F347525

General Info

Members Datasets Scaffolds Average Seq Length
234 187 202 346

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0080572|Ga0501073_0080572_354_1466
Length 370
Sequence MTPPKLYIQDVTLRDGMHAIRHRFGIDHVKAIARALDEAKVDAIEIAHGDGLSGSSFNYGFGACTDRDWIAAVAETVRHAKLTTLLLPGIGTIADLRTAHGLGVRSVRIATHCTEADIASQHIEAARKLDMDVSGFLMMSQMVPADALARQAKLMESYGAHCVYVTDSGGALTMDGVAERLVAYDKVLDPKTQRGIHAHHNLSLGVANSIVAVQNGAVRIDASLAGMGAGAGNAPLEVFIAAADLHGWRHGCDLFKLMDAAEDLVRPLQDRPVRVDRETLSLGYAGVYSSFLRHAERAAEIYEVDVRAILLELGRRRMVGGQEDMIVDVALDLAGAGSRGRLAAGVPGPAGERRGASTDEIDNRAERQHN

Samples

Sample ID Description Type Environment
1 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
2 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
3 2519103095 Burkholderia sp. KJ006 Isolate Nodule
4 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
5 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
6 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
7 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
8 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
9 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
10 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
11 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
12 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
13 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
14 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
15 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
16 2842747753 Variovorax sp. R-72060 Isolate Unclassified
17 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
18 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
19 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
20 2929520902 Variovorax beijingensis 502 Isolate Unclassified
21 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
22 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
23 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
24 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
25 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
69 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
70 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
109 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
110 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
111 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
166 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
171 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
172 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
175 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
176 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
180 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
181 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
182 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
183 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
184 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
185 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
186 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
187 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.32
Metatranscriptomes 0
Isolates 13.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.25
Nodule 3.42
Rhizoplane 6.41
Rhizosphere 56.84
Stem 0
Stem Tuber 0
Unclassified 20.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003439 3300001904 Bacteria 2747
2 JGI24741J21665_1003289 3300001915 Bacteria 3892
3 JGI24740J21852_10010930 3300001979 Bacteria 3470
4 JGI24740J21852_10020662 3300001979 Bacteria 2292
5 rootH1_10031295 3300003323 Bacteria 1425
6 Ga0055532_1000364 3300003758 Bacteria 23736
7 Ga0055541_1000304 3300003841 Bacteria 16368
8 Ga0055541_1003447 3300003841 Bacteria 2976
9 Ga0070676_10055301 3300005328 Bacteria 2342
10 Ga0070683_100096482 3300005329 Bacteria 2781
11 Ga0070682_100001802 3300005337 Bacteria 11965
12 Ga0070661_100149001 3300005344 Bacteria 1768
13 Ga0070668_100007291 3300005347 Bacteria 8204
14 Ga0070668_100119152 3300005347 Bacteria 2108
15 Ga0070673_100033849 3300005364 Bacteria 3862
16 Ga0070663_100019673 3300005455 Bacteria 4457
17 Ga0070663_100082574 3300005455 Bacteria 2364
18 Ga0070662_100103911 3300005457 Bacteria 2155
19 Ga0070681_10058319 3300005458 Bacteria 3841
20 Ga0068867_100003076 3300005459 Bacteria 11754
21 Ga0068855_100019061 3300005563 Bacteria 8249
22 Ga0068855_100110490 3300005563 Bacteria 3156
23 Ga0070664_100048259 3300005564 Bacteria 3598
24 Ga0068852_100086915 3300005616 Bacteria 2788
25 Ga0068861_100085308 3300005719 Bacteria 2480
26 Ga0068851_10068925 3300005834 Bacteria 1826
27 Ga0068860_100000023 3300005843 Bacteria 279076
28 Ga0068860_100000037 3300005843 Bacteria 234524
29 Ga0075365_10011582 3300006038 Bacteria 5193
30 Ga0075363_100002171 3300006048 Bacteria 7898
31 Ga0075364_10007904 3300006051 Bacteria 6335
32 Ga0075432_10002630 3300006058 Bacteria 5999
33 Ga0075362_10007396 3300006177 Bacteria 4159
34 Ga0075362_10037431 3300006177 Bacteria 2127
35 Ga0075369_10010336 3300006186 Bacteria 3648
36 Ga0075366_10009834 3300006195 Bacteria 5349
37 Ga0075366_10111308 3300006195 Bacteria 1647
38 Ga0075370_10004523 3300006353 Bacteria 6766
39 Ga0099826_10061274 3300006948 Bacteria 2446
40 Ga0105240_10040739 3300009093 Bacteria 5937
41 Ga0105240_10251350 3300009093 Bacteria 2044
42 Ga0105245_10056930 3300009098 Bacteria 3515
43 Ga0105243_10001513 3300009148 Bacteria 20306
44 Ga0105241_10006931 3300009174 Bacteria 8341
45 Ga0105248_10324064 3300009177 Bacteria 1735
46 Ga0105237_10040010 3300009545 Bacteria 4730
47 Ga0105237_10042298 3300009545 Bacteria 4595
48 Ga0105238_10036118 3300009551 Bacteria 5023
49 Ga0105239_10075794 3300010375 Bacteria 3698
50 Ga0105239_10178522 3300010375 Bacteria 2375
51 Ga0157370_10078595 3300013104 Bacteria 3107
52 Ga0157369_10029803 3300013105 Bacteria 6027
53 Ga0157372_10305394 3300013307 Bacteria 1851
54 Ga0182008_10009251 3300014497 Bacteria 5325
55 Ga0182007_10004458 3300015262 Bacteria 6346
56 Ga0183361_10007 3300016635 Bacteria 339575
57 Ga0209435_103000 3300025206 Bacteria 1943
58 Ga0209566_100500 3300025225 Bacteria 27278
59 Ga0209566_101159 3300025225 Bacteria 9649
60 Ga0209674_101716 3300025226 Bacteria 5397
61 Ga0209147_100156 3300025229 Bacteria 93105
62 Ga0209563_104313 3300025230 Bacteria 2737
63 Ga0209676_1025260 3300025292 Bacteria 1909
64 Ga0207656_10079777 3300025321 Bacteria 1469
65 Ga0207647_10029705 3300025904 Bacteria 3533
66 Ga0207645_10040416 3300025907 Bacteria 2986
67 Ga0207707_10135860 3300025912 Bacteria 2150
68 Ga0207695_10000624 3300025913 Bacteria 71152
69 Ga0207695_10081740 3300025913 Bacteria 3268
70 Ga0207671_10068510 3300025914 Bacteria 2644
71 Ga0207671_10153174 3300025914 Bacteria 1782
72 Ga0207649_10011062 3300025920 Bacteria 4966
73 Ga0207694_10125309 3300025924 Bacteria 2054
74 Ga0207687_10130521 3300025927 Bacteria 1893
75 Ga0207690_10056431 3300025932 Bacteria 2649
76 Ga0207706_10049633 3300025933 Bacteria 3708
77 Ga0207706_10156139 3300025933 Bacteria 2007
78 Ga0207711_10207808 3300025941 Bacteria 1788
79 Ga0207679_10044629 3300025945 Bacteria 3199
80 Ga0207667_10006575 3300025949 Bacteria 14065
81 Ga0207667_10063021 3300025949 Bacteria 3875
82 Ga0207667_10538548 3300025949 Bacteria 1182
83 Ga0207668_10001046 3300025972 Bacteria 16510
84 Ga0207678_10043378 3300026067 Bacteria 3892
85 Ga0207702_10039643 3300026078 Bacteria 3948
86 Ga0207674_10078244 3300026116 Bacteria 3312
87 Ga0209974_10040088 3300027876 Bacteria 1558
88 Ga0268265_10230896 3300028380 Bacteria 1626
89 Ga0268264_10000002 3300028381 Bacteria 1153045
90 Ga0268264_10000008 3300028381 Bacteria 773387
91 Ga0307515_10004876 3300028794 Bacteria 27436
92 Ga0307515_10083802 3300028794 Bacteria 4105
93 Ga0307513_10006533 3300031456 Bacteria 15228
94 Ga0307513_10021745 3300031456 Bacteria 7567
95 Ga0307408_100104766 3300031548 Bacteria 2161
96 Ga0307514_10033664 3300031649 Bacteria 4087
97 Ga0307406_10076734 3300031901 Bacteria 2208
98 Ga0307409_100352932 3300031995 Bacteria 1388
99 Ga0307510_10062583 3300033180 Bacteria 3801
100 Ga0373925_0008918 3300037068 Bacteria 7306
101 Ga0395899_0001396 3300037312 Bacteria 20706
102 Ga0395905_0080327 3300037471 Bacteria 3056
103 Ga0395905_0090131 3300037471 Bacteria 2875
104 Ga0395905_0184802 3300037471 Bacteria 1957
105 Ga0395905_0292339 3300037471 Bacteria 1516
106 Ga0395901_0013457 3300038443 Bacteria 8317
107 Ga0395901_0062081 3300038443 Bacteria 3889
108 Ga0395901_0204535 3300038443 Bacteria 2069
109 Ga0436361_0834741 3300039447 Bacteria 6358
110 Ga0439447_005363 3300041407 Bacteria 4274
111 Ga0439466_0015721 3300041411 Bacteria 2748
112 Ga0439446_0017158 3300042156 Bacteria 2021
113 Ga0450893_0008923 3300042532 Bacteria 1637
114 Ga0466966_0001722 3300044684 Bacteria 14149
115 Ga0466958_0001689 3300045836 Bacteria 10639
116 Ga0495590_0001969 3300046457 Bacteria 8658
117 Ga0495629_0001746 3300046459 Bacteria 17039
118 Ga0495653_0001061 3300046463 Bacteria 21169
119 Ga0495664_0001568 3300046477 Bacteria 12111
120 Ga0495583_0000001 3300046506 Bacteria 811973
121 Ga0495583_0047457 3300046506 Bacteria 1975
122 Ga0495610_0000013 3300046512 Bacteria 465872
123 Ga0495620_0031186 3300046515 Bacteria 2445
124 Ga0495628_0054467 3300046516 Bacteria 3154
125 Ga0495630_0001092 3300046517 Bacteria 18641
126 Ga0495648_0000300 3300046524 Bacteria 54935
127 Ga0495648_0000587 3300046524 Bacteria 38941
128 Ga0495665_0000088 3300046531 Bacteria 41277
129 Ga0495597_0000028 3300046542 Bacteria 137215
130 Ga0495645_0008151 3300046543 Bacteria 7305
131 Ga0495622_0000003 3300046557 Bacteria 268681
132 Ga0495622_0000006 3300046557 Bacteria 245799
133 Ga0495635_0007133 3300046663 Bacteria 7812
134 Ga0495623_0007903 3300046679 Bacteria 6917
135 Ga0495624_0002951 3300046690 Bacteria 12725
136 Ga0495604_0045460 3300047317 Bacteria 3427
137 Ga0495674_0004761 3300047319 Bacteria 13047
138 Ga0495680_0001743 3300047322 Bacteria 23092
139 Ga0495673_0000263 3300047469 Bacteria 73113
140 Ga0495673_0003137 3300047469 Bacteria 11069
141 Ga0495593_0000023 3300047673 Bacteria 66020
142 Ga0495602_0014218 3300048088 Bacteria 8088
143 Ga0496100_0000468 3300048903 Bacteria 19363
144 Ga0496101_0000286 3300048904 Bacteria 35339
145 Ga0496102_0000603 3300048905 Bacteria 37505
146 Ga0496103_0001250 3300048906 Bacteria 17360
147 Ga0496104_0046440 3300048907 Bacteria 4090
148 Ga0496105_0038132 3300048908 Bacteria 3959
149 Ga0496106_0007807 3300048909 Bacteria 7915
150 Ga0496107_0009062 3300048910 Bacteria 6899
151 Ga0496110_0312423 3300048913 Bacteria 1431
152 Ga0496111_0221006 3300048914 Bacteria 1407
153 Ga0496113_0150926 3300048916 Bacteria 1833
154 Ga0496116_0000592 3300048919 Bacteria 48338
155 Ga0496116_0005280 3300048919 Bacteria 12052
156 Ga0496117_0020409 3300048920 Bacteria 5402
157 Ga0496118_0004634 3300048921 Bacteria 16131
158 Ga0496118_0047726 3300048921 Bacteria 3316
159 Ga0496118_0057517 3300048921 Bacteria 2914
160 Ga0496118_0197260 3300048921 Bacteria 1197
161 Ga0496119_0000417 3300048922 Bacteria 58548
162 Ga0496120_0000812 3300048923 Bacteria 44729
163 Ga0496121_0005486 3300048924 Bacteria 16239
164 Ga0496121_0008424 3300048924 Bacteria 12133
165 Ga0496122_0000710 3300048925 Bacteria 65728
166 Ga0496122_0002201 3300048925 Bacteria 28467
167 Ga0496122_0056448 3300048925 Bacteria 2927
168 Ga0496123_0000104 3300048926 Bacteria 168230
169 Ga0496123_0002735 3300048926 Bacteria 21139
170 Ga0496123_0012881 3300048926 Bacteria 7080
171 Ga0496123_0089297 3300048926 Bacteria 1836
172 Ga0496124_0000224 3300048927 Bacteria 110603
173 Ga0496124_0010636 3300048927 Bacteria 9290
174 Ga0496125_0000363 3300048928 Bacteria 85601
175 Ga0496125_0026055 3300048928 Bacteria 5339
176 Ga0496125_0026107 3300048928 Bacteria 5334
177 Ga0496126_0004277 3300048929 Bacteria 17168
178 Ga0496126_0080218 3300048929 Bacteria 2888
179 Ga0496126_0107733 3300048929 Bacteria 2430
180 Ga0496126_0161542 3300048929 Bacteria 1914
181 Ga0501034_0026298 3300049571 Bacteria 5927
182 Ga0501034_0140182 3300049571 Bacteria 2398
183 Ga0501043_0000573 3300049579 Bacteria 32893
184 Ga0501047_0000298 3300049581 Bacteria 57038
185 Ga0501073_0080572 3300049589 Bacteria 2265
186 Ga0501080_0142565 3300049742 Bacteria 2215
187 Ga0501083_0022402 3300049744 Bacteria 4385
188 nmdc:mga03683_2128_c1 3300050489 Bacteria 6101
189 nmdc:mga03683_655_c2 3300050489 Bacteria 8978
190 nmdc:mga03n38_5917_c1 3300050490 Bacteria 2316
191 nmdc:mga00v17_9061_c1 3300050491 Bacteria 5372
192 nmdc:mga0yw44_6143_c1 3300050492 Bacteria 5771
193 nmdc:mga07m45_13670_c1 3300050496 Bacteria 4311
194 Ga0500643_017021 3300053087 Bacteria 2445
195 Ga0500644_0000140 3300053088 Bacteria 44756
196 Ga0500564_002263 3300053138 Bacteria 7047
197 Ga0500622_0000749 3300053156 Bacteria 28247
198 Ga0500634_0004195 3300053161 Bacteria 6610
199 Ga0500636_0039499 3300053177 Bacteria 2792
200 Ga0500645_012163 3300053730 Bacteria 2788
201 Ga0501084_0042254 3300054114 Bacteria 3813
202 Ga0501082_0040841 3300060353 Bacteria 4000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025321 Ga0207656_10079777 Ga0207656_100797772 321
2 3300048929 Ga0496126_0161542 Ga0496126_0161542_731_1762 321
3 3300045836 Ga0466958_0001689 Ga0466958_0001689_2405_3424 324
4 iso_pu_bacteria 2519103095 2519462292 335
5 iso_pu_bacteria 2582581311 2585295350 335
6 iso_pu_bacteria 2599185239 2599737549 335
7 iso_pu_bacteria 2816332253 2817258040 335
8 iso_pu_bacteria 2816332256 2817281549 335
9 iso_pu_bacteria 2816332286 2817454254 335
10 iso_pu_bacteria 2894023352 2894027679 335
11 iso_pu_bacteria 642555112 642596290 335
12 iso_pu_bacteria 8018845410 8018847200 335
13 iso_pu_bacteria 8020807995 8020811833 335
14 iso_pu_bacteria 8040167225 8040173050 335
15 iso_pu_bacteria 8040173305 8040177410 335
16 3300041407 Ga0439447_005363 Ga0439447_005363_1116_2126 336
17 3300041411 Ga0439466_0015721 Ga0439466_0015721_450_1460 336
18 3300042156 Ga0439446_0017158 Ga0439446_0017158_498_1508 336
19 iso_pu_bacteria 2513237083 2513564673 336
20 iso_pu_bacteria 2599185240 2599749066 336
21 iso_pu_bacteria 2599185355 2600211140 336
22 iso_pu_bacteria 2675903129 2676745621 336
23 iso_pu_bacteria 3007252601 3007255778 336
24 iso_pu_bacteria 641736154 642417558 336
25 iso_pu_bacteria 8003955200 8003961058 336
26 3300053161 Ga0500634_0004195 Ga0500634_0004195_905_1918 337
27 iso_pu_bacteria 2515154123 2515691397 337
28 iso_pu_bacteria 2643221603 2644028356 337
29 iso_pu_bacteria 2744054900 2746084848 337
30 iso_pu_bacteria 2744054901 2746099511 337
31 iso_pu_bacteria 2895511927 2895513441 337
32 iso_pu_bacteria 2987605356 2987608643 337
33 iso_pu_bacteria 8055301274 8055308065 337
34 3300005457 Ga0070662_100103911 Ga0070662_1001039113 338
35 3300005719 Ga0068861_100085308 Ga0068861_1000853083 338
36 3300025933 Ga0207706_10156139 Ga0207706_101561392 338
37 3300046524 Ga0495648_0000300 Ga0495648_0000300_17676_18692 338
38 3300046524 Ga0495648_0000587 Ga0495648_0000587_31452_32480 338
39 3300046557 Ga0495622_0000006 Ga0495622_0000006_190676_191692 338
40 3300047469 Ga0495673_0000263 Ga0495673_0000263_17817_18833 338
41 3300047469 Ga0495673_0003137 Ga0495673_0003137_3356_4372 338
42 3300053138 Ga0500564_002263 Ga0500564_002263_866_1882 338
43 3300053177 Ga0500636_0039499 Ga0500636_0039499_1348_2382 338
44 3300003758 Ga0055532_1000364 Ga0055532_10003649 339
45 3300003841 Ga0055541_1003447 Ga0055541_10034472 339
46 3300016635 Ga0183361_10007 Ga0183361_1000770 339
47 3300025225 Ga0209566_101159 Ga0209566_1011592 339
48 3300025226 Ga0209674_101716 Ga0209674_1017162 339
49 3300025229 Ga0209147_100156 Ga0209147_10015623 339
50 3300027876 Ga0209974_10040088 Ga0209974_100400882 339
51 3300031456 Ga0307513_10006533 Ga0307513_100065337 339
52 3300037471 Ga0395905_0080327 Ga0395905_0080327_1095_2114 339
53 3300037471 Ga0395905_0292339 Ga0395905_0292339_439_1458 339
54 iso_pu_bacteria 2728369097 2729147719 339
55 iso_pu_bacteria 2883087390 2883092409 339
56 iso_pu_bacteria 2981990288 2981990511 339
57 3300001979 JGI24740J21852_10010930 JGI24740J21852_100109303 340
58 3300005329 Ga0070683_100096482 Ga0070683_1000964823 340
59 3300005455 Ga0070663_100082574 Ga0070663_1000825743 340
60 3300005563 Ga0068855_100019061 Ga0068855_1000190615 340
61 3300009093 Ga0105240_10251350 Ga0105240_102513501 340
62 3300009545 Ga0105237_10040010 Ga0105237_100400106 340
63 3300009551 Ga0105238_10036118 Ga0105238_100361186 340
64 3300013105 Ga0157369_10029803 Ga0157369_100298033 340
65 3300025206 Ga0209435_103000 Ga0209435_1030002 340
66 3300025913 Ga0207695_10000624 Ga0207695_1000062458 340
67 3300025914 Ga0207671_10068510 Ga0207671_100685103 340
68 3300025932 Ga0207690_10056431 Ga0207690_100564312 340
69 3300025949 Ga0207667_10006575 Ga0207667_100065755 340
70 3300031649 Ga0307514_10033664 Ga0307514_100336645 340
71 3300037068 Ga0373925_0008918 Ga0373925_0008918_4859_5881 340
72 3300037471 Ga0395905_0184802 Ga0395905_0184802_521_1552 340
73 3300046457 Ga0495590_0001969 Ga0495590_0001969_7236_8297 340
74 3300046459 Ga0495629_0001746 Ga0495629_0001746_15776_16807 340
75 3300046463 Ga0495653_0001061 Ga0495653_0001061_12286_13317 340
76 3300046477 Ga0495664_0001568 Ga0495664_0001568_26_1057 340
77 3300046506 Ga0495583_0047457 Ga0495583_0047457_828_1850 340
78 3300046516 Ga0495628_0054467 Ga0495628_0054467_1971_3002 340
79 3300046517 Ga0495630_0001092 Ga0495630_0001092_6477_7508 340
80 3300046531 Ga0495665_0000088 Ga0495665_0000088_12940_13971 340
81 3300046543 Ga0495645_0008151 Ga0495645_0008151_899_1930 340
82 3300046557 Ga0495622_0000003 Ga0495622_0000003_125692_126726 340
83 3300046663 Ga0495635_0007133 Ga0495635_0007133_2190_3221 340
84 3300046679 Ga0495623_0007903 Ga0495623_0007903_2086_3117 340
85 3300046690 Ga0495624_0002951 Ga0495624_0002951_1222_2253 340
86 3300047317 Ga0495604_0045460 Ga0495604_0045460_1411_2442 340
87 3300047319 Ga0495674_0004761 Ga0495674_0004761_11100_12131 340
88 3300047322 Ga0495680_0001743 Ga0495680_0001743_5562_6593 340
89 3300047673 Ga0495593_0000023 Ga0495593_0000023_37598_38629 340
90 3300048088 Ga0495602_0014218 Ga0495602_0014218_42_1073 340
91 3300048903 Ga0496100_0000468 Ga0496100_0000468_13986_15017 340
92 3300048904 Ga0496101_0000286 Ga0496101_0000286_21164_22195 340
93 3300048905 Ga0496102_0000603 Ga0496102_0000603_26641_27672 340
94 3300048906 Ga0496103_0001250 Ga0496103_0001250_10738_11769 340
95 3300048907 Ga0496104_0046440 Ga0496104_0046440_706_1737 340
96 3300048909 Ga0496106_0007807 Ga0496106_0007807_3538_4569 340
97 3300048910 Ga0496107_0009062 Ga0496107_0009062_4161_5192 340
98 3300048913 Ga0496110_0312423 Ga0496110_0312423_186_1217 340
99 3300048914 Ga0496111_0221006 Ga0496111_0221006_200_1231 340
100 3300048916 Ga0496113_0150926 Ga0496113_0150926_218_1249 340
101 3300048919 Ga0496116_0005280 Ga0496116_0005280_8566_9588 340
102 3300048920 Ga0496117_0020409 Ga0496117_0020409_2277_3299 340
103 3300048921 Ga0496118_0004634 Ga0496118_0004634_14500_15522 340
104 3300048921 Ga0496118_0047726 Ga0496118_0047726_169_1200 340
105 3300048924 Ga0496121_0005486 Ga0496121_0005486_13759_14790 340
106 3300048928 Ga0496125_0026107 Ga0496125_0026107_209_1240 340
107 3300048929 Ga0496126_0080218 Ga0496126_0080218_573_1604 340
108 3300049571 Ga0501034_0140182 Ga0501034_0140182_1121_2146 340
109 3300049744 Ga0501083_0022402 Ga0501083_0022402_2239_3264 340
110 3300053730 Ga0500645_012163 Ga0500645_012163_483_1511 340
111 3300054114 Ga0501084_0042254 Ga0501084_0042254_2044_3069 340
112 3300060353 Ga0501082_0040841 Ga0501082_0040841_627_1652 340
113 iso_pu_bacteria 8002392321 8002395205 340
114 3300005337 Ga0070682_100001802 Ga0070682_1000018023 341
115 3300037471 Ga0395905_0090131 Ga0395905_0090131_969_2015 341
116 3300046542 Ga0495597_0000028 Ga0495597_0000028_62751_63776 341
117 3300048927 Ga0496124_0010636 Ga0496124_0010636_2276_3301 341
118 iso_pu_bacteria 2842747753 2842753078 341
119 iso_pu_bacteria 2929520902 2929522024 341
120 3300003841 Ga0055541_1000304 Ga0055541_100030412 342
121 3300025225 Ga0209566_100500 Ga0209566_10050015 342
122 3300025230 Ga0209563_104313 Ga0209563_1043132 342
123 3300033180 Ga0307510_10062583 Ga0307510_100625834 342
124 3300042532 Ga0450893_0008923 Ga0450893_0008923_16_1059 342
125 3300044684 Ga0466966_0001722 Ga0466966_0001722_9754_10788 342
126 3300046506 Ga0495583_0000001 Ga0495583_0000001_488339_489367 342
127 3300046512 Ga0495610_0000013 Ga0495610_0000013_304643_305671 342
128 3300046515 Ga0495620_0031186 Ga0495620_0031186_90_1118 342
129 3300048926 Ga0496123_0089297 Ga0496123_0089297_353_1381 342
130 3300049579 Ga0501043_0000573 Ga0501043_0000573_31529_32590 342
131 3300049581 Ga0501047_0000298 Ga0501047_0000298_31476_32537 342
132 3300049589 Ga0501073_0080572 Ga0501073_0080572_354_1466 342
133 3300053087 Ga0500643_017021 Ga0500643_017021_318_1346 342
134 3300053088 Ga0500644_0000140 Ga0500644_0000140_42906_43934 342
135 3300005344 Ga0070661_100149001 Ga0070661_1001490012 343
136 3300005843 Ga0068860_100000037 Ga0068860_100000037252 343
137 3300006177 Ga0075362_10037431 Ga0075362_100374312 343
138 3300006186 Ga0075369_10010336 Ga0075369_100103364 343
139 3300009093 Ga0105240_10040739 Ga0105240_100407393 343
140 3300025913 Ga0207695_10081740 Ga0207695_100817402 343
141 3300028381 Ga0268264_10000002 Ga0268264_10000002329 343
142 3300028794 Ga0307515_10083802 Ga0307515_100838022 343
143 3300031456 Ga0307513_10021745 Ga0307513_100217458 343
144 3300039447 Ga0436361_0834741 Ga0436361_0834741_3411_4475 343
145 3300048925 Ga0496122_0000710 Ga0496122_0000710_53203_54249 343
146 3300048926 Ga0496123_0000104 Ga0496123_0000104_113975_115021 343
147 3300049571 Ga0501034_0026298 Ga0501034_0026298_3659_4690 343
148 3300053156 Ga0500622_0000749 Ga0500622_0000749_24524_25570 343
149 3300005347 Ga0070668_100119152 Ga0070668_1001191522 344
150 3300005458 Ga0070681_10058319 Ga0070681_100583193 344
151 3300014497 Ga0182008_10009251 Ga0182008_100092517 344
152 3300015262 Ga0182007_10004458 Ga0182007_100044584 344
153 3300025912 Ga0207707_10135860 Ga0207707_101358602 344
154 3300025949 Ga0207667_10538548 Ga0207667_105385482 344
155 3300038443 Ga0395901_0062081 Ga0395901_0062081_1684_2718 344
156 3300048921 Ga0496118_0057517 Ga0496118_0057517_273_1310 344
157 3300048924 Ga0496121_0008424 Ga0496121_0008424_7268_8305 344
158 3300048925 Ga0496122_0056448 Ga0496122_0056448_1674_2711 344
159 3300048926 Ga0496123_0012881 Ga0496123_0012881_784_1821 344
160 3300048927 Ga0496124_0000224 Ga0496124_0000224_7465_8502 344
161 3300049742 Ga0501080_0142565 Ga0501080_0142565_105_1154 344
162 3300005328 Ga0070676_10055301 Ga0070676_100553013 345
163 3300005364 Ga0070673_100033849 Ga0070673_1000338493 345
164 3300005459 Ga0068867_100003076 Ga0068867_1000030768 345
165 3300006038 Ga0075365_10011582 Ga0075365_100115823 345
166 3300006048 Ga0075363_100002171 Ga0075363_1000021715 345
167 3300006051 Ga0075364_10007904 Ga0075364_100079042 345
168 3300006058 Ga0075432_10002630 Ga0075432_100026305 345
169 3300006177 Ga0075362_10007396 Ga0075362_100073962 345
170 3300006195 Ga0075366_10009834 Ga0075366_100098342 345
171 3300006195 Ga0075366_10111308 Ga0075366_101113082 345
172 3300006353 Ga0075370_10004523 Ga0075370_100045235 345
173 3300006948 Ga0099826_10061274 Ga0099826_100612742 345
174 3300009098 Ga0105245_10056930 Ga0105245_100569302 345
175 3300009148 Ga0105243_10001513 Ga0105243_100015138 345
176 3300010375 Ga0105239_10178522 Ga0105239_101785222 345
177 3300025292 Ga0209676_1025260 Ga0209676_10252602 345
178 3300025907 Ga0207645_10040416 Ga0207645_100404163 345
179 3300025927 Ga0207687_10130521 Ga0207687_101305212 345
180 3300028794 Ga0307515_10004876 Ga0307515_100048762 345
181 3300048908 Ga0496105_0038132 Ga0496105_0038132_402_1439 345
182 3300048919 Ga0496116_0000592 Ga0496116_0000592_17260_18348 345
183 3300048921 Ga0496118_0197260 Ga0496118_0197260_34_1122 345
184 3300048922 Ga0496119_0000417 Ga0496119_0000417_19957_21045 345
185 3300048923 Ga0496120_0000812 Ga0496120_0000812_19102_20190 345
186 3300048925 Ga0496122_0002201 Ga0496122_0002201_26326_27414 345
187 3300048926 Ga0496123_0002735 Ga0496123_0002735_5747_6835 345
188 3300048928 Ga0496125_0000363 Ga0496125_0000363_54523_55611 345
189 3300048928 Ga0496125_0026055 Ga0496125_0026055_2911_3948 345
190 3300048929 Ga0496126_0107733 Ga0496126_0107733_1070_2158 345
191 3300050489 nmdc:mga03683_2128_c1 nmdc:mga03683_2128_c1_4877_5944 345
192 3300050489 nmdc:mga03683_655_c2 nmdc:mga03683_655_c2_2889_3956 345
193 3300050490 nmdc:mga03n38_5917_c1 nmdc:mga03n38_5917_c1_777_1844 345
194 3300050491 nmdc:mga00v17_9061_c1 nmdc:mga00v17_9061_c1_597_1664 345
195 3300050492 nmdc:mga0yw44_6143_c1 nmdc:mga0yw44_6143_c1_995_2062 345
196 3300050496 nmdc:mga07m45_13670_c1 nmdc:mga07m45_13670_c1_671_1753 345
197 3300003323 rootH1_10031295 rootH1_100312951 346
198 3300005347 Ga0070668_100007291 Ga0070668_1000072914 346
199 3300005843 Ga0068860_100000023 Ga0068860_100000023147 346
200 3300009177 Ga0105248_10324064 Ga0105248_103240642 346
201 3300025941 Ga0207711_10207808 Ga0207711_102078082 346
202 3300025972 Ga0207668_10001046 Ga0207668_100010467 346
203 3300028380 Ga0268265_10230896 Ga0268265_102308961 346
204 3300028381 Ga0268264_10000008 Ga0268264_10000008113 346
205 3300048929 Ga0496126_0004277 Ga0496126_0004277_11939_12994 346
206 3300038443 Ga0395901_0204535 Ga0395901_0204535_818_1873 348
207 3300037312 Ga0395899_0001396 Ga0395899_0001396_4485_5567 350
208 3300038443 Ga0395901_0013457 Ga0395901_0013457_5122_6204 350
209 3300001904 JGI24736J21556_1003439 JGI24736J21556_10034393 351
210 3300001915 JGI24741J21665_1003289 JGI24741J21665_10032893 351
211 3300001979 JGI24740J21852_10020662 JGI24740J21852_100206622 351
212 3300005455 Ga0070663_100019673 Ga0070663_1000196732 351
213 3300005563 Ga0068855_100110490 Ga0068855_1001104902 351
214 3300005564 Ga0070664_100048259 Ga0070664_1000482592 351
215 3300005616 Ga0068852_100086915 Ga0068852_1000869153 351
216 3300005834 Ga0068851_10068925 Ga0068851_100689252 351
217 3300009174 Ga0105241_10006931 Ga0105241_100069315 351
218 3300009545 Ga0105237_10042298 Ga0105237_100422984 351
219 3300010375 Ga0105239_10075794 Ga0105239_100757942 351
220 3300013104 Ga0157370_10078595 Ga0157370_100785953 351
221 3300013307 Ga0157372_10305394 Ga0157372_103053941 351
222 3300025904 Ga0207647_10029705 Ga0207647_100297053 351
223 3300025914 Ga0207671_10153174 Ga0207671_101531742 351
224 3300025920 Ga0207649_10011062 Ga0207649_100110621 351
225 3300025924 Ga0207694_10125309 Ga0207694_101253092 351
226 3300025933 Ga0207706_10049633 Ga0207706_100496333 351
227 3300025945 Ga0207679_10044629 Ga0207679_100446293 351
228 3300025949 Ga0207667_10063021 Ga0207667_100630213 351
229 3300026067 Ga0207678_10043378 Ga0207678_100433783 351
230 3300026078 Ga0207702_10039643 Ga0207702_100396433 351
231 3300026116 Ga0207674_10078244 Ga0207674_100782443 351
232 3300031548 Ga0307408_100104766 Ga0307408_1001047662 351
233 3300031901 Ga0307406_10076734 Ga0307406_100767343 351
234 3300031995 Ga0307409_100352932 Ga0307409_1003529322 351

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00682

HMGL-like

HMGL-like

5

265

0.98

PF07836

DmpG_comm

DmpG-like communication domain

273

335

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nvm-assembly1.cif.gz_A crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate 0.9424 13 346
4lrs-assembly1.cif.gz_A crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during nad+ and coa accommodation whithin the shared cofactor-binding site 0.9349 14 347
4jn6-assembly1.cif.gz_A crystal structure of the aldolase-dehydrogenase complex from mycobacterium tuberculosis hrv37 0.9338 14 348
4lrs-assembly1.cif.gz_A crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during nad+ and coa accommodation whithin the shared cofactor-binding site 0.9243 14 347
1nvm-assembly1.cif.gz_A crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate 0.9236 13 346
ID Description Score Start End Superfamily
1nvmE01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9692 12 276 3.20.20.70
af_P51020_275_337_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9672 285 345 1.10.8.60
1nvmE02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9636 285 344 1.10.8.60
1nvmG02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9609 285 346 1.10.8.60
4jn6C02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9553 285 349 1.10.8.60
ID Description Score Start End GO Terms
AF-A0A6B3D2C3-F1-model_v4 4-hydroxy-2-oxovalerate aldolase 1.003 73 174 GO:0003824
AF-A0A4Q2QN03-F1-model_v4 4-hydroxy-2-oxovalerate aldolase 1.002 93 220 GO:0003852
GO:0009098
AF-A0A6P1I588-F1-model_v4 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39) 0.9989 95 244 GO:0003852
GO:0008701
GO:0009098
AF-A0A6M1I1J8-F1-model_v4 deleted 0.9987 110 239
AF-A0A1I7YG57-F1-model_v4 Pyruvate carboxyltransferase domain-containing protein 0.9956 151 272 GO:0003852
GO:0009098

Feature Viewer

pLDDT pTM Quality
88.66 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map