F348106

General Info

Members Datasets Scaffolds Average Seq Length
235 170 470 371

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10000139|Ga0105238_100001399
Length 411
Sequence MKLVLNKSALISSLCRIAAGKKSRLKIPSKAATIALIMAGNSFGQAFRVTTAGESHGPANVVIIDGVPPGIALTLDDLMVDLNRRRPGQSQIVTQRDESDTPEILSGVFEGRTTGTSLAILVRNQDQRSKDYGDIRHLYRPGHADFSFDAKYGFRDFRGGGRSSARETTVRVAAGVVAKKILEQAFDGRVVGYVTQVGSVKATVPDPASVTLAQVETLPTGEPNIIRCPDLDAAAQMIELIESVRKAGDSIGGAAEIVATNIPAGLGEPVFDKIKADLAKALFSLPAVLGVEYGIGFGCVTMRGSEHNDHFIPSDSPGTEGRPGITTDTNRHGGMLGGITTGRPIVLRAAVKPTSSLPIEQPTVNDQGQPATIRTKGRHDPCLLPRFIPMAEAMVAIVLADHWLRWRGQTT

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
78 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
89 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
90 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
91 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
92 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
93 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
163 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
167 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
168 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
169 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
170 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 0
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 1.28
Rhizosphere 88.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10000139 3300009551 Bacteria 80491
2 rootH1_10104581 3300003323 Bacteria 4289
3 Ga0070680_100036179 3300005336 Bacteria 3988
4 Ga0070682_100000766 3300005337 Bacteria 19017
5 Ga0070682_100010793 3300005337 Bacteria 5196
6 Ga0070682_100039083 3300005337 Bacteria 2914
7 Ga0070689_100046602 3300005340 Bacteria 3341
8 Ga0070668_100017234 3300005347 Bacteria 5408
9 Ga0070675_100095912 3300005354 Bacteria 2491
10 Ga0070709_10004947 3300005434 Bacteria 7201
11 Ga0070714_100003254 3300005435 Bacteria 12087
12 Ga0070714_100008079 3300005435 Bacteria 8203
13 Ga0070714_100009680 3300005435 Bacteria 7590
14 Ga0070714_100172157 3300005435 Bacteria 1965
15 Ga0070713_100004999 3300005436 Bacteria 9004
16 Ga0070711_100003619 3300005439 Bacteria 9024
17 Ga0070681_10001554 3300005458 Bacteria 20336
18 Ga0070681_10009351 3300005458 Bacteria 9643
19 Ga0068867_100158370 3300005459 Bacteria 1784
20 Ga0070685_10021731 3300005466 Bacteria 3490
21 Ga0070679_100012036 3300005530 Bacteria 8258
22 Ga0070697_100037778 3300005536 Bacteria 3900
23 Ga0070672_100000260 3300005543 Bacteria 29881
24 Ga0070696_100002786 3300005546 Bacteria 11603
25 Ga0070696_100005474 3300005546 Bacteria 8470
26 Ga0070696_100020371 3300005546 Bacteria 4496
27 Ga0068855_100022173 3300005563 Bacteria 7609
28 Ga0070664_100044970 3300005564 Bacteria 3728
29 Ga0068856_100002127 3300005614 Bacteria 20559
30 Ga0068856_100002936 3300005614 Bacteria 17469
31 Ga0068861_100001614 3300005719 Bacteria 14371
32 Ga0081539_10000443 3300005985 Bacteria 88031
33 Ga0075430_100006560 3300006846 Bacteria 9814
34 Ga0075430_100037658 3300006846 Bacteria 4100
35 Ga0075430_100129294 3300006846 Bacteria 2105
36 Ga0075431_100040046 3300006847 Bacteria 4829
37 Ga0075431_100433777 3300006847 Bacteria 1312
38 Ga0075434_100066659 3300006871 Bacteria 3586
39 Ga0075429_100001360 3300006880 Bacteria 19993
40 Ga0075429_100070994 3300006880 Bacteria 3032
41 Ga0075436_100046166 3300006914 Bacteria 3004
42 Ga0105240_10138015 3300009093 Bacteria 2918
43 Ga0111539_10027179 3300009094 Bacteria 6988
44 Ga0105245_10010003 3300009098 Bacteria 8259
45 Ga0114129_10001587 3300009147 Bacteria 30857
46 Ga0105243_10254472 3300009148 Bacteria 1569
47 Ga0105241_10057488 3300009174 Bacteria 2984
48 Ga0105241_10112908 3300009174 Bacteria 2177
49 Ga0157370_10001959 3300013104 Bacteria 25360
50 Ga0157370_10012667 3300013104 Bacteria 8733
51 Ga0157378_10260129 3300013297 Bacteria 1665
52 Ga0157372_10011271 3300013307 Bacteria 9509
53 Ga0157376_10127244 3300014969 Bacteria 2268
54 Ga0207692_10025347 3300025898 Bacteria 2769
55 Ga0207643_10194157 3300025908 Bacteria 1233
56 Ga0207654_10066211 3300025911 Bacteria 2130
57 Ga0207654_10122239 3300025911 Bacteria 1636
58 Ga0207707_10005746 3300025912 Bacteria 10848
59 Ga0207707_10075878 3300025912 Bacteria 2934
60 Ga0207660_10059727 3300025917 Bacteria 2738
61 Ga0207649_10060331 3300025920 Bacteria 2383
62 Ga0207652_10038075 3300025921 Bacteria 4074
63 Ga0207694_10033450 3300025924 Bacteria 3938
64 Ga0207687_10012456 3300025927 Bacteria 5555
65 Ga0207700_10007554 3300025928 Bacteria 6657
66 Ga0207664_10010690 3300025929 Bacteria 6490
67 Ga0207691_10031568 3300025940 Bacteria 4942
68 Ga0207689_10048817 3300025942 Bacteria 3492
69 Ga0207679_10014486 3300025945 Bacteria 5187
70 Ga0207667_10000207 3300025949 Bacteria 83420
71 Ga0207667_10003434 3300025949 Bacteria 19555
72 Ga0207667_10113093 3300025949 Bacteria 2799
73 Ga0207677_10102890 3300026023 Bacteria 2107
74 Ga0207703_10024953 3300026035 Bacteria 4703
75 Ga0207702_10026079 3300026078 Bacteria 4852
76 Ga0207702_10226670 3300026078 Bacteria 1744
77 Ga0207641_10161569 3300026088 Bacteria 2037
78 Ga0207648_10184788 3300026089 Bacteria 1846
79 Ga0207675_100002150 3300026118 Bacteria 19579
80 Ga0209983_1002755 3300027665 Bacteria 3813
81 Ga0209998_10004016 3300027717 Bacteria 3150
82 Ga0207428_10038826 3300027907 Bacteria 3868
83 Ga0207428_10178420 3300027907 Bacteria 1605
84 Ga0265328_10034518 3300031239 Bacteria 1873
85 Ga0265325_10001755 3300031241 Bacteria 15021
86 Ga0265340_10003980 3300031247 Bacteria 8303
87 Ga0265339_10003219 3300031249 Bacteria 11462
88 Ga0265339_10111678 3300031249 Bacteria 1413
89 Ga0265327_10001481 3300031251 Bacteria 29247
90 Ga0265327_10022641 3300031251 Bacteria 3747
91 Ga0265316_10004921 3300031344 Bacteria 13140
92 Ga0307513_10095931 3300031456 Bacteria 3005
93 Ga0307513_10113510 3300031456 Bacteria 2697
94 Ga0307508_10002741 3300031616 Bacteria 18382
95 Ga0307508_10019483 3300031616 Bacteria 6168
96 Ga0265314_10000003 3300031711 Bacteria 1653386
97 Ga0265314_10173695 3300031711 Bacteria 1298
98 Ga0307516_10004219 3300031730 Bacteria 17894
99 Ga0307416_100342852 3300032002 Bacteria 1508
100 Ga0373923_0104028 3300035111 Bacteria 1255
101 Ga0373936_0008320 3300035113 Bacteria 3903
102 Ga0373956_0067305 3300035119 Bacteria 1630
103 Ga0373961_0060294 3300035241 Bacteria 1149
104 Ga0373924_0003901 3300035410 Bacteria 5172
105 Ga0373924_0094393 3300035410 Bacteria 1282
106 Ga0373931_0032899 3300035691 Bacteria 2685
107 Ga0373937_0192689 3300036401 Bacteria 1915
108 Ga0373937_0195411 3300036401 Bacteria 1901
109 Ga0316584_0043720 3300036712 Bacteria 3341
110 Ga0373925_0144636 3300037068 Bacteria 1863
111 Ga0395899_0001141 3300037312 Bacteria 23519
112 Ga0395899_0004367 3300037312 Bacteria 11027
113 Ga0395900_0027719 3300037418 Bacteria 5803
114 Ga0395900_0188318 3300037418 Bacteria 2094
115 Ga0395898_0022266 3300037466 Bacteria 6419
116 Ga0395905_0011018 3300037471 Bacteria 8750
117 Ga0395901_0003140 3300038443 Bacteria 16600
118 Ga0400484_13138 3300038725 Bacteria 12289
119 Ga0400490_13333 3300038726 Bacteria 21967
120 Ga0400490_21722 3300038726 Bacteria 8577
121 Ga0400491_02276 3300038727 Bacteria 2691
122 Ga0400483_024278 3300039062 Bacteria 9576
123 Ga0451849_1025255 3300041505 Bacteria 3902
124 Ga0451851_0466742 3300041507 Bacteria 2855
125 Ga0451853_0517244 3300041512 Bacteria 6844
126 Ga0451577_0007337 3300042876 Bacteria 10850
127 Ga0451577_0108902 3300042876 Bacteria 2477
128 Ga0453683_0015874 3300044673 Bacteria 4868
129 Ga0453684_0000069 3300044712 Bacteria 456439
130 Ga0453684_0006939 3300044712 Bacteria 21203
131 Ga0453684_0010527 3300044712 Bacteria 15791
132 Ga0451576_0000418 3300045051 Bacteria 98732
133 Ga0451576_0007367 3300045051 Bacteria 13185
134 Ga0451576_0009420 3300045051 Bacteria 11320
135 Ga0451576_0016554 3300045051 Bacteria 8131
136 Ga0451576_0034302 3300045051 Bacteria 5391
137 Ga0451576_0044036 3300045051 Bacteria 4707
138 Ga0451576_0348728 3300045051 Bacteria 1550
139 Ga0495638_0000007 3300046460 Bacteria 602783
140 Ga0495641_0064995 3300046461 Bacteria 1642
141 Ga0495580_0102810 3300046472 Bacteria 1986
142 Ga0495580_0207073 3300046472 Bacteria 1350
143 Ga0495662_0004682 3300046476 Bacteria 6861
144 Ga0495607_0000177 3300046501 Bacteria 67452
145 Ga0495618_0019807 3300046514 Bacteria 4141
146 Ga0495628_0012241 3300046516 Bacteria 7232
147 Ga0495628_0152959 3300046516 Bacteria 1756
148 Ga0495630_0001696 3300046517 Bacteria 15381
149 Ga0495630_0217553 3300046517 Bacteria 1458
150 Ga0495665_0004112 3300046531 Bacteria 7844
151 Ga0495640_0134825 3300046533 Bacteria 1595
152 Ga0495640_0146743 3300046533 Bacteria 1517
153 Ga0495586_0017172 3300046535 Bacteria 3846
154 Ga0495586_0046523 3300046535 Bacteria 2339
155 Ga0495586_0063124 3300046535 Bacteria 2017
156 Ga0495667_0033391 3300046559 Bacteria 3444
157 Ga0495634_0069046 3300046642 Bacteria 2332
158 Ga0495634_0156091 3300046642 Bacteria 1440
159 Ga0495657_0105792 3300046675 Bacteria 1787
160 Ga0495658_0009060 3300046683 Bacteria 4947
161 Ga0495658_0123467 3300046683 Bacteria 1568
162 Ga0495600_0035111 3300046809 Bacteria 3255
163 Ga0495581_0197990 3300047315 Bacteria 1175
164 Ga0495674_0041578 3300047319 Bacteria 4105
165 Ga0495672_0009204 3300047320 Bacteria 7190
166 Ga0495676_0110260 3300047321 Bacteria 2020
167 Ga0495680_0102191 3300047322 Bacteria 2134
168 Ga0495684_0008774 3300047471 Bacteria 7816
169 Ga0496100_0049676 3300048903 Bacteria 2714
170 Ga0496111_0222873 3300048914 Bacteria 1401
171 Ga0496114_0004040 3300048917 Bacteria 11332
172 Ga0496121_0177028 3300048924 Bacteria 1543
173 Ga0496124_0000004 3300048927 Bacteria 976131
174 Ga0496126_0103705 3300048929 Bacteria 2485
175 Ga0501033_0251226 3300049570 Bacteria 1253
176 Ga0501034_0000468 3300049571 Bacteria 66573
177 Ga0501036_0074399 3300049572 Bacteria 2873
178 Ga0501038_0235770 3300049574 Bacteria 1454
179 Ga0501039_0014596 3300049575 Bacteria 6015
180 Ga0501040_0150581 3300049576 Bacteria 1641
181 Ga0501041_0003178 3300049577 Bacteria 9445
182 Ga0501043_0153267 3300049579 Bacteria 1803
183 Ga0501048_0073151 3300049582 Bacteria 2420
184 Ga0501067_0121467 3300049583 Bacteria 1454
185 Ga0501069_0006557 3300049585 Bacteria 6086
186 Ga0501071_0018443 3300049587 Bacteria 4831
187 Ga0501071_0115895 3300049587 Bacteria 1983
188 Ga0501071_0263986 3300049587 Bacteria 1301
189 Ga0501072_0002875 3300049588 Bacteria 12946
190 Ga0501072_0062194 3300049588 Bacteria 2945
191 Ga0501073_0057958 3300049589 Bacteria 2708
192 Ga0501074_0012049 3300049590 Bacteria 6282
193 Ga0501075_0000204 3300049591 Bacteria 31579
194 Ga0501076_0001733 3300049592 Bacteria 14751
195 Ga0501076_0025789 3300049592 Bacteria 4551
196 Ga0501209_000906 3300049656 Bacteria 3870
197 Ga0501079_0040412 3300049741 Bacteria 3597
198 Ga0501079_0111304 3300049741 Bacteria 2128
199 Ga0501080_0017197 3300049742 Bacteria 6681
200 Ga0501080_0020783 3300049742 Bacteria 6078
201 Ga0501080_0168874 3300049742 Bacteria 2018
202 Ga0501083_0001443 3300049744 Bacteria 16226
203 Ga0501083_0096525 3300049744 Bacteria 1950
204 Ga0501280_000344 3300049776 Bacteria 11577
205 Ga0501044_0133697 3300049823 Bacteria 2473
206 Ga0501045_0013638 3300049824 Bacteria 5744
207 nmdc:mga05p37_4585_c1 3300050507 Bacteria 16159
208 nmdc:mga09592_134235_c1 3300050508 Bacteria 2131
209 nmdc:mga09592_2795_c1 3300050508 Bacteria 14140
210 nmdc:mga09592_296627_c1 3300050508 Bacteria 1401
211 nmdc:mga0qj67_122647_c1 3300050509 Bacteria 2102
212 nmdc:mga0qj67_41029_c1 3300050509 Bacteria 3639
213 nmdc:mga06r32_140241_c1 3300050510 Bacteria 2393
214 nmdc:mga08y16_2423_c1 3300050511 Bacteria 16840
215 nmdc:mga08y16_51589_c1 3300050511 Bacteria 4304
216 nmdc:mga0rr50_60740_c1 3300050513 Bacteria 2845
217 nmdc:mga08x19_20510_c1 3300050514 Bacteria 4069
218 nmdc:mga08x19_47614_c1 3300050514 Bacteria 2745
219 nmdc:mga08x19_8929_c1 3300050514 Bacteria 5980
220 Ga0495601_0001071 3300053077 Bacteria 14992
221 Ga0495612_0084944 3300053078 Bacteria 1334
222 Ga0500643_052215 3300053087 Bacteria 1166
223 Ga0500555_009971 3300053103 Bacteria 2720
224 Ga0500616_0001049 3300053153 Bacteria 29212
225 Ga0500609_001550 3300053731 Bacteria 3356
226 Ga0501084_0011092 3300054114 Bacteria 7463
227 Ga0501084_0021139 3300054114 Bacteria 5427
228 Ga0501084_0033187 3300054114 Bacteria 4318
229 Ga0501082_0005685 3300060353 Bacteria 10819
230 Ga0501082_0015417 3300060353 Bacteria 6578
231 Ga0530510_0000257 3300061734 Bacteria 33336
232 2574431039 2574179768 Bacteria 4907129
233 2687236348 2684623219 Bacteria 8442773
234 2857545520 2857542790 Bacteria 5326616
235 639786165 639633007 Bacteria 4376040
236 Ga0105238_10000139
237 rootH1_10104581
238 Ga0070680_100036179
239 Ga0070682_100000766
240 Ga0070682_100010793
241 Ga0070682_100039083
242 Ga0070689_100046602
243 Ga0070668_100017234
244 Ga0070675_100095912
245 Ga0070709_10004947
246 Ga0070714_100003254
247 Ga0070714_100008079
248 Ga0070714_100009680
249 Ga0070714_100172157
250 Ga0070713_100004999
251 Ga0070711_100003619
252 Ga0070681_10001554
253 Ga0070681_10009351
254 Ga0068867_100158370
255 Ga0070685_10021731
256 Ga0070679_100012036
257 Ga0070697_100037778
258 Ga0070672_100000260
259 Ga0070696_100002786
260 Ga0070696_100005474
261 Ga0070696_100020371
262 Ga0068855_100022173
263 Ga0070664_100044970
264 Ga0068856_100002127
265 Ga0068856_100002936
266 Ga0068861_100001614
267 Ga0081539_10000443
268 Ga0075430_100006560
269 Ga0075430_100037658
270 Ga0075430_100129294
271 Ga0075431_100040046
272 Ga0075431_100433777
273 Ga0075434_100066659
274 Ga0075429_100001360
275 Ga0075429_100070994
276 Ga0075436_100046166
277 Ga0105240_10138015
278 Ga0111539_10027179
279 Ga0105245_10010003
280 Ga0114129_10001587
281 Ga0105243_10254472
282 Ga0105241_10057488
283 Ga0105241_10112908
284 Ga0157370_10001959
285 Ga0157370_10012667
286 Ga0157378_10260129
287 Ga0157372_10011271
288 Ga0157376_10127244
289 Ga0207692_10025347
290 Ga0207643_10194157
291 Ga0207654_10066211
292 Ga0207654_10122239
293 Ga0207707_10005746
294 Ga0207707_10075878
295 Ga0207660_10059727
296 Ga0207649_10060331
297 Ga0207652_10038075
298 Ga0207694_10033450
299 Ga0207687_10012456
300 Ga0207700_10007554
301 Ga0207664_10010690
302 Ga0207691_10031568
303 Ga0207689_10048817
304 Ga0207679_10014486
305 Ga0207667_10000207
306 Ga0207667_10003434
307 Ga0207667_10113093
308 Ga0207677_10102890
309 Ga0207703_10024953
310 Ga0207702_10026079
311 Ga0207702_10226670
312 Ga0207641_10161569
313 Ga0207648_10184788
314 Ga0207675_100002150
315 Ga0209983_1002755
316 Ga0209998_10004016
317 Ga0207428_10038826
318 Ga0207428_10178420
319 Ga0265328_10034518
320 Ga0265325_10001755
321 Ga0265340_10003980
322 Ga0265339_10003219
323 Ga0265339_10111678
324 Ga0265327_10001481
325 Ga0265327_10022641
326 Ga0265316_10004921
327 Ga0307513_10095931
328 Ga0307513_10113510
329 Ga0307508_10002741
330 Ga0307508_10019483
331 Ga0265314_10000003
332 Ga0265314_10173695
333 Ga0307516_10004219
334 Ga0307416_100342852
335 Ga0373923_0104028
336 Ga0373936_0008320
337 Ga0373956_0067305
338 Ga0373961_0060294
339 Ga0373924_0003901
340 Ga0373924_0094393
341 Ga0373931_0032899
342 Ga0373937_0192689
343 Ga0373937_0195411
344 Ga0316584_0043720
345 Ga0373925_0144636
346 Ga0395899_0001141
347 Ga0395899_0004367
348 Ga0395900_0027719
349 Ga0395900_0188318
350 Ga0395898_0022266
351 Ga0395905_0011018
352 Ga0395901_0003140
353 Ga0400484_13138
354 Ga0400490_13333
355 Ga0400490_21722
356 Ga0400491_02276
357 Ga0400483_024278
358 Ga0451849_1025255
359 Ga0451851_0466742
360 Ga0451853_0517244
361 Ga0451577_0007337
362 Ga0451577_0108902
363 Ga0453683_0015874
364 Ga0453684_0000069
365 Ga0453684_0006939
366 Ga0453684_0010527
367 Ga0451576_0000418
368 Ga0451576_0007367
369 Ga0451576_0009420
370 Ga0451576_0016554
371 Ga0451576_0034302
372 Ga0451576_0044036
373 Ga0451576_0348728
374 Ga0495638_0000007
375 Ga0495641_0064995
376 Ga0495580_0102810
377 Ga0495580_0207073
378 Ga0495662_0004682
379 Ga0495607_0000177
380 Ga0495618_0019807
381 Ga0495628_0012241
382 Ga0495628_0152959
383 Ga0495630_0001696
384 Ga0495630_0217553
385 Ga0495665_0004112
386 Ga0495640_0134825
387 Ga0495640_0146743
388 Ga0495586_0017172
389 Ga0495586_0046523
390 Ga0495586_0063124
391 Ga0495667_0033391
392 Ga0495634_0069046
393 Ga0495634_0156091
394 Ga0495657_0105792
395 Ga0495658_0009060
396 Ga0495658_0123467
397 Ga0495600_0035111
398 Ga0495581_0197990
399 Ga0495674_0041578
400 Ga0495672_0009204
401 Ga0495676_0110260
402 Ga0495680_0102191
403 Ga0495684_0008774
404 Ga0496100_0049676
405 Ga0496111_0222873
406 Ga0496114_0004040
407 Ga0496121_0177028
408 Ga0496124_0000004
409 Ga0496126_0103705
410 Ga0501033_0251226
411 Ga0501034_0000468
412 Ga0501036_0074399
413 Ga0501038_0235770
414 Ga0501039_0014596
415 Ga0501040_0150581
416 Ga0501041_0003178
417 Ga0501043_0153267
418 Ga0501048_0073151
419 Ga0501067_0121467
420 Ga0501069_0006557
421 Ga0501071_0018443
422 Ga0501071_0115895
423 Ga0501071_0263986
424 Ga0501072_0002875
425 Ga0501072_0062194
426 Ga0501073_0057958
427 Ga0501074_0012049
428 Ga0501075_0000204
429 Ga0501076_0001733
430 Ga0501076_0025789
431 Ga0501209_000906
432 Ga0501079_0040412
433 Ga0501079_0111304
434 Ga0501080_0017197
435 Ga0501080_0020783
436 Ga0501080_0168874
437 Ga0501083_0001443
438 Ga0501083_0096525
439 Ga0501280_000344
440 Ga0501044_0133697
441 Ga0501045_0013638
442 nmdc:mga05p37_4585_c1
443 nmdc:mga09592_134235_c1
444 nmdc:mga09592_2795_c1
445 nmdc:mga09592_296627_c1
446 nmdc:mga0qj67_122647_c1
447 nmdc:mga0qj67_41029_c1
448 nmdc:mga06r32_140241_c1
449 nmdc:mga08y16_2423_c1
450 nmdc:mga08y16_51589_c1
451 nmdc:mga0rr50_60740_c1
452 nmdc:mga08x19_20510_c1
453 nmdc:mga08x19_47614_c1
454 nmdc:mga08x19_8929_c1
455 Ga0495601_0001071
456 Ga0495612_0084944
457 Ga0500643_052215
458 Ga0500555_009971
459 Ga0500616_0001049
460 Ga0500609_001550
461 Ga0501084_0011092
462 Ga0501084_0021139
463 Ga0501084_0033187
464 Ga0501082_0005685
465 Ga0501082_0015417
466 Ga0530510_0000257
467 2574431039
468 2687236348
469 2857545520
470 639786165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01264

Chorismate_synt

Chorismate synthase

47

404

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z9a-assembly1.cif.gz_B crystal structure of chorismate synthase from pseudomonas aeruginosa 0.9472 1 370
5z9a-assembly1.cif.gz_B crystal structure of chorismate synthase from pseudomonas aeruginosa 0.9435 1 370
5z9a-assembly1.cif.gz_A crystal structure of chorismate synthase from pseudomonas aeruginosa 0.9425 1 370
5z9a-assembly1.cif.gz_A crystal structure of chorismate synthase from pseudomonas aeruginosa 0.9388 1 370
5wuy-assembly1.cif.gz_B crystal structure of chorismate synthase from acinetobacter baumannii at 2.50a resolution 0.93 1 372
ID Description Score Start End Superfamily
af_P12008_1_360_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9542 1 371 3.60.150.10
af_A0A1D8PTK1_42_412_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9439 10 370 3.60.150.10
5z9aA00 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9425 1 370 3.60.150.10
5z9aA00 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9388 1 370 3.60.150.10
af_P28777_108_376_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9319 111 370 3.60.150.10
ID Description Score Start End GO Terms
AF-A0A517R072-F1-model_v4 Chorismate synthase (CS) (EC 4.2.3.5) (5-enolpyruvylshikimate-3-phosphate phospholyase) 0.9828 1 370 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181
AF-A0A7V3QFB3-F1-model_v4 Chorismate synthase (CS) (EC 4.2.3.5) (5-enolpyruvylshikimate-3-phosphate phospholyase) 0.9823 3 373 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181
AF-A0A4V0XNH8-F1-model_v4 Chorismate synthase (CS) (EC 4.2.3.5) (5-enolpyruvylshikimate-3-phosphate phospholyase) 0.9822 1 373 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181
GO:1901135
AF-A0A2D6SVU2-F1-model_v4 Chorismate synthase (EC 4.2.3.5) 0.9819 1 325 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181
AF-A0A068NVN8-F1-model_v4 Chorismate synthase (CS) (EC 4.2.3.5) (5-enolpyruvylshikimate-3-phosphate phospholyase) 0.9798 3 371 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181

Map