F348378

General Info

Members Datasets Scaffolds Average Seq Length
235 159 470 222

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0116922|Ga0466966_0116922_431_1183
Length 250
Sequence MPRRNGRGRTDVGTDMRIEIWSDVVCPWCYIGKRRLEKALAGFAHRDQVEIVWRSFQLDPSAPTTPVETVAQALGRKYGGGEAAGRDMIDRVEAVAAEEGMVWRHHSSQRVGTIDAHRLLHLALEAGGPALQGALKEALLHAYFVDAENVADHGVLRRIALGAGLDADRVDAVLAGRDFEAEVEADIAQAAAFGATGVPFYVVDRKYGVSGAQPVELFAQVLEKAWSESHPLLETVGGGSDACGPDGCAI

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
68 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
91 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
98 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
99 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
103 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
104 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
141 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
149 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
150 2619618881 Frankia sp. ACN1ag Isolate Unclassified
151 2619619003 Frankia sp. CpI1-P Isolate Nodule
152 2626541554 Frankia sp. AvcI.1 Isolate Nodule
153 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
154 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
155 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
156 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
157 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
158 8054920844 Frankia tisae Agncl-8 Isolate Nodule
159 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.89
Metatranscriptomes 0.43
Isolates 4.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 1.7
Rhizoplane 0.85
Rhizosphere 87.66
Stem 0
Stem Tuber 0
Unclassified 8.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0116922 3300044684 Bacteria 1641
2 SwRhRL2b_contig_692136 2162886007 Bacteria 1860
3 Ga0065704_10071730 3300005289 Bacteria 10072
4 Ga0065704_10339158 3300005289 Bacteria 826
5 Ga0070658_10463324 3300005327 Bacteria 1093
6 Ga0070683_100441002 3300005329 Bacteria 1242
7 Ga0070661_100048012 3300005344 Bacteria 3124
8 Ga0070674_100384682 3300005356 Bacteria 1142
9 Ga0070667_100066960 3300005367 Bacteria 3052
10 Ga0070714_100228668 3300005435 Bacteria 1713
11 Ga0070713_100691774 3300005436 Bacteria 973
12 Ga0070711_100587568 3300005439 Bacteria 928
13 Ga0070678_100884065 3300005456 Unclassified 816
14 Ga0070681_10061874 3300005458 Bacteria 3717
15 Ga0068853_100118876 3300005539 Bacteria 2355
16 Ga0070665_100000062 3300005548 Bacteria 220304
17 Ga0070665_100073787 3300005548 Bacteria 3417
18 Ga0070665_100166627 3300005548 Bacteria 2205
19 Ga0068855_100533198 3300005563 Unclassified 1272
20 Ga0068857_100241861 3300005577 Bacteria 1653
21 Ga0068856_100188787 3300005614 Bacteria 2074
22 Ga0068852_100066772 3300005616 Unclassified 3142
23 Ga0068851_10050884 3300005834 Bacteria 2104
24 Ga0068858_100000001 3300005842 Bacteria 417735
25 Ga0068862_100012315 3300005844 Bacteria 7073
26 Ga0081539_10027093 3300005985 Bacteria 3638
27 Ga0075365_10197074 3300006038 Bacteria 1410
28 Ga0068871_100047710 3300006358 Bacteria 3455
29 Ga0068865_100235484 3300006881 Unclassified 1438
30 Ga0105243_10000008 3300009148 Bacteria 390270
31 Ga0105242_10225901 3300009176 Unclassified 1675
32 Ga0105248_10001617 3300009177 Bacteria 25013
33 Ga0105248_10077172 3300009177 Bacteria 3745
34 Ga0105237_10120743 3300009545 Bacteria 2615
35 Ga0105238_10105472 3300009551 Bacteria 2800
36 Ga0105238_10786549 3300009551 Unclassified 967
37 Ga0105249_10633524 3300009553 Bacteria 1126
38 Ga0105239_10237778 3300010375 Bacteria 2044
39 Ga0157374_10238148 3300013296 Unclassified 1789
40 Ga0163163_10022532 3300014325 Bacteria 5966
41 Ga0157379_10000059 3300014968 Bacteria 69772
42 Ga0157379_10258439 3300014968 Bacteria 1582
43 Ga0213875_10054819 3300021388 Bacteria 1867
44 Ga0207671_10331025 3300025914 Unclassified 1206
45 Ga0207652_10452045 3300025921 Bacteria 1158
46 Ga0207694_10142911 3300025924 Bacteria 1925
47 Ga0207650_10229533 3300025925 Bacteria 1497
48 Ga0207650_10408678 3300025925 Bacteria 1125
49 Ga0207709_10000006 3300025935 Bacteria 800946
50 Ga0207704_10392085 3300025938 Unclassified 1093
51 Ga0207711_10002744 3300025941 Bacteria 15519
52 Ga0207661_10832193 3300025944 Bacteria 850
53 Ga0207679_10034031 3300025945 Unclassified 3592
54 Ga0207667_10151177 3300025949 Unclassified 2389
55 Ga0207667_10449395 3300025949 Bacteria 1310
56 Ga0207667_10801513 3300025949 Bacteria 939
57 Ga0207668_10158240 3300025972 Unclassified 1762
58 Ga0207658_10018783 3300025986 Bacteria 4779
59 Ga0207658_10045064 3300025986 Bacteria 3214
60 Ga0207658_10789836 3300025986 Bacteria 861
61 Ga0207703_10000007 3300026035 Bacteria 418220
62 Ga0207639_10036875 3300026041 Bacteria 3627
63 Ga0207639_10282985 3300026041 Bacteria 1459
64 Ga0207639_10291301 3300026041 Bacteria 1439
65 Ga0207678_10022459 3300026067 Bacteria 5525
66 Ga0207702_10266211 3300026078 Bacteria 1615
67 Ga0207641_10425362 3300026088 Unclassified 1279
68 Ga0207676_10156212 3300026095 Bacteria 1971
69 Ga0207674_10023334 3300026116 Bacteria 6629
70 Ga0207683_10339244 3300026121 Unclassified 1378
71 Ga0268266_10000001 3300028379 Bacteria 4040580
72 Ga0268266_10827867 3300028379 Bacteria 894
73 Ga0268266_10976612 3300028379 Unclassified 819
74 Ga0268266_11093061 3300028379 Bacteria 772
75 Ga0268265_10111851 3300028380 Bacteria 2231
76 Ga0265320_10044088 3300031240 Bacteria 2200
77 Ga0307508_10185112 3300031616 Bacteria 1685
78 Ga0307406_10476887 3300031901 Bacteria 1007
79 Ga0307409_101008936 3300031995 Bacteria 851
80 Ga0307416_100560890 3300032002 Bacteria 1217
81 Ga0307416_100837729 3300032002 Bacteria 1017
82 Ga0307414_10725004 3300032004 Bacteria 902
83 Ga0307415_100591853 3300032126 Bacteria 986
84 Ga0373959_0005593 3300034820 Unclassified 2064
85 Ga0310109_006180 3300036534 Bacteria 1554
86 Ga0436364_0452560 3300037853 Bacteria 2293
87 Ga0395901_0080170 3300038443 Bacteria 3408
88 Ga0436363_1485035 3300039450 Bacteria 1221
89 Ga0439448_0020379 3300042005 Bacteria 2050
90 Ga0451577_0001657 3300042876 Bacteria 28783
91 Ga0466969_0022476 3300044656 Bacteria 3254
92 Ga0466972_0197422 3300044658 Bacteria 943
93 Ga0453683_0001495 3300044673 Bacteria 19992
94 Ga0466966_0002164 3300044684 Bacteria 12750
95 Ga0466966_0104668 3300044684 Bacteria 1747
96 Ga0466966_0257715 3300044684 Bacteria 1050
97 Ga0466966_0418582 3300044684 Unclassified 805
98 Ga0466961_0013930 3300044693 Bacteria 5153
99 Ga0466961_0024267 3300044693 Bacteria 3901
100 Ga0466963_0064310 3300044694 Bacteria 2457
101 Ga0466963_0089935 3300044694 Bacteria 2089
102 Ga0466963_0115088 3300044694 Bacteria 1848
103 Ga0466963_0184032 3300044694 Bacteria 1459
104 Ga0466964_0025354 3300044706 Bacteria 2315
105 Ga0453684_0004595 3300044712 Bacteria 28783
106 Ga0466971_0006794 3300044719 Bacteria 4978
107 Ga0466971_0020694 3300044719 Bacteria 2925
108 Ga0466971_0069450 3300044719 Bacteria 1598
109 Ga0466968_0038113 3300044735 Bacteria 2019
110 Ga0466970_0044892 3300044765 Bacteria 2353
111 Ga0466970_0098150 3300044765 Bacteria 1594
112 Ga0466957_0056149 3300044842 Bacteria 2407
113 Ga0466957_0118270 3300044842 Bacteria 1687
114 Ga0466957_0152619 3300044842 Bacteria 1495
115 Ga0466957_0203812 3300044842 Bacteria 1300
116 Ga0466960_0163325 3300044901 Bacteria 1197
117 Ga0466959_0008167 3300045049 Bacteria 7385
118 Ga0466959_0052651 3300045049 Bacteria 2980
119 Ga0466959_0295203 3300045049 Unclassified 1110
120 Ga0466959_0573147 3300045049 Bacteria 760
121 Ga0451576_0002326 3300045051 Bacteria 28783
122 Ga0466958_0014716 3300045836 Bacteria 4468
123 Ga0466958_0315795 3300045836 Bacteria 1004
124 Ga0466958_0355352 3300045836 Bacteria 944
125 Ga0466967_0366466 3300045976 Bacteria 1397
126 Ga0495641_0048647 3300046461 Bacteria 1944
127 Ga0495648_0004793 3300046524 Bacteria 11436
128 Ga0495609_0085014 3300046538 Bacteria 1380
129 Ga0495622_0098384 3300046557 Bacteria 1342
130 Ga0495611_0004337 3300046648 Bacteria 6151
131 Ga0495625_0000648 3300046660 Bacteria 50041
132 Ga0495613_0199688 3300046689 Bacteria 1410
133 Ga0495670_0002466 3300046691 Bacteria 9130
134 Ga0495672_0177873 3300047320 Bacteria 1080
135 Ga0495687_000136 3300047443 Bacteria 113298
136 Ga0496102_0069073 3300048905 Bacteria 3243
137 Ga0496103_0390046 3300048906 Bacteria 895
138 Ga0496116_0013210 3300048919 Bacteria 6677
139 Ga0496117_0001530 3300048920 Bacteria 33004
140 Ga0496117_0016957 3300048920 Bacteria 6104
141 Ga0496118_0000289 3300048921 Bacteria 87537
142 Ga0496118_0048523 3300048921 Bacteria 3278
143 Ga0496121_0030422 3300048924 Bacteria 4958
144 Ga0496122_0005425 3300048925 Bacteria 15202
145 Ga0496125_0080932 3300048928 Bacteria 2484
146 Ga0496125_0362530 3300048928 Unclassified 861
147 Ga0495678_000216 3300049459 Bacteria 66661
148 Ga0501031_0003371 3300049568 Bacteria 10264
149 Ga0501031_0066672 3300049568 Bacteria 2345
150 Ga0501032_0003214 3300049569 Bacteria 12563
151 Ga0501032_0100223 3300049569 Bacteria 1919
152 Ga0501033_0003357 3300049570 Bacteria 13212
153 Ga0501033_0178924 3300049570 Bacteria 1521
154 Ga0501034_0008537 3300049571 Bacteria 10812
155 Ga0501034_0242103 3300049571 Bacteria 1750
156 Ga0501034_0267490 3300049571 Bacteria 1651
157 Ga0501036_0004913 3300049572 Bacteria 10797
158 Ga0501036_0006121 3300049572 Bacteria 9765
159 Ga0501037_0010219 3300049573 Bacteria 6886
160 Ga0501037_0144577 3300049573 Bacteria 1701
161 Ga0501038_0007686 3300049574 Bacteria 9939
162 Ga0501038_0017458 3300049574 Bacteria 6487
163 Ga0501038_0032052 3300049574 Bacteria 4641
164 Ga0501039_0015324 3300049575 Bacteria 5867
165 Ga0501039_0066065 3300049575 Bacteria 2807
166 Ga0501040_0022124 3300049576 Bacteria 4253
167 Ga0501041_0003771 3300049577 Bacteria 8716
168 Ga0501042_0022455 3300049578 Bacteria 4407
169 Ga0501042_0336901 3300049578 Bacteria 1090
170 Ga0501043_0058990 3300049579 Bacteria 3011
171 Ga0501043_0102478 3300049579 Bacteria 2249
172 Ga0501043_0249558 3300049579 Bacteria 1367
173 Ga0501043_0256366 3300049579 Bacteria 1346
174 Ga0501043_0427060 3300049579 Bacteria 998
175 Ga0501043_0566380 3300049579 Bacteria 842
176 Ga0501046_0000184 3300049580 Bacteria 63497
177 Ga0501046_0007489 3300049580 Bacteria 9585
178 Ga0501046_0009618 3300049580 Bacteria 8337
179 Ga0501047_0053634 3300049581 Bacteria 3900
180 Ga0501047_0412595 3300049581 Bacteria 1182
181 Ga0501047_0611516 3300049581 Bacteria 911
182 Ga0501047_0782717 3300049581 Unclassified 769
183 Ga0501048_0001483 3300049582 Bacteria 17800
184 Ga0501048_0021934 3300049582 Bacteria 4674
185 Ga0501069_0024928 3300049585 Bacteria 3266
186 Ga0501069_0210752 3300049585 Bacteria 1128
187 Ga0501070_0141516 3300049586 Bacteria 1986
188 Ga0501070_0222068 3300049586 Bacteria 1549
189 Ga0501071_0045305 3300049587 Bacteria 3157
190 Ga0501072_0077341 3300049588 Bacteria 2634
191 Ga0501073_0017400 3300049589 Bacteria 5207
192 Ga0501073_0056665 3300049589 Bacteria 2741
193 Ga0501073_0586693 3300049589 Bacteria 770
194 Ga0501074_0031887 3300049590 Bacteria 3819
195 Ga0501074_0255947 3300049590 Bacteria 1245
196 Ga0501075_0028922 3300049591 Bacteria 4095
197 Ga0501076_0126931 3300049592 Bacteria 2067
198 Ga0501077_0024288 3300049593 Bacteria 3849
199 Ga0501079_0044552 3300049741 Bacteria 3423
200 Ga0501080_0224842 3300049742 Bacteria 1717
201 Ga0501080_0316022 3300049742 Bacteria 1415
202 Ga0501080_0541342 3300049742 Bacteria 1038
203 Ga0501080_0745661 3300049742 Bacteria 861
204 Ga0501081_0007734 3300049743 Bacteria 6968
205 Ga0501083_0053578 3300049744 Bacteria 2708
206 Ga0501083_0189988 3300049744 Bacteria 1340
207 Ga0501035_0001566 3300049822 Bacteria 23270
208 Ga0501035_0068881 3300049822 Bacteria 3137
209 Ga0501035_0111842 3300049822 Bacteria 2393
210 Ga0501035_0113826 3300049822 Bacteria 2369
211 Ga0501035_0514463 3300049822 Bacteria 984
212 Ga0501044_0009003 3300049823 Bacteria 10919
213 Ga0501044_0255922 3300049823 Bacteria 1690
214 Ga0501045_0013760 3300049824 Bacteria 5720
215 Ga0500583_0000229 3300053092 Bacteria 20441
216 Ga0500651_0012797 3300053093 Bacteria 5093
217 Ga0500559_0076666 3300053136 Bacteria 1513
218 Ga0500568_0001580 3300053139 Bacteria 14403
219 Ga0500636_0137113 3300053177 Bacteria 1358
220 Ga0501084_0185604 3300054114 Bacteria 1755
221 Ga0501082_0000176 3300060353 Bacteria 55663
222 Ga0466962_0014417 3300061719 Bacteria 3809
223 Ga0466962_0038597 3300061719 Bacteria 2287
224 Ga0530510_0102605 3300061734 Bacteria 2092
225 2579857160 2579778521 Bacteria 7624758
226 2619856894 2619618881 Bacteria 7521104
227 2620353076 2619619003 Bacteria 7619552
228 2626639275 2626541554 Bacteria 7741902
229 2722728761 2721755487 Bacteria 6357185
230 2904784251 2904780799 Bacteria 5840761
231 2919179125 2919177583 Bacteria 5641607
232 3006427520 3006425503 Bacteria 6491253
233 8054920697 8054913762 Bacteria 7713009
234 8054921878 8054920844 Bacteria 7068637
235 8057573991 8057568493 Bacteria 7221719
236 Ga0466966_0116922
237 SwRhRL2b_contig_692136
238 Ga0065704_10071730
239 Ga0065704_10339158
240 Ga0070658_10463324
241 Ga0070683_100441002
242 Ga0070661_100048012
243 Ga0070674_100384682
244 Ga0070667_100066960
245 Ga0070714_100228668
246 Ga0070713_100691774
247 Ga0070711_100587568
248 Ga0070678_100884065
249 Ga0070681_10061874
250 Ga0068853_100118876
251 Ga0070665_100000062
252 Ga0070665_100073787
253 Ga0070665_100166627
254 Ga0068855_100533198
255 Ga0068857_100241861
256 Ga0068856_100188787
257 Ga0068852_100066772
258 Ga0068851_10050884
259 Ga0068858_100000001
260 Ga0068862_100012315
261 Ga0081539_10027093
262 Ga0075365_10197074
263 Ga0068871_100047710
264 Ga0068865_100235484
265 Ga0105243_10000008
266 Ga0105242_10225901
267 Ga0105248_10001617
268 Ga0105248_10077172
269 Ga0105237_10120743
270 Ga0105238_10105472
271 Ga0105238_10786549
272 Ga0105249_10633524
273 Ga0105239_10237778
274 Ga0157374_10238148
275 Ga0163163_10022532
276 Ga0157379_10000059
277 Ga0157379_10258439
278 Ga0213875_10054819
279 Ga0207671_10331025
280 Ga0207652_10452045
281 Ga0207694_10142911
282 Ga0207650_10229533
283 Ga0207650_10408678
284 Ga0207709_10000006
285 Ga0207704_10392085
286 Ga0207711_10002744
287 Ga0207661_10832193
288 Ga0207679_10034031
289 Ga0207667_10151177
290 Ga0207667_10449395
291 Ga0207667_10801513
292 Ga0207668_10158240
293 Ga0207658_10018783
294 Ga0207658_10045064
295 Ga0207658_10789836
296 Ga0207703_10000007
297 Ga0207639_10036875
298 Ga0207639_10282985
299 Ga0207639_10291301
300 Ga0207678_10022459
301 Ga0207702_10266211
302 Ga0207641_10425362
303 Ga0207676_10156212
304 Ga0207674_10023334
305 Ga0207683_10339244
306 Ga0268266_10000001
307 Ga0268266_10827867
308 Ga0268266_10976612
309 Ga0268266_11093061
310 Ga0268265_10111851
311 Ga0265320_10044088
312 Ga0307508_10185112
313 Ga0307406_10476887
314 Ga0307409_101008936
315 Ga0307416_100560890
316 Ga0307416_100837729
317 Ga0307414_10725004
318 Ga0307415_100591853
319 Ga0373959_0005593
320 Ga0310109_006180
321 Ga0436364_0452560
322 Ga0395901_0080170
323 Ga0436363_1485035
324 Ga0439448_0020379
325 Ga0451577_0001657
326 Ga0466969_0022476
327 Ga0466972_0197422
328 Ga0453683_0001495
329 Ga0466966_0002164
330 Ga0466966_0104668
331 Ga0466966_0257715
332 Ga0466966_0418582
333 Ga0466961_0013930
334 Ga0466961_0024267
335 Ga0466963_0064310
336 Ga0466963_0089935
337 Ga0466963_0115088
338 Ga0466963_0184032
339 Ga0466964_0025354
340 Ga0453684_0004595
341 Ga0466971_0006794
342 Ga0466971_0020694
343 Ga0466971_0069450
344 Ga0466968_0038113
345 Ga0466970_0044892
346 Ga0466970_0098150
347 Ga0466957_0056149
348 Ga0466957_0118270
349 Ga0466957_0152619
350 Ga0466957_0203812
351 Ga0466960_0163325
352 Ga0466959_0008167
353 Ga0466959_0052651
354 Ga0466959_0295203
355 Ga0466959_0573147
356 Ga0451576_0002326
357 Ga0466958_0014716
358 Ga0466958_0315795
359 Ga0466958_0355352
360 Ga0466967_0366466
361 Ga0495641_0048647
362 Ga0495648_0004793
363 Ga0495609_0085014
364 Ga0495622_0098384
365 Ga0495611_0004337
366 Ga0495625_0000648
367 Ga0495613_0199688
368 Ga0495670_0002466
369 Ga0495672_0177873
370 Ga0495687_000136
371 Ga0496102_0069073
372 Ga0496103_0390046
373 Ga0496116_0013210
374 Ga0496117_0001530
375 Ga0496117_0016957
376 Ga0496118_0000289
377 Ga0496118_0048523
378 Ga0496121_0030422
379 Ga0496122_0005425
380 Ga0496125_0080932
381 Ga0496125_0362530
382 Ga0495678_000216
383 Ga0501031_0003371
384 Ga0501031_0066672
385 Ga0501032_0003214
386 Ga0501032_0100223
387 Ga0501033_0003357
388 Ga0501033_0178924
389 Ga0501034_0008537
390 Ga0501034_0242103
391 Ga0501034_0267490
392 Ga0501036_0004913
393 Ga0501036_0006121
394 Ga0501037_0010219
395 Ga0501037_0144577
396 Ga0501038_0007686
397 Ga0501038_0017458
398 Ga0501038_0032052
399 Ga0501039_0015324
400 Ga0501039_0066065
401 Ga0501040_0022124
402 Ga0501041_0003771
403 Ga0501042_0022455
404 Ga0501042_0336901
405 Ga0501043_0058990
406 Ga0501043_0102478
407 Ga0501043_0249558
408 Ga0501043_0256366
409 Ga0501043_0427060
410 Ga0501043_0566380
411 Ga0501046_0000184
412 Ga0501046_0007489
413 Ga0501046_0009618
414 Ga0501047_0053634
415 Ga0501047_0412595
416 Ga0501047_0611516
417 Ga0501047_0782717
418 Ga0501048_0001483
419 Ga0501048_0021934
420 Ga0501069_0024928
421 Ga0501069_0210752
422 Ga0501070_0141516
423 Ga0501070_0222068
424 Ga0501071_0045305
425 Ga0501072_0077341
426 Ga0501073_0017400
427 Ga0501073_0056665
428 Ga0501073_0586693
429 Ga0501074_0031887
430 Ga0501074_0255947
431 Ga0501075_0028922
432 Ga0501076_0126931
433 Ga0501077_0024288
434 Ga0501079_0044552
435 Ga0501080_0224842
436 Ga0501080_0316022
437 Ga0501080_0541342
438 Ga0501080_0745661
439 Ga0501081_0007734
440 Ga0501083_0053578
441 Ga0501083_0189988
442 Ga0501035_0001566
443 Ga0501035_0068881
444 Ga0501035_0111842
445 Ga0501035_0113826
446 Ga0501035_0514463
447 Ga0501044_0009003
448 Ga0501044_0255922
449 Ga0501045_0013760
450 Ga0500583_0000229
451 Ga0500651_0012797
452 Ga0500559_0076666
453 Ga0500568_0001580
454 Ga0500636_0137113
455 Ga0501084_0185604
456 Ga0501082_0000176
457 Ga0466962_0014417
458 Ga0466962_0038597
459 Ga0530510_0102605
460 2579857160
461 2619856894
462 2620353076
463 2626639275
464 2722728761
465 2904784251
466 2919179125
467 3006427520
468 8054920697
469 8054921878
470 8057573991

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

17

223

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xwh-assembly1.cif.gz_A structure of frne, a novel disulfide oxidoreductase from deinococcus radiodurans crystallized in the presence of gsh 0.9336 2 221
5cnw-assembly1.cif.gz_A crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans 0.9197 2 225
5xwh-assembly1.cif.gz_A structure of frne, a novel disulfide oxidoreductase from deinococcus radiodurans crystallized in the presence of gsh 0.898 2 221
5cnw-assembly1.cif.gz_A crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans 0.8964 2 225
3gl5-assembly1.cif.gz_A-2 crystal structure of probable dsba oxidoreductase sco1869 from streptomyces coelicolor 0.8812 1 234
ID Description Score Start End Superfamily
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9641 2 207 3.40.30.10
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9417 2 207 3.40.30.10
3gl5A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9366 1 208 3.40.30.10
af_I1KWJ3_9_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9351 2 207 3.40.30.10
3gl5A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9279 1 208 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A849HKY8-F1-model_v4 DsbA family oxidoreductase 0.9803 1 207 GO:0016491
AF-A0A807MWA2-F1-model_v4 deleted 0.9763 2 214
AF-A0A6G7XB66-F1-model_v4 DsbA family oxidoreductase 0.9759 1 210 GO:0016491
AF-A0A2W4YLP5-F1-model_v4 deleted 0.9759 2 211
AF-A0A662Z4T3-F1-model_v4 Predicted dithiol-disulfide isomerase, DsbA family 0.9752 1 212 GO:0016491
GO:0016853

Map