga0207698_10854252 Ga0207698_108542521 177
58 3300028380 Ga0268265_10452920 Ga0268265_104529203 177
59 3300037312 Ga0395899_0006949 Ga0395899_0006949_7711_8358 177
60 3300037418 Ga0395900_0002485 Ga0395900_0002485_10719_11366 177
61 3300037466 Ga0395898_0013840 Ga0395898_0013840_6946_7593 177
62 3300037471 Ga0395905_0020168 Ga0395905_0020168_961_1608 177
63 3300038443 Ga0395901_0002002 Ga0395901_0002002_1463_2110 177
64 3300046499 Ga0495594_0158111 Ga0495594_0158111_23_652 177
65 3300046664 Ga0495659_0107885 Ga0495659_0107885_186_815 177
66 3300048904 Ga0496101_0498823 Ga0496101_0498823_70_699 177
67 3300048905 Ga0496102_0044217 Ga0496102_0044217_1349_1978 177
68 3300048910 Ga0496107_0321825 Ga0496107_0321825_240_869 177
69 3300053090 Ga0500646_0000834 Ga0500646_0000834_2410_3039 177
70 3300005981 Ga0081538_10164286 Ga0081538_101642861 178
71 3300005471 Ga0070698_100001207 Ga0070698_1000012072 179
72 3300005518 Ga0070699_100155597 Ga0070699_1001555972 179
73 3300005841 Ga0068863_100582812 Ga0068863_1005828122 179
74 3300006881 Ga0068865_100327781 Ga0068865_1003277812 179
75 3300025922 Ga0207646_10259834 Ga0207646_102598342 179
76 3300037418 Ga0395900_0026154 Ga0395900_0026154_1329_1970 179
77 3300037471 Ga0395905_0090173 Ga0395905_0090173_13_654 179
78 3300038443 Ga0395901_0034355 Ga0395901_0034355_2835_3476 179
79 3300039453 Ga0436362_0197462 Ga0436362_0197462_225_866 179
80 3300005437 Ga0070710_10046141 Ga0070710_100461412 180
81 3300026142 Ga0207698_10715630 Ga0207698_107156302 180
82 3300037466 Ga0395898_0431434 Ga0395898_0431434_490_1125 180
83 3300037853 Ga0436364_1249082 Ga0436364_1249082_1745_2431 180
84 3300005435 Ga0070714_100023827 Ga0070714_1000238272 181
85 3300005937 Ga0081455_10030412 Ga0081455_100304127 181
86 3300025898 Ga0207692_10076645 Ga0207692_100766451 181
87 3300025929 Ga0207664_10058324 Ga0207664_100583244 181
88 3300054114 Ga0501084_0140672 Ga0501084_0140672_972_1574 181
89 3300005983 Ga0081540_1006688 Ga0081540_10066888 182
90 3300006175 Ga0070712_100201382 Ga0070712_1002013823 182
91 3300025915 Ga0207693_10218449 Ga0207693_102184492 182
92 3300025939 Ga0207665_10039164 Ga0207665_100391643 182
93 3300049580 Ga0501046_0287607 Ga0501046_0287607_301_960 182
94 3300026075 Ga0207708_10502425 Ga0207708_105024252 183
95 3300005985 Ga0081539_10001489 Ga0081539_1000148938 184
96 3300038742 Ga0400486_29975 Ga0400486_29975_10857_11492 184
97 3300061734 Ga0530510_0235565 Ga0530510_0235565_504_1148 184
98 3300031852 Ga0307410_10921952 Ga0307410_109219521 185
99 3300032005 Ga0307411_10708222 Ga0307411_107082221 185
100 3300039450 Ga0436363_0556933 Ga0436363_0556933_13_624 185
101 3300049576 Ga0501040_0371686 Ga0501040_0371686_330_938 185
102 3300049587 Ga0501071_0478693 Ga0501071_0478693_15_623 185
103 3300005718 Ga0068866_10033746 Ga0068866_100337462 186
104 3300009094 Ga0111539_10619630 Ga0111539_106196302 186
105 3300026075 Ga0207708_10183356 Ga0207708_101833562 186
106 3300046500 Ga0495596_0044552 Ga0495596_0044552_571_1206 186
107 3300005329 Ga0070683_100205888 Ga0070683_1002058882 187
108 3300005615 Ga0070702_100153624 Ga0070702_1001536241 187
109 3300031731 Ga0307405_10087155 Ga0307405_100871552 187
110 3300031852 Ga0307410_10038056 Ga0307410_100380562 187
111 3300031901 Ga0307406_10023775 Ga0307406_100237753 187
112 3300031995 Ga0307409_100002361 Ga0307409_1000023618 187
113 3300032002 Ga0307416_100020134 Ga0307416_1000201347 187
114 3300037466 Ga0395898_0535530 Ga0395898_0535530_50_685 187
115 3300038735 Ga0400485_19226 Ga0400485_19226_10666_11301 187
116 3300025929 Ga0207664_10564260 Ga0207664_105642602 188
117 3300045836 Ga0466958_0060386 Ga0466958_0060386_130_753 188
118 3300049571 Ga0501034_0004805 Ga0501034_0004805_4297_4935 188
119 3300050508 nmdc:mga09592_180886_c1 nmdc:mga09592_180886_c1_718_1377 188
120 3300005329 Ga0070683_100213430 Ga0070683_1002134302 189
121 3300005339 Ga0070660_100237162 Ga0070660_1002371622 189
122 3300005468 Ga0070707_100006232 Ga0070707_1000062328 189
123 3300005536 Ga0070697_100012760 Ga0070697_1000127605 189
124 3300005539 Ga0068853_100972430 Ga0068853_1009724301 189
125 3300005564 Ga0070664_100895980 Ga0070664_1008959801 189
126 3300005616 Ga0068852_100147783 Ga0068852_1001477834 189
127 3300006058 Ga0075432_10074398 Ga0075432_100743981 189
128 3300007265 Ga0099794_10026245 Ga0099794_100262453 189
129 3300009098 Ga0105245_10713220 Ga0105245_107132202 189
130 3300009148 Ga0105243_10069589 Ga0105243_100695894 189
131 3300025901 Ga0207688_10054590 Ga0207688_100545902 189
132 3300025922 Ga0207646_10001161 Ga0207646_1000116131 189
133 3300025926 Ga0207659_10151122 Ga0207659_101511222 189
134 3300025935 Ga0207709_10413499 Ga0207709_104134992 189
135 3300025942 Ga0207689_10186533 Ga0207689_101865332 189
136 3300026023 Ga0207677_10138661 Ga0207677_101386612 189
137 3300026089 Ga0207648_10263333 Ga0207648_102633332 189
138 3300026121 Ga0207683_10039769 Ga0207683_100397693 189
139 3300005456 Ga0070678_100169144 Ga0070678_1001691442 190
140 3300006852 Ga0075433_11058943 Ga0075433_110589431 190
141 3300009094 Ga0111539_10068187 Ga0111539_100681873 190
142 3300009147 Ga0114129_10221306 Ga0114129_102213063 190
143 3300011119 Ga0105246_10397965 Ga0105246_103979652 190
144 3300014968 Ga0157379_10000630 Ga0157379_1000063024 190
145 3300025919 Ga0207657_10178624 Ga0207657_101786242 190
146 3300025944 Ga0207661_10040103 Ga0207661_100401032 190
147 3300028563 Ga0265319_1000006 Ga0265319_1000006226 190
148 3300035241 Ga0373961_0019183 Ga0373961_0019183_1012_1638 190
149 3300035691 Ga0373931_0134441 Ga0373931_0134441_85_711 190
150 3300038443 Ga0395901_0259942 Ga0395901_0259942_206_844 190
151 3300046491 Ga0495584_0178283 Ga0495584_0178283_443_1069 190
152 3300046513 Ga0495616_0108253 Ga0495616_0108253_583_1209 190
153 3300048905 Ga0496102_0000044 Ga0496102_0000044_57271_57897 190
154 3300048906 Ga0496103_0000123 Ga0496103_0000123_26662_27288 190
155 3300048920 Ga0496117_0122545 Ga0496117_0122545_956_1582 190
156 3300048921 Ga0496118_0037771 Ga0496118_0037771_605_1231 190
157 3300048922 Ga0496119_0005652 Ga0496119_0005652_4954_5580 190
158 3300048924 Ga0496121_0069682 Ga0496121_0069682_316_942 190
159 3300050507 nmdc:mga05p37_200387_c1 nmdc:mga05p37_200387_c1_487_1113 190
160 3300050509 nmdc:mga0qj67_98715_c1 nmdc:mga0qj67_98715_c1_1142_1768 190
161 3300050511 nmdc:mga08y16_67411_c1 nmdc:mga08y16_67411_c1_2501_3127 190
162 3300050515 nmdc:mga0a205_170381_c1 nmdc:mga0a205_170381_c1_1086_1712 190
163 3300005347 Ga0070668_100244494 Ga0070668_1002444942 191
164 3300005719 Ga0068861_100278719 Ga0068861_1002787192 191
165 3300005840 Ga0068870_10128267 Ga0068870_101282673 191
166 3300009148 Ga0105243_10513942 Ga0105243_105139422 191
167 3300014326 Ga0157380_10140210 Ga0157380_101402102 191
168 3300025901 Ga0207688_10127955 Ga0207688_101279552 191
169 3300025912 Ga0207707_10764750 Ga0207707_107647502 191
170 3300025917 Ga0207660_10763658 Ga0207660_107636581 191
171 3300025940 Ga0207691_10395243 Ga0207691_103952432 191
172 3300025972 Ga0207668_10431090 Ga0207668_104310902 191
173 3300026075 Ga0207708_10001405 Ga0207708_100014052 191
174 3300026118 Ga0207675_100054003 Ga0207675_1000540032 191
175 3300031824 Ga0307413_10118283 Ga0307413_101182834 191
176 3300031824 Ga0307413_10497199 Ga0307413_104971991 191
177 3300031852 Ga0307410_10368172 Ga0307410_103681721 191
178 3300031901 Ga0307406_10032538 Ga0307406_100325385 191
179 3300031903 Ga0307407_10041070 Ga0307407_100410705 191
180 3300031995 Ga0307409_100032986 Ga0307409_1000329866 191
181 3300031995 Ga0307409_100089039 Ga0307409_1000890393 191
182 3300032004 Ga0307414_10511037 Ga0307414_105110371 191
183 3300032126 Ga0307415_100010152 Ga0307415_1000101525 191
184 3300032126 Ga0307415_100437520 Ga0307415_1004375202 191
185 3300037466 Ga0395898_0112582 Ga0395898_0112582_613_1323 191
186 3300037466 Ga0395898_0495637 Ga0395898_0495637_194_862 191
187 3300038443 Ga0395901_0133842 Ga0395901_0133842_619_1329 191
188 3300039437 Ga0436365_1298002 Ga0436365_1298002_302_988 191
189 3300046511 Ga0495608_0296429 Ga0495608_0296429_162_848 191
190 3300048903 Ga0496100_0577705 Ga0496100_0577705_228_860 191
191 3300048917 Ga0496114_0569430 Ga0496114_0569430_305_934 191
192 3300048929 Ga0496126_0178791 Ga0496126_0178791_834_1463 191
193 3300049572 Ga0501036_0136645 Ga0501036_0136645_1079_1723 191
194 3300049591 Ga0501075_0088028 Ga0501075_0088028_370_1014 191
195 3300049743 Ga0501081_0465972 Ga0501081_0465972_34_678 191
196 3300049824 Ga0501045_0168708 Ga0501045_0168708_859_1503 191
197 3300050511 nmdc:mga08y16_231686_c1 nmdc:mga08y16_231686_c1_729_1361 191
198 3300053085 Ga0495619_0102609 Ga0495619_0102609_658_1311 191
199 3300005981 Ga0081538_10008008 Ga0081538_100080083 193
200 3300006844 Ga0075428_100107667 Ga0075428_1001076672 193
201 3300006846 Ga0075430_100032232 Ga0075430_1000322327 193
202 3300006847 Ga0075431_100295011 Ga0075431_1002950112 193
203 3300009147 Ga0114129_10049372 Ga0114129_100493727 193
204 3300050507 nmdc:mga05p37_54520_c1 nmdc:mga05p37_54520_c1_3713_4372 193
205 3300050509 nmdc:mga0qj67_92952_c1 nmdc:mga0qj67_92952_c1_1326_1985 193
206 3300050511 nmdc:mga08y16_337725_c1 nmdc:mga08y16_337725_c1_10_690 193
207 3300005547 Ga0070693_100417781 Ga0070693_1004177811 194
208 3300005981 Ga0081538_10003436 Ga0081538_100034363 195
209 3300037312 Ga0395899_0105324 Ga0395899_0105324_793_1470 195
210 3300037418 Ga0395900_0089576 Ga0395900_0089576_1355_2032 195
211 3300037466 Ga0395898_0009813 Ga0395898_0009813_8117_8794 195
212 3300037471 Ga0395905_0024552 Ga0395905_0024552_2626_3303 195
213 3300038443 Ga0395901_0001878 Ga0395901_0001878_19784_20461 195
214 3300005328 Ga0070676_10209524 Ga0070676_102095241 197
215 3300005341 Ga0070691_10027311 Ga0070691_100273113 197
216 3300005347 Ga0070668_100067919 Ga0070668_1000679191 197
217 3300005366 Ga0070659_100724029 Ga0070659_1007240291 197
218 3300005546 Ga0070696_100085123 Ga0070696_1000851232 197
219 3300005719 Ga0068861_100045404 Ga0068861_1000454043 197
220 3300005937 Ga0081455_10007270 Ga0081455_1000727012 197
221 3300005981 Ga0081538_10037987 Ga0081538_100379875 197
222 3300005981 Ga0081538_10130693 Ga0081538_101306932 197
223 3300009098 Ga0105245_10116917 Ga0105245_101169174 197
224 3300009553 Ga0105249_10172835 Ga0105249_101728352 197
225 3300010375 Ga0105239_10206077 Ga0105239_102060772 197
226 3300013306 Ga0163162_10063630 Ga0163162_100636303 197
227 3300025901 Ga0207688_10066743 Ga0207688_100667432 197
228 3300025961 Ga0207712_10071348 Ga0207712_100713482 197
229 3300025981 Ga0207640_10191535 Ga0207640_101915351 197
230 3300026118 Ga0207675_100021425 Ga0207675_1000214252 197
231 3300049574 Ga0501038_0383408 Ga0501038_0383408_43_729 197
232 3300049585 Ga0501069_0078787 Ga0501069_0078787_593_1279 197
233 3300049587 Ga0501071_0045233 Ga0501071_0045233_1955_2641 197
234 3300049588 Ga0501072_0027825 Ga0501072_0027825_570_1256 197
235 3300049591 Ga0501075_0118631 Ga0501075_0118631_1311_1997 197
236 3300049592 Ga0501076_0817559 Ga0501076_0817559_66_752 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14333

DUF4389

Domain of unknown function (DUF4389)

134

208

0.93

Feature Viewer

pLDDT pTM Quality
51.72 0.34 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map