F347874

General Info

Members Datasets Scaffolds Average Seq Length
235 177 470 252

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100006839|Ga0070708_1000068398
Length 294
Sequence VTLDAMPERTPAPAPAAGVAMRTGAIPDDQLLVKARAVTKRFGGLLAVSDVNFDIPRGAIVSLIGPNGAGKTTFFNMITGLYLPSSGSIEFDGKPIVTTSGNKIRGKKPHEVAALGIGRTFQNIRLFGTMTALDNVRVGANVHLRSRWWDAALRTPRMLNEETDNRAEAMEILRLVELEDRADAWARSLPYGDQRRLEIARALATRPKLLLLDEPTAGMNASETRDVTSFIRRLRAELNLTVLLIEHDMRVVMGISDRVTVLDHGQVISEGAPAEVRADPKVIEAYLGRGAAEA

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 2738543017 Bacillus sp. OV186 Isolate Unclassified
174 2857586860 Bacillus sp. R-71935 Isolate Unclassified
175 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
176 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
177 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 0
Isolates 2.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.85
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 3.83
Rhizosphere 90.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100006839 3300005445 Bacteria 9092
2 JGI25406J46586_10002973 3300003203 Bacteria 8003
3 JGI25407J50210_10000611 3300003373 Bacteria 7315
4 Ga0065704_10177950 3300005289 Bacteria 1253
5 Ga0070658_10019486 3300005327 Bacteria 5433
6 Ga0070670_100053853 3300005331 Bacteria 3454
7 Ga0068869_100014783 3300005334 Bacteria 5221
8 Ga0068869_100189709 3300005334 Bacteria 1616
9 Ga0070666_10276196 3300005335 Bacteria 1194
10 Ga0070689_100031415 3300005340 Bacteria 4035
11 Ga0070691_10007148 3300005341 Bacteria 5116
12 Ga0070687_100042167 3300005343 Bacteria 2311
13 Ga0070687_100053434 3300005343 Bacteria 2101
14 Ga0070675_100251890 3300005354 Bacteria 1546
15 Ga0070671_100349532 3300005355 Bacteria 1262
16 Ga0070674_100159988 3300005356 Bacteria 1708
17 Ga0070688_100030032 3300005365 Bacteria 3259
18 Ga0070709_10178084 3300005434 Bacteria 1491
19 Ga0070714_100105627 3300005435 Bacteria 2487
20 Ga0070700_100012013 3300005441 Bacteria 4813
21 Ga0070694_100040520 3300005444 Bacteria 3105
22 Ga0070685_10061166 3300005466 Bacteria 2205
23 Ga0070707_100001188 3300005468 Bacteria 25628
24 Ga0070707_100023060 3300005468 Bacteria 5888
25 Ga0070698_100036666 3300005471 Bacteria 5063
26 Ga0070699_100001987 3300005518 Bacteria 18452
27 Ga0070686_100013008 3300005544 Bacteria 4751
28 Ga0070695_100001879 3300005545 Bacteria 11875
29 Ga0070704_100558050 3300005549 Bacteria 1001
30 Ga0068855_100560457 3300005563 Bacteria 1236
31 Ga0068857_100024012 3300005577 Bacteria 5366
32 Ga0068857_100239495 3300005577 Bacteria 1661
33 Ga0068859_100137225 3300005617 Bacteria 2519
34 Ga0068859_100144958 3300005617 Bacteria 2449
35 Ga0068864_100001834 3300005618 Bacteria 17468
36 Ga0068864_100370686 3300005618 Bacteria 1355
37 Ga0068861_100043193 3300005719 Bacteria 3382
38 Ga0068861_100059147 3300005719 Bacteria 2933
39 Ga0068870_10149392 3300005840 Bacteria 1375
40 Ga0068863_100046048 3300005841 Bacteria 4139
41 Ga0068858_100220556 3300005842 Bacteria 1796
42 Ga0068858_100364249 3300005842 Bacteria 1386
43 Ga0068858_100480433 3300005842 Bacteria 1199
44 Ga0068860_100182025 3300005843 Bacteria 2031
45 Ga0068860_100498117 3300005843 Bacteria 1216
46 Ga0081538_10007367 3300005981 Bacteria 9529
47 Ga0081539_10000756 3300005985 Bacteria 64265
48 Ga0081539_10004244 3300005985 Bacteria 16099
49 Ga0070717_10004181 3300006028 Bacteria 10403
50 Ga0070717_10005663 3300006028 Bacteria 9127
51 Ga0068871_100734185 3300006358 Bacteria 907
52 Ga0075433_10002653 3300006852 Bacteria 13652
53 Ga0075434_100008564 3300006871 Bacteria 9515
54 Ga0075434_100186269 3300006871 Bacteria 2096
55 Ga0075434_100615544 3300006871 Bacteria 1105
56 Ga0097620_100137231 3300006931 Bacteria 2519
57 Ga0097620_100144961 3300006931 Bacteria 2449
58 Ga0075435_100009882 3300007076 Bacteria 6944
59 Ga0075435_100080920 3300007076 Bacteria 2668
60 Ga0075435_100164232 3300007076 Bacteria 1872
61 Ga0075435_100484839 3300007076 Bacteria 1068
62 Ga0105245_10049688 3300009098 Bacteria 3757
63 Ga0105245_10168450 3300009098 Bacteria 2084
64 Ga0105247_10003210 3300009101 Bacteria 10771
65 Ga0105247_10008139 3300009101 Bacteria 6404
66 Ga0105247_10111210 3300009101 Bacteria 1764
67 Ga0114129_10077787 3300009147 Bacteria 4614
68 Ga0114129_10293010 3300009147 Bacteria 2171
69 Ga0105243_10031682 3300009148 Bacteria 4078
70 Ga0105241_10023830 3300009174 Bacteria 4541
71 Ga0105248_10150086 3300009177 Bacteria 2629
72 Ga0105237_10000013 3300009545 Bacteria 297699
73 Ga0105238_10038046 3300009551 Bacteria 4888
74 Ga0105249_10666691 3300009553 Bacteria 1099
75 Ga0105249_10829285 3300009553 Bacteria 990
76 Ga0105239_10234417 3300010375 Bacteria 2060
77 Ga0105246_10016495 3300011119 Bacteria 4678
78 Ga0105246_10074662 3300011119 Bacteria 2398
79 Ga0157374_10017601 3300013296 Bacteria 6293
80 Ga0163162_10873058 3300013306 Bacteria 1014
81 Ga0157375_10141647 3300013308 Bacteria 2532
82 Ga0157380_10212329 3300014326 Bacteria 1726
83 Ga0157380_10253039 3300014326 Bacteria 1595
84 Ga0157380_10586190 3300014326 Bacteria 1100
85 Ga0157379_10198768 3300014968 Bacteria 1812
86 Ga0213875_10078904 3300021388 Bacteria 1536
87 Ga0209130_1027062 3300025284 Bacteria 1222
88 Ga0209676_1000692 3300025292 Bacteria 47476
89 Ga0209025_1000127 3300025294 Bacteria 200766
90 Ga0209025_1001964 3300025294 Bacteria 23680
91 Ga0207682_10045723 3300025893 Bacteria 1797
92 Ga0207710_10001192 3300025900 Bacteria 13179
93 Ga0207710_10064867 3300025900 Bacteria 1664
94 Ga0207680_10211681 3300025903 Bacteria 1325
95 Ga0207680_10244814 3300025903 Bacteria 1237
96 Ga0207643_10008690 3300025908 Bacteria 5449
97 Ga0207654_10029906 3300025911 Bacteria 2986
98 Ga0207671_10000417 3300025914 Bacteria 59088
99 Ga0207662_10047901 3300025918 Bacteria 2532
100 Ga0207646_10000895 3300025922 Bacteria 38392
101 Ga0207646_10002008 3300025922 Bacteria 24463
102 Ga0207694_10021455 3300025924 Bacteria 4895
103 Ga0207650_10033334 3300025925 Bacteria 3729
104 Ga0207687_10012609 3300025927 Bacteria 5521
105 Ga0207687_10322011 3300025927 Bacteria 1252
106 Ga0207704_10402162 3300025938 Bacteria 1081
107 Ga0207691_10166958 3300025940 Bacteria 1928
108 Ga0207711_10059312 3300025941 Bacteria 3295
109 Ga0207689_10005556 3300025942 Bacteria 11257
110 Ga0207689_10007447 3300025942 Bacteria 9593
111 Ga0207651_10050660 3300025960 Bacteria 2821
112 Ga0207677_10351151 3300026023 Bacteria 1236
113 Ga0207703_10395003 3300026035 Bacteria 1282
114 Ga0207703_10482074 3300026035 Bacteria 1162
115 Ga0207639_10073803 3300026041 Bacteria 2676
116 Ga0207708_10015113 3300026075 Bacteria 5783
117 Ga0207641_10366658 3300026088 Bacteria 1376
118 Ga0207676_10005976 3300026095 Bacteria 8582
119 Ga0207674_10005763 3300026116 Bacteria 14692
120 Ga0207674_10014569 3300026116 Bacteria 8677
121 Ga0207675_100081382 3300026118 Bacteria 3036
122 Ga0207675_100175455 3300026118 Bacteria 2050
123 Ga0210002_1005603 3300027617 Bacteria 1887
124 Ga0209983_1003629 3300027665 Bacteria 3273
125 Ga0209966_1016956 3300027695 Bacteria 1383
126 Ga0209998_10013469 3300027717 Bacteria 1702
127 Ga0209974_10003933 3300027876 Bacteria 5313
128 Ga0209974_10007236 3300027876 Bacteria 3831
129 Ga0207428_10063380 3300027907 Bacteria 2920
130 Ga0268265_10378670 3300028380 Bacteria 1301
131 Ga0268264_10116317 3300028381 Bacteria 2350
132 Ga0265327_10021348 3300031251 Bacteria 3910
133 Ga0307513_10038935 3300031456 Bacteria 5275
134 Ga0307409_100164032 3300031995 Bacteria 1947
135 Ga0373935_0108748 3300035692 Bacteria 1838
136 Ga0373927_0069817 3300035695 Bacteria 2274
137 Ga0373947_0108614 3300035725 Bacteria 1751
138 Ga0373937_0287141 3300036401 Bacteria 1554
139 Ga0395899_0106139 3300037312 Bacteria 2023
140 Ga0395900_0095214 3300037418 Bacteria 3059
141 Ga0395898_0048689 3300037466 Bacteria 4155
142 Ga0395898_0236501 3300037466 Bacteria 1742
143 Ga0436364_0596925 3300037853 Bacteria 2473
144 Ga0436364_0902891 3300037853 Bacteria 10758
145 Ga0395901_0076030 3300038443 Bacteria 3503
146 Ga0395901_0114523 3300038443 Bacteria 2832
147 Ga0395901_0214578 3300038443 Bacteria 2013
148 Ga0436363_1204138 3300039450 Bacteria 954
149 Ga0436362_0153498 3300039453 Bacteria 6533
150 Ga0451802_0718495 3300041460 Bacteria 886
151 Ga0453684_0020551 3300044712 Bacteria 9946
152 Ga0451576_0017616 3300045051 Bacteria 7850
153 Ga0451576_0177043 3300045051 Bacteria 2227
154 Ga0451576_0782853 3300045051 Bacteria 1002
155 Ga0495592_0001343 3300046454 Bacteria 17024
156 Ga0495603_0119822 3300046455 Bacteria 1534
157 Ga0495591_031613 3300046458 Bacteria 1586
158 Ga0495651_0195011 3300046462 Bacteria 1422
159 Ga0495580_0161676 3300046472 Bacteria 1550
160 Ga0495580_0422918 3300046472 Bacteria 896
161 Ga0495584_0059578 3300046491 Bacteria 1920
162 Ga0495584_0190386 3300046491 Bacteria 1043
163 Ga0495585_0013914 3300046492 Bacteria 4700
164 Ga0495594_0178180 3300046499 Bacteria 1210
165 Ga0495618_0168891 3300046514 Bacteria 1392
166 Ga0495628_0000931 3300046516 Bacteria 26852
167 Ga0495652_0010373 3300046529 Bacteria 8443
168 Ga0495586_0287879 3300046535 Bacteria 941
169 Ga0495621_0007466 3300046539 Bacteria 3238
170 Ga0495645_0000592 3300046543 Bacteria 24955
171 Ga0495633_0032747 3300046558 Bacteria 2510
172 Ga0495647_0000561 3300046681 Bacteria 10941
173 Ga0495658_0021190 3300046683 Bacteria 3424
174 Ga0495613_0134830 3300046689 Bacteria 1767
175 Ga0495670_0069472 3300046691 Bacteria 1781
176 Ga0495672_0173863 3300047320 Bacteria 1096
177 Ga0495602_0364666 3300048088 Bacteria 1039
178 Ga0496101_0797012 3300048904 Bacteria 745
179 Ga0496105_0173829 3300048908 Bacteria 1765
180 Ga0496107_0327900 3300048910 Bacteria 1139
181 Ga0496108_0356033 3300048911 Bacteria 1277
182 Ga0496110_0061406 3300048913 Bacteria 3317
183 Ga0496111_0091773 3300048914 Bacteria 2226
184 Ga0496112_0121802 3300048915 Bacteria 2579
185 Ga0496112_0703950 3300048915 Bacteria 938
186 Ga0501032_0005680 3300049569 Bacteria 9241
187 Ga0501033_0124956 3300049570 Bacteria 1865
188 Ga0501034_0000608 3300049571 Bacteria 56256
189 Ga0501034_0113970 3300049571 Bacteria 2692
190 Ga0501034_0922248 3300049571 Bacteria 760
191 Ga0501036_0020683 3300049572 Bacteria 5528
192 Ga0501037_0022277 3300049573 Bacteria 4687
193 Ga0501038_0017722 3300049574 Bacteria 6436
194 Ga0501039_0018523 3300049575 Bacteria 5346
195 Ga0501042_0054960 3300049578 Bacteria 2840
196 Ga0501043_0015581 3300049579 Bacteria 5957
197 Ga0501046_0016368 3300049580 Bacteria 6212
198 Ga0501046_0017155 3300049580 Bacteria 6050
199 Ga0501047_0105900 3300049581 Bacteria 2692
200 Ga0501048_0059209 3300049582 Bacteria 2714
201 Ga0501067_0022515 3300049583 Bacteria 3487
202 Ga0501068_0044778 3300049584 Bacteria 2665
203 Ga0501069_0017531 3300049585 Bacteria 3856
204 Ga0501070_0020515 3300049586 Bacteria 5542
205 Ga0501071_0356520 3300049587 Bacteria 1113
206 Ga0501072_0183194 3300049588 Bacteria 1671
207 Ga0501073_0004147 3300049589 Bacteria 10867
208 Ga0501074_0006780 3300049590 Bacteria 8267
209 Ga0501080_0097171 3300049742 Bacteria 2734
210 Ga0501083_0018680 3300049744 Bacteria 4829
211 Ga0501083_0041448 3300049744 Bacteria 3122
212 Ga0501035_0012591 3300049822 Bacteria 7816
213 Ga0501044_0426622 3300049823 Bacteria 1235
214 nmdc:mga05p37_129788_c1 3300050507 Bacteria 3093
215 nmdc:mga05p37_235672_c1 3300050507 Bacteria 2203
216 nmdc:mga08y16_8138_c1 3300050511 Bacteria 10969
217 nmdc:mga0n895_11329_c1 3300050512 Bacteria 7947
218 nmdc:mga0n895_172730_c1 3300050512 Bacteria 2193
219 nmdc:mga0n895_404879_c1 3300050512 Bacteria 1380
220 nmdc:mga0n895_654475_c1 3300050512 Bacteria 1049
221 nmdc:mga0n895_94483_c1 3300050512 Bacteria 2994
222 nmdc:mga0rr50_29781_c2 3300050513 Bacteria 2667
223 nmdc:mga0rr50_367281_c1 3300050513 Bacteria 1212
224 nmdc:mga0rr50_45389_c1 3300050513 Bacteria 3229
225 nmdc:mga0rr50_581542_c1 3300050513 Bacteria 954
226 nmdc:mga0a205_5515_c1 3300050515 Bacteria 11397
227 Ga0495601_0019138 3300053077 Bacteria 4173
228 Ga0501084_0255222 3300054114 Bacteria 1480
229 Ga0501082_0098556 3300060353 Bacteria 2527
230 Ga0501082_0260099 3300060353 Bacteria 1510
231 2739268241 2738543017 Bacteria 4271950
232 2857588311 2857586860 Bacteria 4354574
233 2984530837 2984527788 Bacteria 5288478
234 2984536946 2984532647 Bacteria 5288506
235 8033686266 8033684223 Bacteria 6906479
236 Ga0070708_100006839
237 JGI25406J46586_10002973
238 JGI25407J50210_10000611
239 Ga0065704_10177950
240 Ga0070658_10019486
241 Ga0070670_100053853
242 Ga0068869_100014783
243 Ga0068869_100189709
244 Ga0070666_10276196
245 Ga0070689_100031415
246 Ga0070691_10007148
247 Ga0070687_100042167
248 Ga0070687_100053434
249 Ga0070675_100251890
250 Ga0070671_100349532
251 Ga0070674_100159988
252 Ga0070688_100030032
253 Ga0070709_10178084
254 Ga0070714_100105627
255 Ga0070700_100012013
256 Ga0070694_100040520
257 Ga0070685_10061166
258 Ga0070707_100001188
259 Ga0070707_100023060
260 Ga0070698_100036666
261 Ga0070699_100001987
262 Ga0070686_100013008
263 Ga0070695_100001879
264 Ga0070704_100558050
265 Ga0068855_100560457
266 Ga0068857_100024012
267 Ga0068857_100239495
268 Ga0068859_100137225
269 Ga0068859_100144958
270 Ga0068864_100001834
271 Ga0068864_100370686
272 Ga0068861_100043193
273 Ga0068861_100059147
274 Ga0068870_10149392
275 Ga0068863_100046048
276 Ga0068858_100220556
277 Ga0068858_100364249
278 Ga0068858_100480433
279 Ga0068860_100182025
280 Ga0068860_100498117
281 Ga0081538_10007367
282 Ga0081539_10000756
283 Ga0081539_10004244
284 Ga0070717_10004181
285 Ga0070717_10005663
286 Ga0068871_100734185
287 Ga0075433_10002653
288 Ga0075434_100008564
289 Ga0075434_100186269
290 Ga0075434_100615544
291 Ga0097620_100137231
292 Ga0097620_100144961
293 Ga0075435_100009882
294 Ga0075435_100080920
295 Ga0075435_100164232
296 Ga0075435_100484839
297 Ga0105245_10049688
298 Ga0105245_10168450
299 Ga0105247_10003210
300 Ga0105247_10008139
301 Ga0105247_10111210
302 Ga0114129_10077787
303 Ga0114129_10293010
304 Ga0105243_10031682
305 Ga0105241_10023830
306 Ga0105248_10150086
307 Ga0105237_10000013
308 Ga0105238_10038046
309 Ga0105249_10666691
310 Ga0105249_10829285
311 Ga0105239_10234417
312 Ga0105246_10016495
313 Ga0105246_10074662
314 Ga0157374_10017601
315 Ga0163162_10873058
316 Ga0157375_10141647
317 Ga0157380_10212329
318 Ga0157380_10253039
319 Ga0157380_10586190
320 Ga0157379_10198768
321 Ga0213875_10078904
322 Ga0209130_1027062
323 Ga0209676_1000692
324 Ga0209025_1000127
325 Ga0209025_1001964
326 Ga0207682_10045723
327 Ga0207710_10001192
328 Ga0207710_10064867
329 Ga0207680_10211681
330 Ga0207680_10244814
331 Ga0207643_10008690
332 Ga0207654_10029906
333 Ga0207671_10000417
334 Ga0207662_10047901
335 Ga0207646_10000895
336 Ga0207646_10002008
337 Ga0207694_10021455
338 Ga0207650_10033334
339 Ga0207687_10012609
340 Ga0207687_10322011
341 Ga0207704_10402162
342 Ga0207691_10166958
343 Ga0207711_10059312
344 Ga0207689_10005556
345 Ga0207689_10007447
346 Ga0207651_10050660
347 Ga0207677_10351151
348 Ga0207703_10395003
349 Ga0207703_10482074
350 Ga0207639_10073803
351 Ga0207708_10015113
352 Ga0207641_10366658
353 Ga0207676_10005976
354 Ga0207674_10005763
355 Ga0207674_10014569
356 Ga0207675_100081382
357 Ga0207675_100175455
358 Ga0210002_1005603
359 Ga0209983_1003629
360 Ga0209966_1016956
361 Ga0209998_10013469
362 Ga0209974_10003933
363 Ga0209974_10007236
364 Ga0207428_10063380
365 Ga0268265_10378670
366 Ga0268264_10116317
367 Ga0265327_10021348
368 Ga0307513_10038935
369 Ga0307409_100164032
370 Ga0373935_0108748
371 Ga0373927_0069817
372 Ga0373947_0108614
373 Ga0373937_0287141
374 Ga0395899_0106139
375 Ga0395900_0095214
376 Ga0395898_0048689
377 Ga0395898_0236501
378 Ga0436364_0596925
379 Ga0436364_0902891
380 Ga0395901_0076030
381 Ga0395901_0114523
382 Ga0395901_0214578
383 Ga0436363_1204138
384 Ga0436362_0153498
385 Ga0451802_0718495
386 Ga0453684_0020551
387 Ga0451576_0017616
388 Ga0451576_0177043
389 Ga0451576_0782853
390 Ga0495592_0001343
391 Ga0495603_0119822
392 Ga0495591_031613
393 Ga0495651_0195011
394 Ga0495580_0161676
395 Ga0495580_0422918
396 Ga0495584_0059578
397 Ga0495584_0190386
398 Ga0495585_0013914
399 Ga0495594_0178180
400 Ga0495618_0168891
401 Ga0495628_0000931
402 Ga0495652_0010373
403 Ga0495586_0287879
404 Ga0495621_0007466
405 Ga0495645_0000592
406 Ga0495633_0032747
407 Ga0495647_0000561
408 Ga0495658_0021190
409 Ga0495613_0134830
410 Ga0495670_0069472
411 Ga0495672_0173863
412 Ga0495602_0364666
413 Ga0496101_0797012
414 Ga0496105_0173829
415 Ga0496107_0327900
416 Ga0496108_0356033
417 Ga0496110_0061406
418 Ga0496111_0091773
419 Ga0496112_0121802
420 Ga0496112_0703950
421 Ga0501032_0005680
422 Ga0501033_0124956
423 Ga0501034_0000608
424 Ga0501034_0113970
425 Ga0501034_0922248
426 Ga0501036_0020683
427 Ga0501037_0022277
428 Ga0501038_0017722
429 Ga0501039_0018523
430 Ga0501042_0054960
431 Ga0501043_0015581
432 Ga0501046_0016368
433 Ga0501046_0017155
434 Ga0501047_0105900
435 Ga0501048_0059209
436 Ga0501067_0022515
437 Ga0501068_0044778
438 Ga0501069_0017531
439 Ga0501070_0020515
440 Ga0501071_0356520
441 Ga0501072_0183194
442 Ga0501073_0004147
443 Ga0501074_0006780
444 Ga0501080_0097171
445 Ga0501083_0018680
446 Ga0501083_0041448
447 Ga0501035_0012591
448 Ga0501044_0426622
449 nmdc:mga05p37_129788_c1
450 nmdc:mga05p37_235672_c1
451 nmdc:mga08y16_8138_c1
452 nmdc:mga0n895_11329_c1
453 nmdc:mga0n895_172730_c1
454 nmdc:mga0n895_404879_c1
455 nmdc:mga0n895_654475_c1
456 nmdc:mga0n895_94483_c1
457 nmdc:mga0rr50_29781_c2
458 nmdc:mga0rr50_367281_c1
459 nmdc:mga0rr50_45389_c1
460 nmdc:mga0rr50_581542_c1
461 nmdc:mga0a205_5515_c1
462 Ga0495601_0019138
463 Ga0501084_0255222
464 Ga0501082_0098556
465 Ga0501082_0260099
466 2739268241
467 2857588311
468 2984530837
469 2984536946
470 8033686266

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

266

292

0.95

PF00005

ABC_tran

ABC transporter

48

217

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9266 5 248
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.917 1 239
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9163 1 239
7osf-assembly1.cif.gz_B abc transporter complex nosdfyl, r-domain 1 0.9138 3 242
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9114 5 248
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9628 4 250 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9442 4 250 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9322 2 68 3.40.50.300
af_Q2FXB7_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9275 3 235 3.40.50.300
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9265 4 251 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A435TXS8-F1-model_v4 ABC transporter ATP-binding protein 0.9756 3 250 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A6B2TAT5-F1-model_v4 ATP-binding cassette domain-containing protein 0.974 5 239 GO:0005524
GO:0005886
GO:0016887
AF-A0A1G7CL76-F1-model_v4 Amino acid/amide ABC transporter membrane protein 2, HAAT family /amino acid/amide ABC transporter ATP-binding protein 1, HAAT family 0.9717 3 250 GO:0005524
GO:0005886
GO:0015658
GO:0016887
AF-A0A7W3T3T6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9667 6 250 GO:0005524
GO:0005886
GO:0016887
AF-A0A7V4Y2Z9-F1-model_v4 Branched-chain amino acid ABC transporter ATP-binding protein/permease 0.9636 2 250 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Map