F348283

General Info

Members Datasets Scaffolds Average Seq Length
235 149 470 143

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101615984|Ga0307416_1016159842
Length 173
Sequence VNQFNGRVYQIKKWQPSFKGIALRTPNIYMNVKEQIDDYITGQPEPKRSELEKLHRTILKIDPKCKLWFLDGKNSEGRVVSNPNIGYGSYTIKYADGTFREFYQIGLSANKTGISVYILGIEDKKYLAETYGKDLGKASVTGYCIRFKTLRDINTDVLKAAIEFGFENTNEKG

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025227 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
137 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
138 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
147 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
148 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 0
Rhizosphere 97.45
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_101615984 3300032002 Bacteria 753
2 rootH1_10041975 3300003323 Bacteria 5953
3 Ga0065712_10014762 3300005290 Bacteria 1763
4 Ga0065715_10237947 3300005293 Bacteria 1209
5 Ga0065715_10418759 3300005293 Bacteria 859
6 Ga0065707_10104700 3300005295 Bacteria 2683
7 Ga0070658_10973722 3300005327 Bacteria 738
8 Ga0070658_11096315 3300005327 Bacteria 692
9 Ga0070670_100493035 3300005331 Bacteria 1089
10 Ga0070670_101241045 3300005331 Bacteria 682
11 Ga0068869_100078404 3300005334 Bacteria 2460
12 Ga0068869_100285849 3300005334 Bacteria 1327
13 Ga0070680_100101870 3300005336 Bacteria 2384
14 Ga0070660_100299526 3300005339 Bacteria 1318
15 Ga0070660_100390329 3300005339 Bacteria 1150
16 Ga0070689_100098511 3300005340 Bacteria 2312
17 Ga0070661_100756135 3300005344 Bacteria 795
18 Ga0070669_100005362 3300005353 Bacteria 9252
19 Ga0070669_101512104 3300005353 Bacteria 584
20 Ga0070675_100155735 3300005354 Bacteria 1962
21 Ga0070675_100215735 3300005354 Bacteria 1669
22 Ga0070675_101183424 3300005354 Bacteria 704
23 Ga0070671_100191438 3300005355 Bacteria 1734
24 Ga0070671_100407998 3300005355 Bacteria 1163
25 Ga0070674_100149336 3300005356 Bacteria 1762
26 Ga0070667_100120252 3300005367 Bacteria 2284
27 Ga0070714_100949259 3300005435 Bacteria 836
28 Ga0070711_101272590 3300005439 Bacteria 638
29 Ga0070705_100151336 3300005440 Bacteria 1539
30 Ga0070705_100183221 3300005440 Bacteria 1420
31 Ga0070705_100196400 3300005440 Bacteria 1379
32 Ga0070700_100970740 3300005441 Bacteria 696
33 Ga0070694_101103526 3300005444 Bacteria 662
34 Ga0070662_100305389 3300005457 Bacteria 1294
35 Ga0070662_101189652 3300005457 Bacteria 655
36 Ga0070681_10097488 3300005458 Bacteria 2887
37 Ga0070681_10731069 3300005458 Bacteria 906
38 Ga0070685_11241371 3300005466 Bacteria 568
39 Ga0070706_100325463 3300005467 Bacteria 1433
40 Ga0070698_100056361 3300005471 Bacteria 3983
41 Ga0070698_100779704 3300005471 Bacteria 900
42 Ga0070699_100020952 3300005518 Bacteria 5636
43 Ga0070699_100259362 3300005518 Bacteria 1554
44 Ga0070699_100342679 3300005518 Bacteria 1345
45 Ga0070679_100005903 3300005530 Bacteria 11376
46 Ga0070679_100118268 3300005530 Bacteria 2635
47 Ga0070679_100248661 3300005530 Bacteria 1734
48 Ga0068853_100360398 3300005539 Bacteria 1354
49 Ga0070686_100155243 3300005544 Bacteria 1606
50 Ga0070696_100650309 3300005546 Bacteria 855
51 Ga0070704_100293607 3300005549 Bacteria 1351
52 Ga0070664_100050051 3300005564 Bacteria 3535
53 Ga0070664_100276077 3300005564 Bacteria 1515
54 Ga0070664_100483244 3300005564 Bacteria 1140
55 Ga0070664_101615813 3300005564 Bacteria 614
56 Ga0068854_100089126 3300005578 Bacteria 2292
57 Ga0068854_101043921 3300005578 Bacteria 726
58 Ga0068856_102046143 3300005614 Bacteria 583
59 Ga0068852_100300579 3300005616 Bacteria 1553
60 Ga0068852_100574493 3300005616 Bacteria 1130
61 Ga0068859_100211359 3300005617 Bacteria 2026
62 Ga0068859_100437725 3300005617 Bacteria 1404
63 Ga0068859_101305666 3300005617 Bacteria 800
64 Ga0068864_100030518 3300005618 Bacteria 4569
65 Ga0068864_100558740 3300005618 Bacteria 1107
66 Ga0068866_10748637 3300005718 Bacteria 675
67 Ga0068861_100046022 3300005719 Bacteria 3288
68 Ga0068861_100063511 3300005719 Bacteria 2838
69 Ga0068861_100276354 3300005719 Bacteria 1444
70 Ga0068870_10082373 3300005840 Bacteria 1781
71 Ga0068863_100036888 3300005841 Bacteria 4655
72 Ga0068863_100722637 3300005841 Bacteria 991
73 Ga0068858_100093772 3300005842 Bacteria 2795
74 Ga0068858_100516835 3300005842 Bacteria 1154
75 Ga0068860_100647202 3300005843 Bacteria 1065
76 Ga0068862_100103993 3300005844 Bacteria 2487
77 Ga0070715_10230299 3300006163 Bacteria 958
78 Ga0097621_100003491 3300006237 Bacteria 10844
79 Ga0068871_100022816 3300006358 Bacteria 4831
80 Ga0068871_100546620 3300006358 Bacteria 1048
81 Ga0075428_100670524 3300006844 Bacteria 1105
82 Ga0075433_10498055 3300006852 Bacteria 1072
83 Ga0075429_100259696 3300006880 Bacteria 1521
84 Ga0097620_100211364 3300006931 Bacteria 2026
85 Ga0097620_100437725 3300006931 Bacteria 1404
86 Ga0097620_101305653 3300006931 Bacteria 800
87 Ga0099795_10325655 3300007788 Bacteria 682
88 Ga0105243_10000412 3300009148 Bacteria 44922
89 Ga0105242_10002992 3300009176 Bacteria 13225
90 Ga0105242_10012637 3300009176 Bacteria 6501
91 Ga0105248_10052186 3300009177 Bacteria 4589
92 Ga0105248_10232801 3300009177 Bacteria 2074
93 Ga0105237_11816267 3300009545 Bacteria 617
94 Ga0105249_10056378 3300009553 Bacteria 3597
95 Ga0105249_10064637 3300009553 Bacteria 3364
96 Ga0105249_10274852 3300009553 Bacteria 1680
97 Ga0105249_10728197 3300009553 Bacteria 1053
98 Ga0157373_10104273 3300013100 Bacteria 1994
99 Ga0157373_10821364 3300013100 Unclassified 686
100 Ga0157373_10864545 3300013100 Bacteria 669
101 Ga0157371_10038161 3300013102 Bacteria 3437
102 Ga0157371_10193502 3300013102 Bacteria 1457
103 Ga0157369_10219844 3300013105 Bacteria 1989
104 Ga0157369_10323846 3300013105 Bacteria 1602
105 Ga0157369_10703203 3300013105 Bacteria 1041
106 Ga0157374_10206833 3300013296 Bacteria 1923
107 Ga0157374_10587352 3300013296 Bacteria 1123
108 Ga0157374_10976184 3300013296 Bacteria 866
109 Ga0157378_10080554 3300013297 Bacteria 2942
110 Ga0157378_10103056 3300013297 Bacteria 2607
111 Ga0157378_10678614 3300013297 Bacteria 1048
112 Ga0163162_10025992 3300013306 Bacteria 5786
113 Ga0163162_10042639 3300013306 Bacteria 4543
114 Ga0163162_10231655 3300013306 Bacteria 1977
115 Ga0157372_10389812 3300013307 Bacteria 1623
116 Ga0157372_10454170 3300013307 Bacteria 1493
117 Ga0157375_10110263 3300013308 Bacteria 2849
118 Ga0157375_10449409 3300013308 Bacteria 1454
119 Ga0157375_11033669 3300013308 Bacteria 960
120 Ga0157375_12193847 3300013308 Bacteria 658
121 Ga0163163_10078583 3300014325 Bacteria 3296
122 Ga0163163_10109560 3300014325 Bacteria 2789
123 Ga0163163_10114007 3300014325 Bacteria 2733
124 Ga0163163_10413827 3300014325 Bacteria 1407
125 Ga0157380_10021559 3300014326 Bacteria 4834
126 Ga0157377_10089810 3300014745 Bacteria 1812
127 Ga0157377_10202160 3300014745 Bacteria 1262
128 Ga0182006_1000003 3300015261 Bacteria 826681
129 Ga0163161_10035730 3300017792 Bacteria 3557
130 Ga0163161_10701857 3300017792 Bacteria 842
131 Ga0163161_10903489 3300017792 Bacteria 748
132 Ga0163161_11215029 3300017792 Bacteria 652
133 Ga0207638_1006432 3300025227 Bacteria 527
134 Ga0207666_1006225 3300025271 Bacteria 1543
135 Ga0207697_10173419 3300025315 Bacteria 944
136 Ga0207647_10010251 3300025904 Bacteria 6621
137 Ga0207647_10371614 3300025904 Bacteria 808
138 Ga0207647_10770878 3300025904 Bacteria 519
139 Ga0207705_10113566 3300025909 Bacteria 2003
140 Ga0207684_10203775 3300025910 Bacteria 1707
141 Ga0207660_10086387 3300025917 Bacteria 2316
142 Ga0207657_10035221 3300025919 Bacteria 4491
143 Ga0207649_10907958 3300025920 Bacteria 691
144 Ga0207652_10125897 3300025921 Bacteria 2282
145 Ga0207652_10443675 3300025921 Bacteria 1170
146 Ga0207681_11560547 3300025923 Bacteria 553
147 Ga0207664_10403035 3300025929 Bacteria 1217
148 Ga0207644_10026968 3300025931 Bacteria 3966
149 Ga0207644_10059148 3300025931 Bacteria 2771
150 Ga0207706_10639029 3300025933 Bacteria 912
151 Ga0207706_11250883 3300025933 Bacteria 615
152 Ga0207686_10000011 3300025934 Bacteria 216046
153 Ga0207686_10000383 3300025934 Bacteria 30902
154 Ga0207686_10025988 3300025934 Bacteria 3413
155 Ga0207709_10000041 3300025935 Bacteria 258279
156 Ga0207670_10064638 3300025936 Bacteria 2508
157 Ga0207669_10266442 3300025937 Bacteria 1284
158 Ga0207704_10122997 3300025938 Bacteria 1780
159 Ga0207711_10021424 3300025941 Bacteria 5400
160 Ga0207711_10091025 3300025941 Bacteria 2683
161 Ga0207689_10041467 3300025942 Bacteria 3809
162 Ga0207689_10070306 3300025942 Bacteria 2875
163 Ga0207661_10836073 3300025944 Bacteria 848
164 Ga0207679_10026050 3300025945 Bacteria 4029
165 Ga0207679_10034608 3300025945 Bacteria 3566
166 Ga0207651_10136571 3300025960 Bacteria 1887
167 Ga0207651_11019110 3300025960 Bacteria 740
168 Ga0207712_10014539 3300025961 Bacteria 5067
169 Ga0207640_10066292 3300025981 Bacteria 2412
170 Ga0207658_10109050 3300025986 Bacteria 2185
171 Ga0207677_10096156 3300026023 Bacteria 2166
172 Ga0207677_10119688 3300026023 Bacteria 1978
173 Ga0207703_10342017 3300026035 Bacteria 1375
174 Ga0207639_10373468 3300026041 Bacteria 1279
175 Ga0207639_11660097 3300026041 Bacteria 599
176 Ga0207678_10833342 3300026067 Bacteria 815
177 Ga0207708_10271822 3300026075 Bacteria 1371
178 Ga0207702_11131461 3300026078 Bacteria 777
179 Ga0207641_10256517 3300026088 Bacteria 1635
180 Ga0207641_10747872 3300026088 Bacteria 965
181 Ga0207676_10103244 3300026095 Bacteria 2368
182 Ga0207676_10263575 3300026095 Bacteria 1557
183 Ga0207676_10370353 3300026095 Bacteria 1330
184 Ga0207675_100003862 3300026118 Bacteria 14565
185 Ga0207675_100060847 3300026118 Bacteria 3526
186 Ga0207683_10037470 3300026121 Bacteria 4222
187 Ga0207698_10228833 3300026142 Bacteria 1686
188 Ga0207428_10480041 3300027907 Bacteria 904
189 Ga0265357_1029313 3300028023 Bacteria 625
190 Ga0268265_10154974 3300028380 Bacteria 1937
191 Ga0268265_10637308 3300028380 Bacteria 1023
192 Ga0268264_10592456 3300028381 Bacteria 1092
193 Ga0265760_10002410 3300031090 Bacteria 5461
194 Ga0307408_100547032 3300031548 Bacteria 1021
195 Ga0307516_10085432 3300031730 Bacteria 2993
196 Ga0307410_10030042 3300031852 Bacteria 3468
197 Ga0307410_10260523 3300031852 Bacteria 1352
198 Ga0307407_10002448 3300031903 Bacteria 7269
199 Ga0307409_100053952 3300031995 Bacteria 3092
200 Ga0307409_100200113 3300031995 Bacteria 1786
201 Ga0307416_100346344 3300032002 Bacteria 1501
202 Ga0307411_11005265 3300032005 Bacteria 747
203 Ga0307415_100295950 3300032126 Bacteria 1338
204 Ga0307415_100440813 3300032126 Bacteria 1123
205 Ga0307510_10000365 3300033180 Bacteria 42827
206 Ga0373951_0006494 3300035091 Bacteria 2675
207 Ga0395898_0468005 3300037466 Bacteria 1200
208 Ga0451849_1338078 3300041505 Unclassified 636
209 Ga0466966_0800527 3300044684 Bacteria 568
210 Ga0453684_0179234 3300044712 Bacteria 2489
211 Ga0453684_0306977 3300044712 Bacteria 1802
212 Ga0453684_0818898 3300044712 Bacteria 1003
213 Ga0466970_0074465 3300044765 Bacteria 1828
214 Ga0466959_0053429 3300045049 Bacteria 2953
215 Ga0451576_0201340 3300045051 Bacteria 2080
216 Ga0495580_0375619 3300046472 Bacteria 961
217 Ga0495584_0153549 3300046491 Bacteria 1170
218 Ga0495616_0370431 3300046513 Bacteria 593
219 Ga0495621_0150957 3300046539 Bacteria 914
220 Ga0501259_011688 3300049688 Unclassified 1456
221 Ga0501225_0048041 3300049705 Bacteria 1185
222 Ga0501241_176337 3300049758 Bacteria 505
223 Ga0501044_0070801 3300049823 Bacteria 3547
224 nmdc:mga05p37_1077299_c1 3300050507 Bacteria 844
225 nmdc:mga09592_177318_c1 3300050508 Bacteria 1843
226 nmdc:mga08y16_335025_c1 3300050511 Bacteria 1556
227 nmdc:mga08y16_56566_c1 3300050511 Bacteria 4098
228 nmdc:mga0n895_557588_c1 3300050512 Bacteria 1151
229 nmdc:mga0n895_892629_c1 3300050512 Bacteria 875
230 nmdc:mga0rr50_973959_c1 3300050513 Bacteria 723
231 nmdc:mga0a205_185250_c1 3300050515 Bacteria 1975
232 Ga0495655_0011057 3300053083 Bacteria 1802
233 Ga0500577_0017810 3300053142 Bacteria 2271
234 Ga0500622_0044336 3300053156 Bacteria 2305
235 Ga0466962_0207464 3300061719 Bacteria 958
236 Ga0307416_101615984
237 rootH1_10041975
238 Ga0065712_10014762
239 Ga0065715_10237947
240 Ga0065715_10418759
241 Ga0065707_10104700
242 Ga0070658_10973722
243 Ga0070658_11096315
244 Ga0070670_100493035
245 Ga0070670_101241045
246 Ga0068869_100078404
247 Ga0068869_100285849
248 Ga0070680_100101870
249 Ga0070660_100299526
250 Ga0070660_100390329
251 Ga0070689_100098511
252 Ga0070661_100756135
253 Ga0070669_100005362
254 Ga0070669_101512104
255 Ga0070675_100155735
256 Ga0070675_100215735
257 Ga0070675_101183424
258 Ga0070671_100191438
259 Ga0070671_100407998
260 Ga0070674_100149336
261 Ga0070667_100120252
262 Ga0070714_100949259
263 Ga0070711_101272590
264 Ga0070705_100151336
265 Ga0070705_100183221
266 Ga0070705_100196400
267 Ga0070700_100970740
268 Ga0070694_101103526
269 Ga0070662_100305389
270 Ga0070662_101189652
271 Ga0070681_10097488
272 Ga0070681_10731069
273 Ga0070685_11241371
274 Ga0070706_100325463
275 Ga0070698_100056361
276 Ga0070698_100779704
277 Ga0070699_100020952
278 Ga0070699_100259362
279 Ga0070699_100342679
280 Ga0070679_100005903
281 Ga0070679_100118268
282 Ga0070679_100248661
283 Ga0068853_100360398
284 Ga0070686_100155243
285 Ga0070696_100650309
286 Ga0070704_100293607
287 Ga0070664_100050051
288 Ga0070664_100276077
289 Ga0070664_100483244
290 Ga0070664_101615813
291 Ga0068854_100089126
292 Ga0068854_101043921
293 Ga0068856_102046143
294 Ga0068852_100300579
295 Ga0068852_100574493
296 Ga0068859_100211359
297 Ga0068859_100437725
298 Ga0068859_101305666
299 Ga0068864_100030518
300 Ga0068864_100558740
301 Ga0068866_10748637
302 Ga0068861_100046022
303 Ga0068861_100063511
304 Ga0068861_100276354
305 Ga0068870_10082373
306 Ga0068863_100036888
307 Ga0068863_100722637
308 Ga0068858_100093772
309 Ga0068858_100516835
310 Ga0068860_100647202
311 Ga0068862_100103993
312 Ga0070715_10230299
313 Ga0097621_100003491
314 Ga0068871_100022816
315 Ga0068871_100546620
316 Ga0075428_100670524
317 Ga0075433_10498055
318 Ga0075429_100259696
319 Ga0097620_100211364
320 Ga0097620_100437725
321 Ga0097620_101305653
322 Ga0099795_10325655
323 Ga0105243_10000412
324 Ga0105242_10002992
325 Ga0105242_10012637
326 Ga0105248_10052186
327 Ga0105248_10232801
328 Ga0105237_11816267
329 Ga0105249_10056378
330 Ga0105249_10064637
331 Ga0105249_10274852
332 Ga0105249_10728197
333 Ga0157373_10104273
334 Ga0157373_10821364
335 Ga0157373_10864545
336 Ga0157371_10038161
337 Ga0157371_10193502
338 Ga0157369_10219844
339 Ga0157369_10323846
340 Ga0157369_10703203
341 Ga0157374_10206833
342 Ga0157374_10587352
343 Ga0157374_10976184
344 Ga0157378_10080554
345 Ga0157378_10103056
346 Ga0157378_10678614
347 Ga0163162_10025992
348 Ga0163162_10042639
349 Ga0163162_10231655
350 Ga0157372_10389812
351 Ga0157372_10454170
352 Ga0157375_10110263
353 Ga0157375_10449409
354 Ga0157375_11033669
355 Ga0157375_12193847
356 Ga0163163_10078583
357 Ga0163163_10109560
358 Ga0163163_10114007
359 Ga0163163_10413827
360 Ga0157380_10021559
361 Ga0157377_10089810
362 Ga0157377_10202160
363 Ga0182006_1000003
364 Ga0163161_10035730
365 Ga0163161_10701857
366 Ga0163161_10903489
367 Ga0163161_11215029
368 Ga0207638_1006432
369 Ga0207666_1006225
370 Ga0207697_10173419
371 Ga0207647_10010251
372 Ga0207647_10371614
373 Ga0207647_10770878
374 Ga0207705_10113566
375 Ga0207684_10203775
376 Ga0207660_10086387
377 Ga0207657_10035221
378 Ga0207649_10907958
379 Ga0207652_10125897
380 Ga0207652_10443675
381 Ga0207681_11560547
382 Ga0207664_10403035
383 Ga0207644_10026968
384 Ga0207644_10059148
385 Ga0207706_10639029
386 Ga0207706_11250883
387 Ga0207686_10000011
388 Ga0207686_10000383
389 Ga0207686_10025988
390 Ga0207709_10000041
391 Ga0207670_10064638
392 Ga0207669_10266442
393 Ga0207704_10122997
394 Ga0207711_10021424
395 Ga0207711_10091025
396 Ga0207689_10041467
397 Ga0207689_10070306
398 Ga0207661_10836073
399 Ga0207679_10026050
400 Ga0207679_10034608
401 Ga0207651_10136571
402 Ga0207651_11019110
403 Ga0207712_10014539
404 Ga0207640_10066292
405 Ga0207658_10109050
406 Ga0207677_10096156
407 Ga0207677_10119688
408 Ga0207703_10342017
409 Ga0207639_10373468
410 Ga0207639_11660097
411 Ga0207678_10833342
412 Ga0207708_10271822
413 Ga0207702_11131461
414 Ga0207641_10256517
415 Ga0207641_10747872
416 Ga0207676_10103244
417 Ga0207676_10263575
418 Ga0207676_10370353
419 Ga0207675_100003862
420 Ga0207675_100060847
421 Ga0207683_10037470
422 Ga0207698_10228833
423 Ga0207428_10480041
424 Ga0265357_1029313
425 Ga0268265_10154974
426 Ga0268265_10637308
427 Ga0268264_10592456
428 Ga0265760_10002410
429 Ga0307408_100547032
430 Ga0307516_10085432
431 Ga0307410_10030042
432 Ga0307410_10260523
433 Ga0307407_10002448
434 Ga0307409_100053952
435 Ga0307409_100200113
436 Ga0307416_100346344
437 Ga0307411_11005265
438 Ga0307415_100295950
439 Ga0307415_100440813
440 Ga0307510_10000365
441 Ga0373951_0006494
442 Ga0395898_0468005
443 Ga0451849_1338078
444 Ga0466966_0800527
445 Ga0453684_0179234
446 Ga0453684_0306977
447 Ga0453684_0818898
448 Ga0466970_0074465
449 Ga0466959_0053429
450 Ga0451576_0201340
451 Ga0495580_0375619
452 Ga0495584_0153549
453 Ga0495616_0370431
454 Ga0495621_0150957
455 Ga0501259_011688
456 Ga0501225_0048041
457 Ga0501241_176337
458 Ga0501044_0070801
459 nmdc:mga05p37_1077299_c1
460 nmdc:mga09592_177318_c1
461 nmdc:mga08y16_335025_c1
462 nmdc:mga08y16_56566_c1
463 nmdc:mga0n895_557588_c1
464 nmdc:mga0n895_892629_c1
465 nmdc:mga0rr50_973959_c1
466 nmdc:mga0a205_185250_c1
467 Ga0495655_0011057
468 Ga0500577_0017810
469 Ga0500622_0044336
470 Ga0466962_0207464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

47

165

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.743 19 154
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7232 17 155
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6974 17 155
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6693 19 154
1dj3-assembly1.cif.gz_B structures of adenylosuccinate synthetase from triticum aestivum and arabidopsis thaliana 0.6509 71 88
ID Description Score Start End Superfamily
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7302 19 155 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.708 19 155 3.90.1150.200
af_A0A0P0V657_185_381_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6058 72 93 3.30.420.10
af_Q54J48_8_246_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.5817 65 93 3.40.50.880
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.567 35 154 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A4Q3UIT9-F1-model_v4 DUF1801 domain-containing protein 0.994 13 150
AF-A0A257H5R8-F1-model_v4 YdhG-like domain-containing protein 0.989 13 151
AF-A0A1H6JFL5-F1-model_v4 Uncharacterized protein 0.9862 13 150
AF-A0A4Q9Z1W1-F1-model_v4 DUF1801 domain-containing protein 0.9861 35 149
AF-A0A7W2FWF9-F1-model_v4 DUF1801 domain-containing protein 0.9835 13 149

Map