F347896

General Info

Members Datasets Scaffolds Average Seq Length
235 148 235 474

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100049818|Ga0070706_1000498182
Length 494
Sequence MSPADLPGLNIADLQALLRRREVSPRDVLEALRARIEEIDPKIDAYLSLDFEAALKEAEKVDVNLPLGGVPIAIKDIINVAGQPCTCGSKILANYRAMYDATVIRKLRAAGAIPFGKTNMDEFAMGSSTENSSVKPTRNPWDLSRVPGGSGALGTDTGGSIRQPAAVSGVVGVKPTYGRVSRFGVTAFASSLDQVGPLAKTVRDAGLIMGAIAGHDPLDSTSLNEPVPNYPASLNGDLAAGRVRVAAATGLRGVRLGLPKEYMIEGIDSQVKSAIDAAVQHFISLGAEVIDLTLPHTEYGIAVYYFLATAEASANLARFDGVRYGYRAENPRDILDHYGRTRGDGFGPEVKRRIILGTYVLSSGYYDAYYLRAQKVRELIRQDFATAFEKVDAIVSPTSPVPAFKLGERTADPLQMYLADIFTVPGNLAGICGISLPCGFAKIDPPEDGFAVANSVQLPIGLQLLGKALDEARIFQIARAYEQSTDWHKAKPSL

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
120 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.83
Rhizosphere 93.19
Stem 0
Stem Tuber 0
Unclassified 2.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000016 3300003203 Bacteria 91056
2 JGI25406J46586_10000959 3300003203 Bacteria 13554
3 rootH2_10016441 3300003320 Bacteria 43831
4 JGI25405J52794_10000371 3300003911 Bacteria 6334
5 Ga0065714_10064594 3300005288 Bacteria 30899
6 Ga0065704_10006019 3300005289 Bacteria 4241
7 Ga0065712_10000121 3300005290 Bacteria 103063
8 Ga0065712_10085996 3300005290 Bacteria 2662
9 Ga0065715_10003017 3300005293 Bacteria 4229
10 Ga0065715_10089446 3300005293 Bacteria 10135
11 Ga0065715_10093569 3300005293 Bacteria 4636
12 Ga0065707_10012648 3300005295 Bacteria 4177
13 Ga0070658_10004257 3300005327 Bacteria 11696
14 Ga0070658_10140153 3300005327 Bacteria 2020
15 Ga0070676_10001395 3300005328 Bacteria 12191
16 Ga0070690_100081831 3300005330 Bacteria 2113
17 Ga0070670_100093102 3300005331 Bacteria 2592
18 Ga0070666_10073637 3300005335 Bacteria 2327
19 Ga0070660_100075227 3300005339 Bacteria 2644
20 Ga0070689_100059878 3300005340 Bacteria 2960
21 Ga0070687_100000577 3300005343 Bacteria 12201
22 Ga0070661_100002913 3300005344 Bacteria 11789
23 Ga0070669_100011503 3300005353 Bacteria 6281
24 Ga0070675_100001717 3300005354 Bacteria 16184
25 Ga0070671_100134057 3300005355 Bacteria 2087
26 Ga0070671_100140654 3300005355 Bacteria 2037
27 Ga0070673_100183466 3300005364 Bacteria 1792
28 Ga0070659_100003104 3300005366 Bacteria 11813
29 Ga0070659_100144307 3300005366 Bacteria 1939
30 Ga0070667_100001295 3300005367 Bacteria 22619
31 Ga0070714_100140236 3300005435 Bacteria 2169
32 Ga0070713_100006391 3300005436 Bacteria 8164
33 Ga0070711_100020665 3300005439 Bacteria 4248
34 Ga0070711_100028880 3300005439 Bacteria 3653
35 Ga0070711_100116959 3300005439 Bacteria 1965
36 Ga0070708_100004035 3300005445 Bacteria 11538
37 Ga0070708_100032664 3300005445 Bacteria 4516
38 Ga0070708_100166620 3300005445 Bacteria 2055
39 Ga0070662_100021601 3300005457 Bacteria 4396
40 Ga0070681_10022094 3300005458 Bacteria 6385
41 Ga0070706_100000329 3300005467 Bacteria 57770
42 Ga0070706_100000876 3300005467 Bacteria 33053
43 Ga0070706_100021192 3300005467 Bacteria 5985
44 Ga0070706_100047900 3300005467 Bacteria 3945
45 Ga0070706_100049818 3300005467 Bacteria 3864
46 Ga0070706_100098097 3300005467 Bacteria 2722
47 Ga0070706_100202312 3300005467 Bacteria 1855
48 Ga0070707_100000049 3300005468 Bacteria 102972
49 Ga0070707_100009406 3300005468 Bacteria 9071
50 Ga0070707_100042761 3300005468 Bacteria 4338
51 Ga0070707_100092019 3300005468 Bacteria 2936
52 Ga0070707_100163577 3300005468 Bacteria 2168
53 Ga0070698_100001216 3300005471 Bacteria 28652
54 Ga0070698_100007271 3300005471 Bacteria 11993
55 Ga0070684_100000202 3300005535 Bacteria 41508
56 Ga0070684_100020404 3300005535 Bacteria 5498
57 Ga0070697_100009619 3300005536 Bacteria 7554
58 Ga0070697_100011899 3300005536 Bacteria 6811
59 Ga0070697_100048161 3300005536 Bacteria 3456
60 Ga0070697_100092592 3300005536 Bacteria 2501
61 Ga0070697_100137395 3300005536 Bacteria 2053
62 Ga0070665_100012239 3300005548 Bacteria 8648
63 Ga0070665_100019246 3300005548 Bacteria 6849
64 Ga0068855_100033070 3300005563 Bacteria 6174
65 Ga0068856_100001045 3300005614 Bacteria 29378
66 Ga0068859_100260179 3300005617 Bacteria 1826
67 Ga0068863_100004599 3300005841 Bacteria 13595
68 Ga0068858_100017896 3300005842 Bacteria 6636
69 Ga0068858_100047153 3300005842 Bacteria 3995
70 Ga0068860_100000202 3300005843 Bacteria 94520
71 Ga0068860_100005012 3300005843 Bacteria 13483
72 Ga0068862_100004453 3300005844 Bacteria 11818
73 Ga0081455_10001817 3300005937 Bacteria 25709
74 Ga0081455_10002278 3300005937 Bacteria 22898
75 Ga0081455_10002468 3300005937 Bacteria 21998
76 Ga0081455_10005170 3300005937 Bacteria 14364
77 Ga0081455_10006042 3300005937 Bacteria 13104
78 Ga0081540_1000119 3300005983 Bacteria 84020
79 Ga0081540_1018470 3300005983 Bacteria 4275
80 Ga0081539_10000383 3300005985 Bacteria 95995
81 Ga0081539_10000998 3300005985 Bacteria 52505
82 Ga0081539_10016084 3300005985 Bacteria 5377
83 Ga0081539_10024857 3300005985 Bacteria 3873
84 Ga0070717_10050584 3300006028 Bacteria 3416
85 Ga0070712_100004051 3300006175 Bacteria 8996
86 Ga0070712_100072194 3300006175 Bacteria 2472
87 Ga0070712_100084474 3300006175 Bacteria 2308
88 Ga0097620_100260188 3300006931 Bacteria 1826
89 Ga0099794_10025778 3300007265 Bacteria 2712
90 Ga0105240_10000064 3300009093 Bacteria 215932
91 Ga0105240_10178127 3300009093 Bacteria 2512
92 Ga0111539_10191068 3300009094 Bacteria 2389
93 Ga0105245_10035067 3300009098 Bacteria 4451
94 Ga0105245_10112097 3300009098 Bacteria 2538
95 Ga0105245_10233746 3300009098 Bacteria 1779
96 Ga0114129_10031765 3300009147 Bacteria 7464
97 Ga0114129_10180326 3300009147 Bacteria 2874
98 Ga0105243_10009519 3300009148 Bacteria 7396
99 Ga0105243_10121880 3300009148 Bacteria 2200
100 Ga0105249_10004445 3300009553 Bacteria 12130
101 Ga0105239_10003699 3300010375 Bacteria 18629
102 Ga0105246_10094519 3300011119 Bacteria 2162
103 Ga0157374_10000071 3300013296 Bacteria 102927
104 Ga0157374_10014349 3300013296 Bacteria 6934
105 Ga0157374_10060605 3300013296 Bacteria 3542
106 Ga0163162_10028771 3300013306 Bacteria 5501
107 Ga0163162_10068848 3300013306 Bacteria 3591
108 Ga0163162_10322200 3300013306 Bacteria 1678
109 Ga0157375_10034699 3300013308 Bacteria 4808
110 Ga0157379_10000960 3300014968 Bacteria 23399
111 Ga0157376_10000562 3300014969 Bacteria 23988
112 Ga0157376_10008458 3300014969 Bacteria 7430
113 Ga0157376_10035517 3300014969 Bacteria 4032
114 Ga0213872_10049924 3300021361 Bacteria 1900
115 Ga0213876_10000104 3300021384 Bacteria 93860
116 Ga0207697_10000127 3300025315 Bacteria 36502
117 Ga0207697_10003150 3300025315 Bacteria 8224
118 Ga0207697_10006524 3300025315 Bacteria 5267
119 Ga0207688_10032270 3300025901 Bacteria 2894
120 Ga0207647_10002889 3300025904 Bacteria 12941
121 Ga0207699_10128884 3300025906 Bacteria 1647
122 Ga0207645_10000835 3300025907 Bacteria 25692
123 Ga0207705_10003005 3300025909 Bacteria 12869
124 Ga0207705_10068468 3300025909 Bacteria 2570
125 Ga0207684_10000401 3300025910 Bacteria 57950
126 Ga0207684_10002073 3300025910 Bacteria 20631
127 Ga0207684_10016950 3300025910 Bacteria 6258
128 Ga0207684_10045060 3300025910 Bacteria 3741
129 Ga0207684_10115788 3300025910 Bacteria 2297
130 Ga0207684_10169557 3300025910 Bacteria 1881
131 Ga0207695_10000046 3300025913 Bacteria 430344
132 Ga0207671_10007220 3300025914 Bacteria 9677
133 Ga0207693_10003275 3300025915 Bacteria 13865
134 Ga0207693_10039146 3300025915 Bacteria 3733
135 Ga0207663_10083107 3300025916 Bacteria 2103
136 Ga0207663_10125298 3300025916 Bacteria 1766
137 Ga0207662_10001248 3300025918 Bacteria 12225
138 Ga0207657_10165914 3300025919 Bacteria 1791
139 Ga0207649_10001486 3300025920 Bacteria 13765
140 Ga0207646_10000115 3300025922 Bacteria 110424
141 Ga0207646_10000774 3300025922 Bacteria 41404
142 Ga0207646_10018023 3300025922 Bacteria 6594
143 Ga0207646_10050717 3300025922 Bacteria 3713
144 Ga0207646_10106712 3300025922 Bacteria 2512
145 Ga0207646_10170886 3300025922 Bacteria 1963
146 Ga0207681_10016204 3300025923 Bacteria 4657
147 Ga0207659_10129352 3300025926 Bacteria 1946
148 Ga0207687_10044245 3300025927 Bacteria 3071
149 Ga0207700_10006458 3300025928 Bacteria 7081
150 Ga0207700_10007934 3300025928 Bacteria 6535
151 Ga0207700_10077382 3300025928 Bacteria 2584
152 Ga0207644_10142484 3300025931 Bacteria 1847
153 Ga0207690_10008993 3300025932 Bacteria 5928
154 Ga0207690_10132343 3300025932 Bacteria 1827
155 Ga0207706_10000921 3300025933 Bacteria 30112
156 Ga0207709_10021425 3300025935 Bacteria 3659
157 Ga0207670_10018894 3300025936 Bacteria 4199
158 Ga0207670_10095045 3300025936 Bacteria 2116
159 Ga0207670_10114331 3300025936 Bacteria 1950
160 Ga0207665_10097897 3300025939 Bacteria 2043
161 Ga0207691_10077794 3300025940 Bacteria 2987
162 Ga0207667_10002208 3300025949 Bacteria 24438
163 Ga0207712_10162788 3300025961 Bacteria 1736
164 Ga0207668_10000957 3300025972 Bacteria 17416
165 Ga0207658_10004264 3300025986 Bacteria 9962
166 Ga0207677_10003667 3300026023 Bacteria 8154
167 Ga0207677_10197379 3300026023 Bacteria 1597
168 Ga0207703_10034086 3300026035 Bacteria 4039
169 Ga0207703_10039408 3300026035 Bacteria 3776
170 Ga0207678_10001830 3300026067 Bacteria 19499
171 Ga0207702_10001908 3300026078 Bacteria 20370
172 Ga0207675_100050258 3300026118 Bacteria 3890
173 Ga0207683_10045679 3300026121 Bacteria 3831
174 Ga0209588_1001937 3300027671 Bacteria 5540
175 Ga0268266_10036807 3300028379 Bacteria 4169
176 Ga0268265_10003907 3300028380 Bacteria 10506
177 Ga0268264_10000241 3300028381 Bacteria 103608
178 Ga0268264_10009217 3300028381 Bacteria 8178
179 Ga0268264_10024418 3300028381 Bacteria 4934
180 Ga0307408_100075765 3300031548 Bacteria 2501
181 Ga0373951_0001068 3300035091 Bacteria 7340
182 Ga0373943_0027567 3300035170 Bacteria 2670
183 Ga0373927_0097426 3300035695 Bacteria 1912
184 Ga0373925_0037906 3300037068 Bacteria 3561
185 Ga0395899_0000009 3300037312 Bacteria 538632
186 Ga0395898_0000092 3300037466 Bacteria 235647
187 Ga0395898_0131985 3300037466 Bacteria 2392
188 Ga0395898_0150751 3300037466 Bacteria 2225
189 Ga0436364_1540449 3300037853 Bacteria 2150
190 Ga0395901_0212974 3300038443 Bacteria 2022
191 Ga0242420_000515 3300038996 Bacteria 4434
192 Ga0436365_0646895 3300039437 Bacteria 2883
193 Ga0436365_0763619 3300039437 Bacteria 54172
194 Ga0436365_1195936 3300039437 Bacteria 50732
195 Ga0436360_0098844 3300039438 Bacteria 4312
196 Ga0436360_0289825 3300039438 Bacteria 5521
197 Ga0436360_1159677 3300039438 Bacteria 1980
198 Ga0436361_0004611 3300039447 Bacteria 2219
199 Ga0436361_1032121 3300039447 Bacteria 3341
200 Ga0436363_1653205 3300039450 Bacteria 8357
201 Ga0439454_002699 3300042011 Bacteria 1902
202 Ga0439435_0014222 3300042436 Bacteria 1964
203 Ga0453683_0027625 3300044673 Bacteria 3596
204 Ga0466971_0000008 3300044719 Bacteria 108703
205 Ga0466967_0111019 3300045976 Bacteria 2519
206 Ga0495603_0066903 3300046455 Bacteria 2116
207 Ga0495630_0038307 3300046517 Bacteria 3586
208 Ga0495643_0000502 3300046522 Bacteria 49323
209 Ga0495634_0029264 3300046642 Bacteria 3814
210 Ga0495657_0136946 3300046675 Bacteria 1529
211 Ga0495623_0005768 3300046679 Bacteria 8079
212 Ga0496102_0176284 3300048905 Bacteria 2013
213 Ga0496104_0113773 3300048907 Bacteria 2595
214 Ga0496106_0196626 3300048909 Bacteria 1604
215 Ga0496109_0009879 3300048912 Bacteria 8148
216 Ga0496109_0088294 3300048912 Bacteria 2865
217 Ga0496110_0263404 3300048913 Bacteria 1569
218 Ga0496112_0289069 3300048915 Bacteria 1585
219 Ga0496113_0022863 3300048916 Bacteria 4429
220 Ga0496115_0102322 3300048918 Bacteria 2349
221 Ga0501032_0000253 3300049569 Bacteria 44609
222 Ga0501033_0000006 3300049570 Bacteria 348953
223 Ga0501033_0000187 3300049570 Bacteria 59491
224 Ga0501037_0000371 3300049573 Bacteria 37418
225 Ga0501038_0000686 3300049574 Bacteria 30094
226 Ga0501043_0000273 3300049579 Bacteria 46526
227 Ga0501043_0040594 3300049579 Bacteria 3657
228 Ga0501047_0008825 3300049581 Bacteria 9512
229 Ga0501070_0004810 3300049586 Bacteria 11546
230 Ga0501070_0129527 3300049586 Bacteria 2084
231 Ga0501035_0000004 3300049822 Bacteria 403650
232 Ga0501044_0000566 3300049823 Bacteria 45002
233 Ga0501044_0193165 3300049823 Bacteria 1997
234 nmdc:mga05p37_39519_c1 3300050507 Bacteria 5793
235 Ga0466962_0000004 3300061719 Bacteria 179133

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0136946 Ga0495657_0136946_308_1516 379
2 3300046679 Ga0495623_0005768 Ga0495623_0005768_6858_8063 380
3 3300009148 Ga0105243_10121880 Ga0105243_101218801 381
4 3300025932 Ga0207690_10008993 Ga0207690_100089938 381
5 3300048915 Ga0496112_0289069 Ga0496112_0289069_50_1258 385
6 3300007265 Ga0099794_10025778 Ga0099794_100257781 395
7 3300027671 Ga0209588_1001937 Ga0209588_10019372 424
8 3300044673 Ga0453683_0027625 Ga0453683_0027625_1995_3419 424
9 3300021384 Ga0213876_10000104 Ga0213876_1000010442 427
10 3300039437 Ga0436365_1195936 Ga0436365_1195936_34674_36131 427
11 3300003203 JGI25406J46586_10000959 JGI25406J46586_100009597 444
12 3300005288 Ga0065714_10064594 Ga0065714_1006459416 444
13 3300005290 Ga0065712_10000121 Ga0065712_1000012117 444
14 3300005293 Ga0065715_10089446 Ga0065715_1008944610 444
15 3300005617 Ga0068859_100260179 Ga0068859_1002601792 444
16 3300005985 Ga0081539_10000998 Ga0081539_1000099817 444
17 3300006931 Ga0097620_100260188 Ga0097620_1002601882 444
18 3300009148 Ga0105243_10009519 Ga0105243_100095192 444
19 3300011119 Ga0105246_10094519 Ga0105246_100945193 444
20 3300025935 Ga0207709_10021425 Ga0207709_100214256 444
21 3300035091 Ga0373951_0001068 Ga0373951_0001068_5930_7324 444
22 3300038996 Ga0242420_000515 Ga0242420_000515_1072_2466 444
23 3300048909 Ga0496106_0196626 Ga0496106_0196626_193_1581 444
24 3300031548 Ga0307408_100075765 Ga0307408_1000757653 445
25 3300005327 Ga0070658_10004257 Ga0070658_100042579 446
26 3300025909 Ga0207705_10003005 Ga0207705_100030055 446
27 3300025922 Ga0207646_10170886 Ga0207646_101708861 450
28 3300005445 Ga0070708_100004035 Ga0070708_1000040358 453
29 3300005467 Ga0070706_100047900 Ga0070706_1000479002 453
30 3300005468 Ga0070707_100009406 Ga0070707_1000094065 453
31 3300005536 Ga0070697_100011899 Ga0070697_1000118994 453
32 3300025910 Ga0207684_10045060 Ga0207684_100450603 453
33 3300025922 Ga0207646_10018023 Ga0207646_100180235 453
34 3300025901 Ga0207688_10032270 Ga0207688_100322703 456
35 3300005468 Ga0070707_100163577 Ga0070707_1001635773 459
36 3300042436 Ga0439435_0014222 Ga0439435_0014222_199_1659 461
37 3300044719 Ga0466971_0000008 Ga0466971_0000008_41664_43112 461
38 3300049570 Ga0501033_0000187 Ga0501033_0000187_31660_33108 461
39 3300049823 Ga0501044_0193165 Ga0501044_0193165_20_1468 461
40 3300061719 Ga0466962_0000004 Ga0466962_0000004_65346_66794 461
41 3300049579 Ga0501043_0040594 Ga0501043_0040594_517_1965 462
42 3300049581 Ga0501047_0008825 Ga0501047_0008825_4136_5584 462
43 3300049586 Ga0501070_0004810 Ga0501070_0004810_7598_9046 462
44 3300049822 Ga0501035_0000004 Ga0501035_0000004_127000_128448 462
45 3300005843 Ga0068860_100000202 Ga0068860_10000020216 465
46 3300028381 Ga0268264_10000241 Ga0268264_1000024129 465
47 3300005327 Ga0070658_10140153 Ga0070658_101401531 466
48 3300005435 Ga0070714_100140236 Ga0070714_1001402361 466
49 3300005436 Ga0070713_100006391 Ga0070713_1000063918 466
50 3300005467 Ga0070706_100000876 Ga0070706_1000008764 466
51 3300005471 Ga0070698_100007271 Ga0070698_1000072717 466
52 3300005536 Ga0070697_100048161 Ga0070697_1000481612 466
53 3300005842 Ga0068858_100047153 Ga0068858_1000471535 466
54 3300009093 Ga0105240_10000064 Ga0105240_1000006447 466
55 3300009093 Ga0105240_10178127 Ga0105240_101781272 466
56 3300013306 Ga0163162_10068848 Ga0163162_100688482 466
57 3300021361 Ga0213872_10049924 Ga0213872_100499241 466
58 3300025906 Ga0207699_10128884 Ga0207699_101288841 466
59 3300025909 Ga0207705_10068468 Ga0207705_100684682 466
60 3300025910 Ga0207684_10002073 Ga0207684_1000207312 466
61 3300025913 Ga0207695_10000046 Ga0207695_10000046131 466
62 3300025914 Ga0207671_10007220 Ga0207671_100072207 466
63 3300025928 Ga0207700_10006458 Ga0207700_100064587 466
64 3300026035 Ga0207703_10034086 Ga0207703_100340865 466
65 3300026035 Ga0207703_10039408 Ga0207703_100394082 466
66 3300037853 Ga0436364_1540449 Ga0436364_1540449_338_1795 466
67 3300039437 Ga0436365_0763619 Ga0436365_0763619_41858_43309 466
68 3300039438 Ga0436360_0098844 Ga0436360_0098844_57_1517 466
69 3300039438 Ga0436360_0289825 Ga0436360_0289825_3686_5137 466
70 3300039438 Ga0436360_1159677 Ga0436360_1159677_110_1561 466
71 3300039447 Ga0436361_0004611 Ga0436361_0004611_272_1732 466
72 3300039447 Ga0436361_1032121 Ga0436361_1032121_1087_2559 466
73 3300039450 Ga0436363_1653205 Ga0436363_1653205_3356_4825 466
74 3300046522 Ga0495643_0000502 Ga0495643_0000502_5604_7055 466
75 3300003320 rootH2_10016441 rootH2_1001644143 467
76 3300005344 Ga0070661_100002913 Ga0070661_1000029135 467
77 3300005366 Ga0070659_100144307 Ga0070659_1001443072 467
78 3300005614 Ga0068856_100001045 Ga0068856_10000104512 467
79 3300013296 Ga0157374_10014349 Ga0157374_1001434910 467
80 3300025920 Ga0207649_10001486 Ga0207649_100014865 467
81 3300025932 Ga0207690_10132343 Ga0207690_101323432 467
82 3300026078 Ga0207702_10001908 Ga0207702_100019082 467
83 3300037312 Ga0395899_0000009 Ga0395899_0000009_527099_528547 467
84 3300037466 Ga0395898_0000092 Ga0395898_0000092_149041_150489 467
85 3300037466 Ga0395898_0150751 Ga0395898_0150751_237_1715 467
86 3300038443 Ga0395901_0212974 Ga0395901_0212974_451_1929 467
87 3300039437 Ga0436365_0646895 Ga0436365_0646895_1026_2498 467
88 3300049569 Ga0501032_0000253 Ga0501032_0000253_31167_32633 467
89 3300049570 Ga0501033_0000006 Ga0501033_0000006_168210_169676 467
90 3300049573 Ga0501037_0000371 Ga0501037_0000371_29791_31239 467
91 3300049574 Ga0501038_0000686 Ga0501038_0000686_16803_18251 467
92 3300049579 Ga0501043_0000273 Ga0501043_0000273_42940_44388 467
93 3300049586 Ga0501070_0129527 Ga0501070_0129527_222_1670 467
94 3300049823 Ga0501044_0000566 Ga0501044_0000566_38575_40023 467
95 3300005937 Ga0081455_10005170 Ga0081455_1000517012 468
96 3300005983 Ga0081540_1000119 Ga0081540_100011955 468
97 3300013296 Ga0157374_10000071 Ga0157374_100000714 468
98 3300014969 Ga0157376_10000562 Ga0157376_1000056216 468
99 3300045976 Ga0466967_0111019 Ga0466967_0111019_365_1840 468
100 3300005331 Ga0070670_100093102 Ga0070670_1000931022 469
101 3300005364 Ga0070673_100183466 Ga0070673_1001834662 469
102 3300005439 Ga0070711_100020665 Ga0070711_1000206652 469
103 3300005445 Ga0070708_100032664 Ga0070708_1000326643 469
104 3300005468 Ga0070707_100042761 Ga0070707_1000427615 469
105 3300005563 Ga0068855_100033070 Ga0068855_1000330707 469
106 3300005937 Ga0081455_10001817 Ga0081455_100018176 469
107 3300005937 Ga0081455_10006042 Ga0081455_100060422 469
108 3300009094 Ga0111539_10191068 Ga0111539_101910682 469
109 3300009147 Ga0114129_10031765 Ga0114129_100317651 469
110 3300009147 Ga0114129_10180326 Ga0114129_101803264 469
111 3300025915 Ga0207693_10003275 Ga0207693_1000327512 469
112 3300025916 Ga0207663_10125298 Ga0207663_101252982 469
113 3300025922 Ga0207646_10000774 Ga0207646_1000077416 469
114 3300025949 Ga0207667_10002208 Ga0207667_100022087 469
115 3300026067 Ga0207678_10001830 Ga0207678_100018308 469
116 3300037068 Ga0373925_0037906 Ga0373925_0037906_1238_2698 469
117 3300046455 Ga0495603_0066903 Ga0495603_0066903_46_1524 469
118 3300046517 Ga0495630_0038307 Ga0495630_0038307_413_1891 469
119 3300046642 Ga0495634_0029264 Ga0495634_0029264_1544_3022 469
120 3300050507 nmdc:mga05p37_39519_c1 nmdc:mga05p37_39519_c1_73_1551 469
121 3300005289 Ga0065704_10006019 Ga0065704_100060193 470
122 3300005293 Ga0065715_10003017 Ga0065715_100030173 470
123 3300005330 Ga0070690_100081831 Ga0070690_1000818313 470
124 3300005335 Ga0070666_10073637 Ga0070666_100736372 470
125 3300005445 Ga0070708_100166620 Ga0070708_1001666202 470
126 3300005458 Ga0070681_10022094 Ga0070681_100220943 470
127 3300005467 Ga0070706_100021192 Ga0070706_1000211927 470
128 3300005471 Ga0070698_100001216 Ga0070698_1000012167 470
129 3300005535 Ga0070684_100000202 Ga0070684_10000020233 470
130 3300005535 Ga0070684_100020404 Ga0070684_1000204046 470
131 3300005536 Ga0070697_100092592 Ga0070697_1000925921 470
132 3300005536 Ga0070697_100137395 Ga0070697_1001373952 470
133 3300005548 Ga0070665_100019246 Ga0070665_1000192466 470
134 3300005841 Ga0068863_100004599 Ga0068863_1000045993 470
135 3300005842 Ga0068858_100017896 Ga0068858_1000178962 470
136 3300005937 Ga0081455_10002278 Ga0081455_1000227815 470
137 3300005985 Ga0081539_10016084 Ga0081539_100160845 470
138 3300005985 Ga0081539_10024857 Ga0081539_100248572 470
139 3300009098 Ga0105245_10112097 Ga0105245_101120972 470
140 3300009098 Ga0105245_10233746 Ga0105245_102337462 470
141 3300013306 Ga0163162_10322200 Ga0163162_103222002 470
142 3300013308 Ga0157375_10034699 Ga0157375_100346991 470
143 3300014968 Ga0157379_10000960 Ga0157379_1000096019 470
144 3300014969 Ga0157376_10008458 Ga0157376_100084582 470
145 3300014969 Ga0157376_10035517 Ga0157376_100355172 470
146 3300025315 Ga0207697_10003150 Ga0207697_100031502 470
147 3300025315 Ga0207697_10006524 Ga0207697_100065241 470
148 3300025904 Ga0207647_10002889 Ga0207647_100028892 470
149 3300025910 Ga0207684_10016950 Ga0207684_100169502 470
150 3300025916 Ga0207663_10083107 Ga0207663_100831072 470
151 3300025922 Ga0207646_10106712 Ga0207646_101067122 470
152 3300025928 Ga0207700_10007934 Ga0207700_100079343 470
153 3300025936 Ga0207670_10018894 Ga0207670_100188943 470
154 3300025936 Ga0207670_10095045 Ga0207670_100950452 470
155 3300025939 Ga0207665_10097897 Ga0207665_100978972 470
156 3300025940 Ga0207691_10077794 Ga0207691_100777942 470
157 3300026118 Ga0207675_100050258 Ga0207675_1000502585 470
158 3300026121 Ga0207683_10045679 Ga0207683_100456792 470
159 3300028381 Ga0268264_10024418 Ga0268264_100244185 470
160 3300042011 Ga0439454_002699 Ga0439454_002699_151_1629 470
161 3300048905 Ga0496102_0176284 Ga0496102_0176284_526_2001 470
162 3300048907 Ga0496104_0113773 Ga0496104_0113773_669_2144 470
163 3300048912 Ga0496109_0088294 Ga0496109_0088294_661_2139 470
164 3300003203 JGI25406J46586_10000016 JGI25406J46586_1000001650 471
165 3300003911 JGI25405J52794_10000371 JGI25405J52794_100003714 471
166 3300005290 Ga0065712_10085996 Ga0065712_100859964 471
167 3300005293 Ga0065715_10093569 Ga0065715_100935695 471
168 3300005295 Ga0065707_10012648 Ga0065707_100126482 471
169 3300005328 Ga0070676_10001395 Ga0070676_100013955 471
170 3300005339 Ga0070660_100075227 Ga0070660_1000752273 471
171 3300005340 Ga0070689_100059878 Ga0070689_1000598784 471
172 3300005343 Ga0070687_100000577 Ga0070687_1000005778 471
173 3300005353 Ga0070669_100011503 Ga0070669_1000115033 471
174 3300005354 Ga0070675_100001717 Ga0070675_10000171710 471
175 3300005355 Ga0070671_100134057 Ga0070671_1001340572 471
176 3300005355 Ga0070671_100140654 Ga0070671_1001406542 471
177 3300005366 Ga0070659_100003104 Ga0070659_1000031045 471
178 3300005367 Ga0070667_100001295 Ga0070667_1000012956 471
179 3300005439 Ga0070711_100028880 Ga0070711_1000288803 471
180 3300005439 Ga0070711_100116959 Ga0070711_1001169591 471
181 3300005457 Ga0070662_100021601 Ga0070662_1000216012 471
182 3300005467 Ga0070706_100000329 Ga0070706_10000032947 471
183 3300005467 Ga0070706_100049818 Ga0070706_1000498182 471
184 3300005467 Ga0070706_100098097 Ga0070706_1000980972 471
185 3300005467 Ga0070706_100202312 Ga0070706_1002023121 471
186 3300005468 Ga0070707_100000049 Ga0070707_10000004963 471
187 3300005468 Ga0070707_100092019 Ga0070707_1000920194 471
188 3300005536 Ga0070697_100009619 Ga0070697_1000096197 471
189 3300005548 Ga0070665_100012239 Ga0070665_1000122391 471
190 3300005843 Ga0068860_100005012 Ga0068860_10000501211 471
191 3300005844 Ga0068862_100004453 Ga0068862_1000044538 471
192 3300005937 Ga0081455_10002468 Ga0081455_1000246817 471
193 3300005983 Ga0081540_1018470 Ga0081540_10184702 471
194 3300005985 Ga0081539_10000383 Ga0081539_1000038357 471
195 3300006028 Ga0070717_10050584 Ga0070717_100505844 471
196 3300006175 Ga0070712_100004051 Ga0070712_1000040516 471
197 3300006175 Ga0070712_100072194 Ga0070712_1000721942 471
198 3300006175 Ga0070712_100084474 Ga0070712_1000844742 471
199 3300009098 Ga0105245_10035067 Ga0105245_100350674 471
200 3300009553 Ga0105249_10004445 Ga0105249_100044456 471
201 3300010375 Ga0105239_10003699 Ga0105239_1000369912 471
202 3300013296 Ga0157374_10060605 Ga0157374_100606054 471
203 3300013306 Ga0163162_10028771 Ga0163162_100287715 471
204 3300025315 Ga0207697_10000127 Ga0207697_1000012711 471
205 3300025907 Ga0207645_10000835 Ga0207645_100008356 471
206 3300025910 Ga0207684_10000401 Ga0207684_1000040145 471
207 3300025910 Ga0207684_10115788 Ga0207684_101157882 471
208 3300025910 Ga0207684_10169557 Ga0207684_101695572 471
209 3300025915 Ga0207693_10039146 Ga0207693_100391465 471
210 3300025918 Ga0207662_10001248 Ga0207662_100012488 471
211 3300025919 Ga0207657_10165914 Ga0207657_101659142 471
212 3300025922 Ga0207646_10000115 Ga0207646_1000011529 471
213 3300025922 Ga0207646_10050717 Ga0207646_100507172 471
214 3300025923 Ga0207681_10016204 Ga0207681_100162042 471
215 3300025926 Ga0207659_10129352 Ga0207659_101293522 471
216 3300025927 Ga0207687_10044245 Ga0207687_100442454 471
217 3300025928 Ga0207700_10077382 Ga0207700_100773821 471
218 3300025931 Ga0207644_10142484 Ga0207644_101424842 471
219 3300025933 Ga0207706_10000921 Ga0207706_1000092125 471
220 3300025936 Ga0207670_10114331 Ga0207670_101143312 471
221 3300025961 Ga0207712_10162788 Ga0207712_101627882 471
222 3300025972 Ga0207668_10000957 Ga0207668_100009578 471
223 3300025986 Ga0207658_10004264 Ga0207658_100042648 471
224 3300026023 Ga0207677_10003667 Ga0207677_100036675 471
225 3300026023 Ga0207677_10197379 Ga0207677_101973792 471
226 3300028379 Ga0268266_10036807 Ga0268266_100368074 471
227 3300028380 Ga0268265_10003907 Ga0268265_100039072 471
228 3300028381 Ga0268264_10009217 Ga0268264_100092176 471
229 3300035170 Ga0373943_0027567 Ga0373943_0027567_934_2409 471
230 3300035695 Ga0373927_0097426 Ga0373927_0097426_334_1809 471
231 3300037466 Ga0395898_0131985 Ga0395898_0131985_225_1703 471
232 3300048912 Ga0496109_0009879 Ga0496109_0009879_279_1757 471
233 3300048913 Ga0496110_0263404 Ga0496110_0263404_79_1557 471
234 3300048916 Ga0496113_0022863 Ga0496113_0022863_624_2102 471
235 3300048918 Ga0496115_0102322 Ga0496115_0102322_146_1624 471

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

27

475

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wj3-assembly2.cif.gz_D crystal structure of the asparagine transamidosome from pseudomonas aeruginosa 0.8385 9 468
3h0r-assembly7.cif.gz_S structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.8264 10 471
3kfu-assembly1.cif.gz_H crystal structure of the transamidosome 0.823 11 462
2gi3-assembly1.cif.gz_A-2 crystal structure of glutamyl-trna(gln) amidotransferase subunit a (tm1272) from thermotoga maritima at 1.80 a resolution 0.8209 5 460
3ip4-assembly1.cif.gz_A the high resolution structure of gatcab 0.8182 2 467
ID Description Score Start End Superfamily
2gi3A01 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8592 5 460 3.90.1300.10
4wj3D00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8385 9 468 3.90.1300.10
af_Q9LI77_43_527_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8352 11 460 3.90.1300.10
2dqnA00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8298 10 466 3.90.1300.10
3kfuH00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.823 11 462 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A239IVB4-F1-model_v4 Amidase 0.9352 9 119 GO:0003824
AF-A0A017HRX4-F1-model_v4 Aspartyl-tRNA(Asn) amidotransferase subunit A / Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.6, EC 6.3.5.7) 0.9226 5 295 GO:0016740
GO:0050566
GO:0050567
AF-A0A3M1FVW2-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA 0.9191 10 292 GO:0016740
AF-A0A2G8MCC4-F1-model_v4 deleted 0.9179 1 297
AF-A0A7X4AB54-F1-model_v4 deleted 0.9126 2 301

Feature Viewer

pLDDT pTM Quality
78.19 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map