F347896
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 235 | 148 | 235 | 474 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100049818|Ga0070706_1000498182 |
| Length | 494 |
| Sequence | MSPADLPGLNIADLQALLRRREVSPRDVLEALRARIEEIDPKIDAYLSLDFEAALKEAEKVDVNLPLGGVPIAIKDIINVAGQPCTCGSKILANYRAMYDATVIRKLRAAGAIPFGKTNMDEFAMGSSTENSSVKPTRNPWDLSRVPGGSGALGTDTGGSIRQPAAVSGVVGVKPTYGRVSRFGVTAFASSLDQVGPLAKTVRDAGLIMGAIAGHDPLDSTSLNEPVPNYPASLNGDLAAGRVRVAAATGLRGVRLGLPKEYMIEGIDSQVKSAIDAAVQHFISLGAEVIDLTLPHTEYGIAVYYFLATAEASANLARFDGVRYGYRAENPRDILDHYGRTRGDGFGPEVKRRIILGTYVLSSGYYDAYYLRAQKVRELIRQDFATAFEKVDAIVSPTSPVPAFKLGERTADPLQMYLADIFTVPGNLAGICGISLPCGFAKIDPPEDGFAVANSVQLPIGLQLLGKALDEARIFQIARAYEQSTDWHKAKPSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 64 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 65 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 107 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 108 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 109 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 115 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 116 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 117 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 118 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 119 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 120 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 121 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 122 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 123 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 124 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 131 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 132 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 133 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 135 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 136 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 137 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 138 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.83 |
| Rhizosphere | 93.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000016 | 3300003203 | Bacteria | 91056 |
| 2 | JGI25406J46586_10000959 | 3300003203 | Bacteria | 13554 |
| 3 | rootH2_10016441 | 3300003320 | Bacteria | 43831 |
| 4 | JGI25405J52794_10000371 | 3300003911 | Bacteria | 6334 |
| 5 | Ga0065714_10064594 | 3300005288 | Bacteria | 30899 |
| 6 | Ga0065704_10006019 | 3300005289 | Bacteria | 4241 |
| 7 | Ga0065712_10000121 | 3300005290 | Bacteria | 103063 |
| 8 | Ga0065712_10085996 | 3300005290 | Bacteria | 2662 |
| 9 | Ga0065715_10003017 | 3300005293 | Bacteria | 4229 |
| 10 | Ga0065715_10089446 | 3300005293 | Bacteria | 10135 |
| 11 | Ga0065715_10093569 | 3300005293 | Bacteria | 4636 |
| 12 | Ga0065707_10012648 | 3300005295 | Bacteria | 4177 |
| 13 | Ga0070658_10004257 | 3300005327 | Bacteria | 11696 |
| 14 | Ga0070658_10140153 | 3300005327 | Bacteria | 2020 |
| 15 | Ga0070676_10001395 | 3300005328 | Bacteria | 12191 |
| 16 | Ga0070690_100081831 | 3300005330 | Bacteria | 2113 |
| 17 | Ga0070670_100093102 | 3300005331 | Bacteria | 2592 |
| 18 | Ga0070666_10073637 | 3300005335 | Bacteria | 2327 |
| 19 | Ga0070660_100075227 | 3300005339 | Bacteria | 2644 |
| 20 | Ga0070689_100059878 | 3300005340 | Bacteria | 2960 |
| 21 | Ga0070687_100000577 | 3300005343 | Bacteria | 12201 |
| 22 | Ga0070661_100002913 | 3300005344 | Bacteria | 11789 |
| 23 | Ga0070669_100011503 | 3300005353 | Bacteria | 6281 |
| 24 | Ga0070675_100001717 | 3300005354 | Bacteria | 16184 |
| 25 | Ga0070671_100134057 | 3300005355 | Bacteria | 2087 |
| 26 | Ga0070671_100140654 | 3300005355 | Bacteria | 2037 |
| 27 | Ga0070673_100183466 | 3300005364 | Bacteria | 1792 |
| 28 | Ga0070659_100003104 | 3300005366 | Bacteria | 11813 |
| 29 | Ga0070659_100144307 | 3300005366 | Bacteria | 1939 |
| 30 | Ga0070667_100001295 | 3300005367 | Bacteria | 22619 |
| 31 | Ga0070714_100140236 | 3300005435 | Bacteria | 2169 |
| 32 | Ga0070713_100006391 | 3300005436 | Bacteria | 8164 |
| 33 | Ga0070711_100020665 | 3300005439 | Bacteria | 4248 |
| 34 | Ga0070711_100028880 | 3300005439 | Bacteria | 3653 |
| 35 | Ga0070711_100116959 | 3300005439 | Bacteria | 1965 |
| 36 | Ga0070708_100004035 | 3300005445 | Bacteria | 11538 |
| 37 | Ga0070708_100032664 | 3300005445 | Bacteria | 4516 |
| 38 | Ga0070708_100166620 | 3300005445 | Bacteria | 2055 |
| 39 | Ga0070662_100021601 | 3300005457 | Bacteria | 4396 |
| 40 | Ga0070681_10022094 | 3300005458 | Bacteria | 6385 |
| 41 | Ga0070706_100000329 | 3300005467 | Bacteria | 57770 |
| 42 | Ga0070706_100000876 | 3300005467 | Bacteria | 33053 |
| 43 | Ga0070706_100021192 | 3300005467 | Bacteria | 5985 |
| 44 | Ga0070706_100047900 | 3300005467 | Bacteria | 3945 |
| 45 | Ga0070706_100049818 | 3300005467 | Bacteria | 3864 |
| 46 | Ga0070706_100098097 | 3300005467 | Bacteria | 2722 |
| 47 | Ga0070706_100202312 | 3300005467 | Bacteria | 1855 |
| 48 | Ga0070707_100000049 | 3300005468 | Bacteria | 102972 |
| 49 | Ga0070707_100009406 | 3300005468 | Bacteria | 9071 |
| 50 | Ga0070707_100042761 | 3300005468 | Bacteria | 4338 |
| 51 | Ga0070707_100092019 | 3300005468 | Bacteria | 2936 |
| 52 | Ga0070707_100163577 | 3300005468 | Bacteria | 2168 |
| 53 | Ga0070698_100001216 | 3300005471 | Bacteria | 28652 |
| 54 | Ga0070698_100007271 | 3300005471 | Bacteria | 11993 |
| 55 | Ga0070684_100000202 | 3300005535 | Bacteria | 41508 |
| 56 | Ga0070684_100020404 | 3300005535 | Bacteria | 5498 |
| 57 | Ga0070697_100009619 | 3300005536 | Bacteria | 7554 |
| 58 | Ga0070697_100011899 | 3300005536 | Bacteria | 6811 |
| 59 | Ga0070697_100048161 | 3300005536 | Bacteria | 3456 |
| 60 | Ga0070697_100092592 | 3300005536 | Bacteria | 2501 |
| 61 | Ga0070697_100137395 | 3300005536 | Bacteria | 2053 |
| 62 | Ga0070665_100012239 | 3300005548 | Bacteria | 8648 |
| 63 | Ga0070665_100019246 | 3300005548 | Bacteria | 6849 |
| 64 | Ga0068855_100033070 | 3300005563 | Bacteria | 6174 |
| 65 | Ga0068856_100001045 | 3300005614 | Bacteria | 29378 |
| 66 | Ga0068859_100260179 | 3300005617 | Bacteria | 1826 |
| 67 | Ga0068863_100004599 | 3300005841 | Bacteria | 13595 |
| 68 | Ga0068858_100017896 | 3300005842 | Bacteria | 6636 |
| 69 | Ga0068858_100047153 | 3300005842 | Bacteria | 3995 |
| 70 | Ga0068860_100000202 | 3300005843 | Bacteria | 94520 |
| 71 | Ga0068860_100005012 | 3300005843 | Bacteria | 13483 |
| 72 | Ga0068862_100004453 | 3300005844 | Bacteria | 11818 |
| 73 | Ga0081455_10001817 | 3300005937 | Bacteria | 25709 |
| 74 | Ga0081455_10002278 | 3300005937 | Bacteria | 22898 |
| 75 | Ga0081455_10002468 | 3300005937 | Bacteria | 21998 |
| 76 | Ga0081455_10005170 | 3300005937 | Bacteria | 14364 |
| 77 | Ga0081455_10006042 | 3300005937 | Bacteria | 13104 |
| 78 | Ga0081540_1000119 | 3300005983 | Bacteria | 84020 |
| 79 | Ga0081540_1018470 | 3300005983 | Bacteria | 4275 |
| 80 | Ga0081539_10000383 | 3300005985 | Bacteria | 95995 |
| 81 | Ga0081539_10000998 | 3300005985 | Bacteria | 52505 |
| 82 | Ga0081539_10016084 | 3300005985 | Bacteria | 5377 |
| 83 | Ga0081539_10024857 | 3300005985 | Bacteria | 3873 |
| 84 | Ga0070717_10050584 | 3300006028 | Bacteria | 3416 |
| 85 | Ga0070712_100004051 | 3300006175 | Bacteria | 8996 |
| 86 | Ga0070712_100072194 | 3300006175 | Bacteria | 2472 |
| 87 | Ga0070712_100084474 | 3300006175 | Bacteria | 2308 |
| 88 | Ga0097620_100260188 | 3300006931 | Bacteria | 1826 |
| 89 | Ga0099794_10025778 | 3300007265 | Bacteria | 2712 |
| 90 | Ga0105240_10000064 | 3300009093 | Bacteria | 215932 |
| 91 | Ga0105240_10178127 | 3300009093 | Bacteria | 2512 |
| 92 | Ga0111539_10191068 | 3300009094 | Bacteria | 2389 |
| 93 | Ga0105245_10035067 | 3300009098 | Bacteria | 4451 |
| 94 | Ga0105245_10112097 | 3300009098 | Bacteria | 2538 |
| 95 | Ga0105245_10233746 | 3300009098 | Bacteria | 1779 |
| 96 | Ga0114129_10031765 | 3300009147 | Bacteria | 7464 |
| 97 | Ga0114129_10180326 | 3300009147 | Bacteria | 2874 |
| 98 | Ga0105243_10009519 | 3300009148 | Bacteria | 7396 |
| 99 | Ga0105243_10121880 | 3300009148 | Bacteria | 2200 |
| 100 | Ga0105249_10004445 | 3300009553 | Bacteria | 12130 |
| 101 | Ga0105239_10003699 | 3300010375 | Bacteria | 18629 |
| 102 | Ga0105246_10094519 | 3300011119 | Bacteria | 2162 |
| 103 | Ga0157374_10000071 | 3300013296 | Bacteria | 102927 |
| 104 | Ga0157374_10014349 | 3300013296 | Bacteria | 6934 |
| 105 | Ga0157374_10060605 | 3300013296 | Bacteria | 3542 |
| 106 | Ga0163162_10028771 | 3300013306 | Bacteria | 5501 |
| 107 | Ga0163162_10068848 | 3300013306 | Bacteria | 3591 |
| 108 | Ga0163162_10322200 | 3300013306 | Bacteria | 1678 |
| 109 | Ga0157375_10034699 | 3300013308 | Bacteria | 4808 |
| 110 | Ga0157379_10000960 | 3300014968 | Bacteria | 23399 |
| 111 | Ga0157376_10000562 | 3300014969 | Bacteria | 23988 |
| 112 | Ga0157376_10008458 | 3300014969 | Bacteria | 7430 |
| 113 | Ga0157376_10035517 | 3300014969 | Bacteria | 4032 |
| 114 | Ga0213872_10049924 | 3300021361 | Bacteria | 1900 |
| 115 | Ga0213876_10000104 | 3300021384 | Bacteria | 93860 |
| 116 | Ga0207697_10000127 | 3300025315 | Bacteria | 36502 |
| 117 | Ga0207697_10003150 | 3300025315 | Bacteria | 8224 |
| 118 | Ga0207697_10006524 | 3300025315 | Bacteria | 5267 |
| 119 | Ga0207688_10032270 | 3300025901 | Bacteria | 2894 |
| 120 | Ga0207647_10002889 | 3300025904 | Bacteria | 12941 |
| 121 | Ga0207699_10128884 | 3300025906 | Bacteria | 1647 |
| 122 | Ga0207645_10000835 | 3300025907 | Bacteria | 25692 |
| 123 | Ga0207705_10003005 | 3300025909 | Bacteria | 12869 |
| 124 | Ga0207705_10068468 | 3300025909 | Bacteria | 2570 |
| 125 | Ga0207684_10000401 | 3300025910 | Bacteria | 57950 |
| 126 | Ga0207684_10002073 | 3300025910 | Bacteria | 20631 |
| 127 | Ga0207684_10016950 | 3300025910 | Bacteria | 6258 |
| 128 | Ga0207684_10045060 | 3300025910 | Bacteria | 3741 |
| 129 | Ga0207684_10115788 | 3300025910 | Bacteria | 2297 |
| 130 | Ga0207684_10169557 | 3300025910 | Bacteria | 1881 |
| 131 | Ga0207695_10000046 | 3300025913 | Bacteria | 430344 |
| 132 | Ga0207671_10007220 | 3300025914 | Bacteria | 9677 |
| 133 | Ga0207693_10003275 | 3300025915 | Bacteria | 13865 |
| 134 | Ga0207693_10039146 | 3300025915 | Bacteria | 3733 |
| 135 | Ga0207663_10083107 | 3300025916 | Bacteria | 2103 |
| 136 | Ga0207663_10125298 | 3300025916 | Bacteria | 1766 |
| 137 | Ga0207662_10001248 | 3300025918 | Bacteria | 12225 |
| 138 | Ga0207657_10165914 | 3300025919 | Bacteria | 1791 |
| 139 | Ga0207649_10001486 | 3300025920 | Bacteria | 13765 |
| 140 | Ga0207646_10000115 | 3300025922 | Bacteria | 110424 |
| 141 | Ga0207646_10000774 | 3300025922 | Bacteria | 41404 |
| 142 | Ga0207646_10018023 | 3300025922 | Bacteria | 6594 |
| 143 | Ga0207646_10050717 | 3300025922 | Bacteria | 3713 |
| 144 | Ga0207646_10106712 | 3300025922 | Bacteria | 2512 |
| 145 | Ga0207646_10170886 | 3300025922 | Bacteria | 1963 |
| 146 | Ga0207681_10016204 | 3300025923 | Bacteria | 4657 |
| 147 | Ga0207659_10129352 | 3300025926 | Bacteria | 1946 |
| 148 | Ga0207687_10044245 | 3300025927 | Bacteria | 3071 |
| 149 | Ga0207700_10006458 | 3300025928 | Bacteria | 7081 |
| 150 | Ga0207700_10007934 | 3300025928 | Bacteria | 6535 |
| 151 | Ga0207700_10077382 | 3300025928 | Bacteria | 2584 |
| 152 | Ga0207644_10142484 | 3300025931 | Bacteria | 1847 |
| 153 | Ga0207690_10008993 | 3300025932 | Bacteria | 5928 |
| 154 | Ga0207690_10132343 | 3300025932 | Bacteria | 1827 |
| 155 | Ga0207706_10000921 | 3300025933 | Bacteria | 30112 |
| 156 | Ga0207709_10021425 | 3300025935 | Bacteria | 3659 |
| 157 | Ga0207670_10018894 | 3300025936 | Bacteria | 4199 |
| 158 | Ga0207670_10095045 | 3300025936 | Bacteria | 2116 |
| 159 | Ga0207670_10114331 | 3300025936 | Bacteria | 1950 |
| 160 | Ga0207665_10097897 | 3300025939 | Bacteria | 2043 |
| 161 | Ga0207691_10077794 | 3300025940 | Bacteria | 2987 |
| 162 | Ga0207667_10002208 | 3300025949 | Bacteria | 24438 |
| 163 | Ga0207712_10162788 | 3300025961 | Bacteria | 1736 |
| 164 | Ga0207668_10000957 | 3300025972 | Bacteria | 17416 |
| 165 | Ga0207658_10004264 | 3300025986 | Bacteria | 9962 |
| 166 | Ga0207677_10003667 | 3300026023 | Bacteria | 8154 |
| 167 | Ga0207677_10197379 | 3300026023 | Bacteria | 1597 |
| 168 | Ga0207703_10034086 | 3300026035 | Bacteria | 4039 |
| 169 | Ga0207703_10039408 | 3300026035 | Bacteria | 3776 |
| 170 | Ga0207678_10001830 | 3300026067 | Bacteria | 19499 |
| 171 | Ga0207702_10001908 | 3300026078 | Bacteria | 20370 |
| 172 | Ga0207675_100050258 | 3300026118 | Bacteria | 3890 |
| 173 | Ga0207683_10045679 | 3300026121 | Bacteria | 3831 |
| 174 | Ga0209588_1001937 | 3300027671 | Bacteria | 5540 |
| 175 | Ga0268266_10036807 | 3300028379 | Bacteria | 4169 |
| 176 | Ga0268265_10003907 | 3300028380 | Bacteria | 10506 |
| 177 | Ga0268264_10000241 | 3300028381 | Bacteria | 103608 |
| 178 | Ga0268264_10009217 | 3300028381 | Bacteria | 8178 |
| 179 | Ga0268264_10024418 | 3300028381 | Bacteria | 4934 |
| 180 | Ga0307408_100075765 | 3300031548 | Bacteria | 2501 |
| 181 | Ga0373951_0001068 | 3300035091 | Bacteria | 7340 |
| 182 | Ga0373943_0027567 | 3300035170 | Bacteria | 2670 |
| 183 | Ga0373927_0097426 | 3300035695 | Bacteria | 1912 |
| 184 | Ga0373925_0037906 | 3300037068 | Bacteria | 3561 |
| 185 | Ga0395899_0000009 | 3300037312 | Bacteria | 538632 |
| 186 | Ga0395898_0000092 | 3300037466 | Bacteria | 235647 |
| 187 | Ga0395898_0131985 | 3300037466 | Bacteria | 2392 |
| 188 | Ga0395898_0150751 | 3300037466 | Bacteria | 2225 |
| 189 | Ga0436364_1540449 | 3300037853 | Bacteria | 2150 |
| 190 | Ga0395901_0212974 | 3300038443 | Bacteria | 2022 |
| 191 | Ga0242420_000515 | 3300038996 | Bacteria | 4434 |
| 192 | Ga0436365_0646895 | 3300039437 | Bacteria | 2883 |
| 193 | Ga0436365_0763619 | 3300039437 | Bacteria | 54172 |
| 194 | Ga0436365_1195936 | 3300039437 | Bacteria | 50732 |
| 195 | Ga0436360_0098844 | 3300039438 | Bacteria | 4312 |
| 196 | Ga0436360_0289825 | 3300039438 | Bacteria | 5521 |
| 197 | Ga0436360_1159677 | 3300039438 | Bacteria | 1980 |
| 198 | Ga0436361_0004611 | 3300039447 | Bacteria | 2219 |
| 199 | Ga0436361_1032121 | 3300039447 | Bacteria | 3341 |
| 200 | Ga0436363_1653205 | 3300039450 | Bacteria | 8357 |
| 201 | Ga0439454_002699 | 3300042011 | Bacteria | 1902 |
| 202 | Ga0439435_0014222 | 3300042436 | Bacteria | 1964 |
| 203 | Ga0453683_0027625 | 3300044673 | Bacteria | 3596 |
| 204 | Ga0466971_0000008 | 3300044719 | Bacteria | 108703 |
| 205 | Ga0466967_0111019 | 3300045976 | Bacteria | 2519 |
| 206 | Ga0495603_0066903 | 3300046455 | Bacteria | 2116 |
| 207 | Ga0495630_0038307 | 3300046517 | Bacteria | 3586 |
| 208 | Ga0495643_0000502 | 3300046522 | Bacteria | 49323 |
| 209 | Ga0495634_0029264 | 3300046642 | Bacteria | 3814 |
| 210 | Ga0495657_0136946 | 3300046675 | Bacteria | 1529 |
| 211 | Ga0495623_0005768 | 3300046679 | Bacteria | 8079 |
| 212 | Ga0496102_0176284 | 3300048905 | Bacteria | 2013 |
| 213 | Ga0496104_0113773 | 3300048907 | Bacteria | 2595 |
| 214 | Ga0496106_0196626 | 3300048909 | Bacteria | 1604 |
| 215 | Ga0496109_0009879 | 3300048912 | Bacteria | 8148 |
| 216 | Ga0496109_0088294 | 3300048912 | Bacteria | 2865 |
| 217 | Ga0496110_0263404 | 3300048913 | Bacteria | 1569 |
| 218 | Ga0496112_0289069 | 3300048915 | Bacteria | 1585 |
| 219 | Ga0496113_0022863 | 3300048916 | Bacteria | 4429 |
| 220 | Ga0496115_0102322 | 3300048918 | Bacteria | 2349 |
| 221 | Ga0501032_0000253 | 3300049569 | Bacteria | 44609 |
| 222 | Ga0501033_0000006 | 3300049570 | Bacteria | 348953 |
| 223 | Ga0501033_0000187 | 3300049570 | Bacteria | 59491 |
| 224 | Ga0501037_0000371 | 3300049573 | Bacteria | 37418 |
| 225 | Ga0501038_0000686 | 3300049574 | Bacteria | 30094 |
| 226 | Ga0501043_0000273 | 3300049579 | Bacteria | 46526 |
| 227 | Ga0501043_0040594 | 3300049579 | Bacteria | 3657 |
| 228 | Ga0501047_0008825 | 3300049581 | Bacteria | 9512 |
| 229 | Ga0501070_0004810 | 3300049586 | Bacteria | 11546 |
| 230 | Ga0501070_0129527 | 3300049586 | Bacteria | 2084 |
| 231 | Ga0501035_0000004 | 3300049822 | Bacteria | 403650 |
| 232 | Ga0501044_0000566 | 3300049823 | Bacteria | 45002 |
| 233 | Ga0501044_0193165 | 3300049823 | Bacteria | 1997 |
| 234 | nmdc:mga05p37_39519_c1 | 3300050507 | Bacteria | 5793 |
| 235 | Ga0466962_0000004 | 3300061719 | Bacteria | 179133 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046675 | Ga0495657_0136946 | Ga0495657_0136946_308_1516 | 379 |
| 2 | 3300046679 | Ga0495623_0005768 | Ga0495623_0005768_6858_8063 | 380 |
| 3 | 3300009148 | Ga0105243_10121880 | Ga0105243_101218801 | 381 |
| 4 | 3300025932 | Ga0207690_10008993 | Ga0207690_100089938 | 381 |
| 5 | 3300048915 | Ga0496112_0289069 | Ga0496112_0289069_50_1258 | 385 |
| 6 | 3300007265 | Ga0099794_10025778 | Ga0099794_100257781 | 395 |
| 7 | 3300027671 | Ga0209588_1001937 | Ga0209588_10019372 | 424 |
| 8 | 3300044673 | Ga0453683_0027625 | Ga0453683_0027625_1995_3419 | 424 |
| 9 | 3300021384 | Ga0213876_10000104 | Ga0213876_1000010442 | 427 |
| 10 | 3300039437 | Ga0436365_1195936 | Ga0436365_1195936_34674_36131 | 427 |
| 11 | 3300003203 | JGI25406J46586_10000959 | JGI25406J46586_100009597 | 444 |
| 12 | 3300005288 | Ga0065714_10064594 | Ga0065714_1006459416 | 444 |
| 13 | 3300005290 | Ga0065712_10000121 | Ga0065712_1000012117 | 444 |
| 14 | 3300005293 | Ga0065715_10089446 | Ga0065715_1008944610 | 444 |
| 15 | 3300005617 | Ga0068859_100260179 | Ga0068859_1002601792 | 444 |
| 16 | 3300005985 | Ga0081539_10000998 | Ga0081539_1000099817 | 444 |
| 17 | 3300006931 | Ga0097620_100260188 | Ga0097620_1002601882 | 444 |
| 18 | 3300009148 | Ga0105243_10009519 | Ga0105243_100095192 | 444 |
| 19 | 3300011119 | Ga0105246_10094519 | Ga0105246_100945193 | 444 |
| 20 | 3300025935 | Ga0207709_10021425 | Ga0207709_100214256 | 444 |
| 21 | 3300035091 | Ga0373951_0001068 | Ga0373951_0001068_5930_7324 | 444 |
| 22 | 3300038996 | Ga0242420_000515 | Ga0242420_000515_1072_2466 | 444 |
| 23 | 3300048909 | Ga0496106_0196626 | Ga0496106_0196626_193_1581 | 444 |
| 24 | 3300031548 | Ga0307408_100075765 | Ga0307408_1000757653 | 445 |
| 25 | 3300005327 | Ga0070658_10004257 | Ga0070658_100042579 | 446 |
| 26 | 3300025909 | Ga0207705_10003005 | Ga0207705_100030055 | 446 |
| 27 | 3300025922 | Ga0207646_10170886 | Ga0207646_101708861 | 450 |
| 28 | 3300005445 | Ga0070708_100004035 | Ga0070708_1000040358 | 453 |
| 29 | 3300005467 | Ga0070706_100047900 | Ga0070706_1000479002 | 453 |
| 30 | 3300005468 | Ga0070707_100009406 | Ga0070707_1000094065 | 453 |
| 31 | 3300005536 | Ga0070697_100011899 | Ga0070697_1000118994 | 453 |
| 32 | 3300025910 | Ga0207684_10045060 | Ga0207684_100450603 | 453 |
| 33 | 3300025922 | Ga0207646_10018023 | Ga0207646_100180235 | 453 |
| 34 | 3300025901 | Ga0207688_10032270 | Ga0207688_100322703 | 456 |
| 35 | 3300005468 | Ga0070707_100163577 | Ga0070707_1001635773 | 459 |
| 36 | 3300042436 | Ga0439435_0014222 | Ga0439435_0014222_199_1659 | 461 |
| 37 | 3300044719 | Ga0466971_0000008 | Ga0466971_0000008_41664_43112 | 461 |
| 38 | 3300049570 | Ga0501033_0000187 | Ga0501033_0000187_31660_33108 | 461 |
| 39 | 3300049823 | Ga0501044_0193165 | Ga0501044_0193165_20_1468 | 461 |
| 40 | 3300061719 | Ga0466962_0000004 | Ga0466962_0000004_65346_66794 | 461 |
| 41 | 3300049579 | Ga0501043_0040594 | Ga0501043_0040594_517_1965 | 462 |
| 42 | 3300049581 | Ga0501047_0008825 | Ga0501047_0008825_4136_5584 | 462 |
| 43 | 3300049586 | Ga0501070_0004810 | Ga0501070_0004810_7598_9046 | 462 |
| 44 | 3300049822 | Ga0501035_0000004 | Ga0501035_0000004_127000_128448 | 462 |
| 45 | 3300005843 | Ga0068860_100000202 | Ga0068860_10000020216 | 465 |
| 46 | 3300028381 | Ga0268264_10000241 | Ga0268264_1000024129 | 465 |
| 47 | 3300005327 | Ga0070658_10140153 | Ga0070658_101401531 | 466 |
| 48 | 3300005435 | Ga0070714_100140236 | Ga0070714_1001402361 | 466 |
| 49 | 3300005436 | Ga0070713_100006391 | Ga0070713_1000063918 | 466 |
| 50 | 3300005467 | Ga0070706_100000876 | Ga0070706_1000008764 | 466 |
| 51 | 3300005471 | Ga0070698_100007271 | Ga0070698_1000072717 | 466 |
| 52 | 3300005536 | Ga0070697_100048161 | Ga0070697_1000481612 | 466 |
| 53 | 3300005842 | Ga0068858_100047153 | Ga0068858_1000471535 | 466 |
| 54 | 3300009093 | Ga0105240_10000064 | Ga0105240_1000006447 | 466 |
| 55 | 3300009093 | Ga0105240_10178127 | Ga0105240_101781272 | 466 |
| 56 | 3300013306 | Ga0163162_10068848 | Ga0163162_100688482 | 466 |
| 57 | 3300021361 | Ga0213872_10049924 | Ga0213872_100499241 | 466 |
| 58 | 3300025906 | Ga0207699_10128884 | Ga0207699_101288841 | 466 |
| 59 | 3300025909 | Ga0207705_10068468 | Ga0207705_100684682 | 466 |
| 60 | 3300025910 | Ga0207684_10002073 | Ga0207684_1000207312 | 466 |
| 61 | 3300025913 | Ga0207695_10000046 | Ga0207695_10000046131 | 466 |
| 62 | 3300025914 | Ga0207671_10007220 | Ga0207671_100072207 | 466 |
| 63 | 3300025928 | Ga0207700_10006458 | Ga0207700_100064587 | 466 |
| 64 | 3300026035 | Ga0207703_10034086 | Ga0207703_100340865 | 466 |
| 65 | 3300026035 | Ga0207703_10039408 | Ga0207703_100394082 | 466 |
| 66 | 3300037853 | Ga0436364_1540449 | Ga0436364_1540449_338_1795 | 466 |
| 67 | 3300039437 | Ga0436365_0763619 | Ga0436365_0763619_41858_43309 | 466 |
| 68 | 3300039438 | Ga0436360_0098844 | Ga0436360_0098844_57_1517 | 466 |
| 69 | 3300039438 | Ga0436360_0289825 | Ga0436360_0289825_3686_5137 | 466 |
| 70 | 3300039438 | Ga0436360_1159677 | Ga0436360_1159677_110_1561 | 466 |
| 71 | 3300039447 | Ga0436361_0004611 | Ga0436361_0004611_272_1732 | 466 |
| 72 | 3300039447 | Ga0436361_1032121 | Ga0436361_1032121_1087_2559 | 466 |
| 73 | 3300039450 | Ga0436363_1653205 | Ga0436363_1653205_3356_4825 | 466 |
| 74 | 3300046522 | Ga0495643_0000502 | Ga0495643_0000502_5604_7055 | 466 |
| 75 | 3300003320 | rootH2_10016441 | rootH2_1001644143 | 467 |
| 76 | 3300005344 | Ga0070661_100002913 | Ga0070661_1000029135 | 467 |
| 77 | 3300005366 | Ga0070659_100144307 | Ga0070659_1001443072 | 467 |
| 78 | 3300005614 | Ga0068856_100001045 | Ga0068856_10000104512 | 467 |
| 79 | 3300013296 | Ga0157374_10014349 | Ga0157374_1001434910 | 467 |
| 80 | 3300025920 | Ga0207649_10001486 | Ga0207649_100014865 | 467 |
| 81 | 3300025932 | Ga0207690_10132343 | Ga0207690_101323432 | 467 |
| 82 | 3300026078 | Ga0207702_10001908 | Ga0207702_100019082 | 467 |
| 83 | 3300037312 | Ga0395899_0000009 | Ga0395899_0000009_527099_528547 | 467 |
| 84 | 3300037466 | Ga0395898_0000092 | Ga0395898_0000092_149041_150489 | 467 |
| 85 | 3300037466 | Ga0395898_0150751 | Ga0395898_0150751_237_1715 | 467 |
| 86 | 3300038443 | Ga0395901_0212974 | Ga0395901_0212974_451_1929 | 467 |
| 87 | 3300039437 | Ga0436365_0646895 | Ga0436365_0646895_1026_2498 | 467 |
| 88 | 3300049569 | Ga0501032_0000253 | Ga0501032_0000253_31167_32633 | 467 |
| 89 | 3300049570 | Ga0501033_0000006 | Ga0501033_0000006_168210_169676 | 467 |
| 90 | 3300049573 | Ga0501037_0000371 | Ga0501037_0000371_29791_31239 | 467 |
| 91 | 3300049574 | Ga0501038_0000686 | Ga0501038_0000686_16803_18251 | 467 |
| 92 | 3300049579 | Ga0501043_0000273 | Ga0501043_0000273_42940_44388 | 467 |
| 93 | 3300049586 | Ga0501070_0129527 | Ga0501070_0129527_222_1670 | 467 |
| 94 | 3300049823 | Ga0501044_0000566 | Ga0501044_0000566_38575_40023 | 467 |
| 95 | 3300005937 | Ga0081455_10005170 | Ga0081455_1000517012 | 468 |
| 96 | 3300005983 | Ga0081540_1000119 | Ga0081540_100011955 | 468 |
| 97 | 3300013296 | Ga0157374_10000071 | Ga0157374_100000714 | 468 |
| 98 | 3300014969 | Ga0157376_10000562 | Ga0157376_1000056216 | 468 |
| 99 | 3300045976 | Ga0466967_0111019 | Ga0466967_0111019_365_1840 | 468 |
| 100 | 3300005331 | Ga0070670_100093102 | Ga0070670_1000931022 | 469 |
| 101 | 3300005364 | Ga0070673_100183466 | Ga0070673_1001834662 | 469 |
| 102 | 3300005439 | Ga0070711_100020665 | Ga0070711_1000206652 | 469 |
| 103 | 3300005445 | Ga0070708_100032664 | Ga0070708_1000326643 | 469 |
| 104 | 3300005468 | Ga0070707_100042761 | Ga0070707_1000427615 | 469 |
| 105 | 3300005563 | Ga0068855_100033070 | Ga0068855_1000330707 | 469 |
| 106 | 3300005937 | Ga0081455_10001817 | Ga0081455_100018176 | 469 |
| 107 | 3300005937 | Ga0081455_10006042 | Ga0081455_100060422 | 469 |
| 108 | 3300009094 | Ga0111539_10191068 | Ga0111539_101910682 | 469 |
| 109 | 3300009147 | Ga0114129_10031765 | Ga0114129_100317651 | 469 |
| 110 | 3300009147 | Ga0114129_10180326 | Ga0114129_101803264 | 469 |
| 111 | 3300025915 | Ga0207693_10003275 | Ga0207693_1000327512 | 469 |
| 112 | 3300025916 | Ga0207663_10125298 | Ga0207663_101252982 | 469 |
| 113 | 3300025922 | Ga0207646_10000774 | Ga0207646_1000077416 | 469 |
| 114 | 3300025949 | Ga0207667_10002208 | Ga0207667_100022087 | 469 |
| 115 | 3300026067 | Ga0207678_10001830 | Ga0207678_100018308 | 469 |
| 116 | 3300037068 | Ga0373925_0037906 | Ga0373925_0037906_1238_2698 | 469 |
| 117 | 3300046455 | Ga0495603_0066903 | Ga0495603_0066903_46_1524 | 469 |
| 118 | 3300046517 | Ga0495630_0038307 | Ga0495630_0038307_413_1891 | 469 |
| 119 | 3300046642 | Ga0495634_0029264 | Ga0495634_0029264_1544_3022 | 469 |
| 120 | 3300050507 | nmdc:mga05p37_39519_c1 | nmdc:mga05p37_39519_c1_73_1551 | 469 |
| 121 | 3300005289 | Ga0065704_10006019 | Ga0065704_100060193 | 470 |
| 122 | 3300005293 | Ga0065715_10003017 | Ga0065715_100030173 | 470 |
| 123 | 3300005330 | Ga0070690_100081831 | Ga0070690_1000818313 | 470 |
| 124 | 3300005335 | Ga0070666_10073637 | Ga0070666_100736372 | 470 |
| 125 | 3300005445 | Ga0070708_100166620 | Ga0070708_1001666202 | 470 |
| 126 | 3300005458 | Ga0070681_10022094 | Ga0070681_100220943 | 470 |
| 127 | 3300005467 | Ga0070706_100021192 | Ga0070706_1000211927 | 470 |
| 128 | 3300005471 | Ga0070698_100001216 | Ga0070698_1000012167 | 470 |
| 129 | 3300005535 | Ga0070684_100000202 | Ga0070684_10000020233 | 470 |
| 130 | 3300005535 | Ga0070684_100020404 | Ga0070684_1000204046 | 470 |
| 131 | 3300005536 | Ga0070697_100092592 | Ga0070697_1000925921 | 470 |
| 132 | 3300005536 | Ga0070697_100137395 | Ga0070697_1001373952 | 470 |
| 133 | 3300005548 | Ga0070665_100019246 | Ga0070665_1000192466 | 470 |
| 134 | 3300005841 | Ga0068863_100004599 | Ga0068863_1000045993 | 470 |
| 135 | 3300005842 | Ga0068858_100017896 | Ga0068858_1000178962 | 470 |
| 136 | 3300005937 | Ga0081455_10002278 | Ga0081455_1000227815 | 470 |
| 137 | 3300005985 | Ga0081539_10016084 | Ga0081539_100160845 | 470 |
| 138 | 3300005985 | Ga0081539_10024857 | Ga0081539_100248572 | 470 |
| 139 | 3300009098 | Ga0105245_10112097 | Ga0105245_101120972 | 470 |
| 140 | 3300009098 | Ga0105245_10233746 | Ga0105245_102337462 | 470 |
| 141 | 3300013306 | Ga0163162_10322200 | Ga0163162_103222002 | 470 |
| 142 | 3300013308 | Ga0157375_10034699 | Ga0157375_100346991 | 470 |
| 143 | 3300014968 | Ga0157379_10000960 | Ga0157379_1000096019 | 470 |
| 144 | 3300014969 | Ga0157376_10008458 | Ga0157376_100084582 | 470 |
| 145 | 3300014969 | Ga0157376_10035517 | Ga0157376_100355172 | 470 |
| 146 | 3300025315 | Ga0207697_10003150 | Ga0207697_100031502 | 470 |
| 147 | 3300025315 | Ga0207697_10006524 | Ga0207697_100065241 | 470 |
| 148 | 3300025904 | Ga0207647_10002889 | Ga0207647_100028892 | 470 |
| 149 | 3300025910 | Ga0207684_10016950 | Ga0207684_100169502 | 470 |
| 150 | 3300025916 | Ga0207663_10083107 | Ga0207663_100831072 | 470 |
| 151 | 3300025922 | Ga0207646_10106712 | Ga0207646_101067122 | 470 |
| 152 | 3300025928 | Ga0207700_10007934 | Ga0207700_100079343 | 470 |
| 153 | 3300025936 | Ga0207670_10018894 | Ga0207670_100188943 | 470 |
| 154 | 3300025936 | Ga0207670_10095045 | Ga0207670_100950452 | 470 |
| 155 | 3300025939 | Ga0207665_10097897 | Ga0207665_100978972 | 470 |
| 156 | 3300025940 | Ga0207691_10077794 | Ga0207691_100777942 | 470 |
| 157 | 3300026118 | Ga0207675_100050258 | Ga0207675_1000502585 | 470 |
| 158 | 3300026121 | Ga0207683_10045679 | Ga0207683_100456792 | 470 |
| 159 | 3300028381 | Ga0268264_10024418 | Ga0268264_100244185 | 470 |
| 160 | 3300042011 | Ga0439454_002699 | Ga0439454_002699_151_1629 | 470 |
| 161 | 3300048905 | Ga0496102_0176284 | Ga0496102_0176284_526_2001 | 470 |
| 162 | 3300048907 | Ga0496104_0113773 | Ga0496104_0113773_669_2144 | 470 |
| 163 | 3300048912 | Ga0496109_0088294 | Ga0496109_0088294_661_2139 | 470 |
| 164 | 3300003203 | JGI25406J46586_10000016 | JGI25406J46586_1000001650 | 471 |
| 165 | 3300003911 | JGI25405J52794_10000371 | JGI25405J52794_100003714 | 471 |
| 166 | 3300005290 | Ga0065712_10085996 | Ga0065712_100859964 | 471 |
| 167 | 3300005293 | Ga0065715_10093569 | Ga0065715_100935695 | 471 |
| 168 | 3300005295 | Ga0065707_10012648 | Ga0065707_100126482 | 471 |
| 169 | 3300005328 | Ga0070676_10001395 | Ga0070676_100013955 | 471 |
| 170 | 3300005339 | Ga0070660_100075227 | Ga0070660_1000752273 | 471 |
| 171 | 3300005340 | Ga0070689_100059878 | Ga0070689_1000598784 | 471 |
| 172 | 3300005343 | Ga0070687_100000577 | Ga0070687_1000005778 | 471 |
| 173 | 3300005353 | Ga0070669_100011503 | Ga0070669_1000115033 | 471 |
| 174 | 3300005354 | Ga0070675_100001717 | Ga0070675_10000171710 | 471 |
| 175 | 3300005355 | Ga0070671_100134057 | Ga0070671_1001340572 | 471 |
| 176 | 3300005355 | Ga0070671_100140654 | Ga0070671_1001406542 | 471 |
| 177 | 3300005366 | Ga0070659_100003104 | Ga0070659_1000031045 | 471 |
| 178 | 3300005367 | Ga0070667_100001295 | Ga0070667_1000012956 | 471 |
| 179 | 3300005439 | Ga0070711_100028880 | Ga0070711_1000288803 | 471 |
| 180 | 3300005439 | Ga0070711_100116959 | Ga0070711_1001169591 | 471 |
| 181 | 3300005457 | Ga0070662_100021601 | Ga0070662_1000216012 | 471 |
| 182 | 3300005467 | Ga0070706_100000329 | Ga0070706_10000032947 | 471 |
| 183 | 3300005467 | Ga0070706_100049818 | Ga0070706_1000498182 | 471 |
| 184 | 3300005467 | Ga0070706_100098097 | Ga0070706_1000980972 | 471 |
| 185 | 3300005467 | Ga0070706_100202312 | Ga0070706_1002023121 | 471 |
| 186 | 3300005468 | Ga0070707_100000049 | Ga0070707_10000004963 | 471 |
| 187 | 3300005468 | Ga0070707_100092019 | Ga0070707_1000920194 | 471 |
| 188 | 3300005536 | Ga0070697_100009619 | Ga0070697_1000096197 | 471 |
| 189 | 3300005548 | Ga0070665_100012239 | Ga0070665_1000122391 | 471 |
| 190 | 3300005843 | Ga0068860_100005012 | Ga0068860_10000501211 | 471 |
| 191 | 3300005844 | Ga0068862_100004453 | Ga0068862_1000044538 | 471 |
| 192 | 3300005937 | Ga0081455_10002468 | Ga0081455_1000246817 | 471 |
| 193 | 3300005983 | Ga0081540_1018470 | Ga0081540_10184702 | 471 |
| 194 | 3300005985 | Ga0081539_10000383 | Ga0081539_1000038357 | 471 |
| 195 | 3300006028 | Ga0070717_10050584 | Ga0070717_100505844 | 471 |
| 196 | 3300006175 | Ga0070712_100004051 | Ga0070712_1000040516 | 471 |
| 197 | 3300006175 | Ga0070712_100072194 | Ga0070712_1000721942 | 471 |
| 198 | 3300006175 | Ga0070712_100084474 | Ga0070712_1000844742 | 471 |
| 199 | 3300009098 | Ga0105245_10035067 | Ga0105245_100350674 | 471 |
| 200 | 3300009553 | Ga0105249_10004445 | Ga0105249_100044456 | 471 |
| 201 | 3300010375 | Ga0105239_10003699 | Ga0105239_1000369912 | 471 |
| 202 | 3300013296 | Ga0157374_10060605 | Ga0157374_100606054 | 471 |
| 203 | 3300013306 | Ga0163162_10028771 | Ga0163162_100287715 | 471 |
| 204 | 3300025315 | Ga0207697_10000127 | Ga0207697_1000012711 | 471 |
| 205 | 3300025907 | Ga0207645_10000835 | Ga0207645_100008356 | 471 |
| 206 | 3300025910 | Ga0207684_10000401 | Ga0207684_1000040145 | 471 |
| 207 | 3300025910 | Ga0207684_10115788 | Ga0207684_101157882 | 471 |
| 208 | 3300025910 | Ga0207684_10169557 | Ga0207684_101695572 | 471 |
| 209 | 3300025915 | Ga0207693_10039146 | Ga0207693_100391465 | 471 |
| 210 | 3300025918 | Ga0207662_10001248 | Ga0207662_100012488 | 471 |
| 211 | 3300025919 | Ga0207657_10165914 | Ga0207657_101659142 | 471 |
| 212 | 3300025922 | Ga0207646_10000115 | Ga0207646_1000011529 | 471 |
| 213 | 3300025922 | Ga0207646_10050717 | Ga0207646_100507172 | 471 |
| 214 | 3300025923 | Ga0207681_10016204 | Ga0207681_100162042 | 471 |
| 215 | 3300025926 | Ga0207659_10129352 | Ga0207659_101293522 | 471 |
| 216 | 3300025927 | Ga0207687_10044245 | Ga0207687_100442454 | 471 |
| 217 | 3300025928 | Ga0207700_10077382 | Ga0207700_100773821 | 471 |
| 218 | 3300025931 | Ga0207644_10142484 | Ga0207644_101424842 | 471 |
| 219 | 3300025933 | Ga0207706_10000921 | Ga0207706_1000092125 | 471 |
| 220 | 3300025936 | Ga0207670_10114331 | Ga0207670_101143312 | 471 |
| 221 | 3300025961 | Ga0207712_10162788 | Ga0207712_101627882 | 471 |
| 222 | 3300025972 | Ga0207668_10000957 | Ga0207668_100009578 | 471 |
| 223 | 3300025986 | Ga0207658_10004264 | Ga0207658_100042648 | 471 |
| 224 | 3300026023 | Ga0207677_10003667 | Ga0207677_100036675 | 471 |
| 225 | 3300026023 | Ga0207677_10197379 | Ga0207677_101973792 | 471 |
| 226 | 3300028379 | Ga0268266_10036807 | Ga0268266_100368074 | 471 |
| 227 | 3300028380 | Ga0268265_10003907 | Ga0268265_100039072 | 471 |
| 228 | 3300028381 | Ga0268264_10009217 | Ga0268264_100092176 | 471 |
| 229 | 3300035170 | Ga0373943_0027567 | Ga0373943_0027567_934_2409 | 471 |
| 230 | 3300035695 | Ga0373927_0097426 | Ga0373927_0097426_334_1809 | 471 |
| 231 | 3300037466 | Ga0395898_0131985 | Ga0395898_0131985_225_1703 | 471 |
| 232 | 3300048912 | Ga0496109_0009879 | Ga0496109_0009879_279_1757 | 471 |
| 233 | 3300048913 | Ga0496110_0263404 | Ga0496110_0263404_79_1557 | 471 |
| 234 | 3300048916 | Ga0496113_0022863 | Ga0496113_0022863_624_2102 | 471 |
| 235 | 3300048918 | Ga0496115_0102322 | Ga0496115_0102322_146_1624 | 471 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wj3-assembly2.cif.gz_D | crystal structure of the asparagine transamidosome from pseudomonas aeruginosa | 0.8385 | 9 | 468 |
| 3h0r-assembly7.cif.gz_S | structure of trna-dependent amidotransferase gatcab from aquifex aeolicus | 0.8264 | 10 | 471 |
| 3kfu-assembly1.cif.gz_H | crystal structure of the transamidosome | 0.823 | 11 | 462 |
| 2gi3-assembly1.cif.gz_A-2 | crystal structure of glutamyl-trna(gln) amidotransferase subunit a (tm1272) from thermotoga maritima at 1.80 a resolution | 0.8209 | 5 | 460 |
| 3ip4-assembly1.cif.gz_A | the high resolution structure of gatcab | 0.8182 | 2 | 467 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gi3A01 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.8592 | 5 | 460 | 3.90.1300.10 |
| 4wj3D00 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.8385 | 9 | 468 | 3.90.1300.10 |
| af_Q9LI77_43_527_3.90.1300.10 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.8352 | 11 | 460 | 3.90.1300.10 |
| 2dqnA00 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.8298 | 10 | 466 | 3.90.1300.10 |
| 3kfuH00 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.823 | 11 | 462 | 3.90.1300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A239IVB4-F1-model_v4 | Amidase | 0.9352 | 9 | 119 |
GO:0003824
|
| AF-A0A017HRX4-F1-model_v4 | Aspartyl-tRNA(Asn) amidotransferase subunit A / Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.6, EC 6.3.5.7) | 0.9226 | 5 | 295 |
GO:0016740
GO:0050566 GO:0050567 |
| AF-A0A3M1FVW2-F1-model_v4 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA | 0.9191 | 10 | 292 |
GO:0016740
|
| AF-A0A2G8MCC4-F1-model_v4 | deleted | 0.9179 | 1 | 297 |
|
| AF-A0A7X4AB54-F1-model_v4 | deleted | 0.9126 | 2 | 301 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar