F347205
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 234 | 137 | 234 | 610 |
Family's Representative Sequence
| Representative Sequence | 3300026118|Ga0207675_100078481|Ga0207675_1000784812 |
| Length | 690 |
| Sequence | LLRHLRKHLAGFVGALLLTAVSAPATYSGQPIIWETSGRADLLKGDARGVSISDTGMLMLAPRLTEVFNTEQAFVWSSAVDAQGNVYLGTGHDGKIFRVSADGRGSLLYDKPESSLLIATNQKAFALFDAHLREIHALAPAADGSIYALALSDAASTGRQPAAATAPQPTDGSGVPSTSVTITAIDESGAPIQTAGQPTRSRTDIASARSAVFRILPDGATDVVWSSPSVTAFAIAPALQPGSVLIGTADKGRIYSVTNDGRDTLLLQSTEGQISSFQVRGNQVYAASSNQGKVFRFGPELIAEGTYESPVRDAKLTASWGRIWWRGSGNVELQTRSGNGERPDATWSEWSGSYRDPGGSPISSPRARFIQWRALLRSTGSGPTWMEDASLAYLPRNVAPEVLSITSLPIGVGLQQLAQVQVDPNVESSGLDPSLFGAVAVVPPRRIFQRGARSFQWQAEDRNGDTLEYAIYYRPLNETTFRLLRDKLRDNFYTIDGATLADGRYIIKIIASDAPDNPMGQALTGERLSEPVDIDNTPPVLRALTPQASSGNRVAFEVDDATGKIKRGDFSLDGAPWTPLFPDDGIADSGHEQYSVELPALAPGEHTVSLRAFDGTAQVWRSWWVDGRAPTDIGAPLSGTFTNDVGTLTGDGARSRWSRIHTGAPRWEQTVSKDGTNWETNWVADFERVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 108 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 109 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 110 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 113 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 117 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 118 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 119 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 120 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 121 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 123 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 124 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 125 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 126 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 127 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 128 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 129 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 130 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.71 |
| Rhizosphere | 97.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000099 | 3300002459 | Bacteria | 47837 |
| 2 | Ga0065714_10064424 | 3300005288 | Bacteria | 236118 |
| 3 | Ga0065712_10000117 | 3300005290 | Bacteria | 235194 |
| 4 | Ga0065712_10004776 | 3300005290 | Unclassified | 4505 |
| 5 | Ga0065712_10072735 | 3300005290 | Bacteria | 4631 |
| 6 | Ga0065715_10089590 | 3300005293 | Bacteria | 9335 |
| 7 | Ga0065715_10091714 | 3300005293 | Bacteria | 5590 |
| 8 | Ga0065707_10001764 | 3300005295 | Bacteria | 8859 |
| 9 | Ga0065707_10002183 | 3300005295 | Bacteria | 5827 |
| 10 | Ga0070690_100009424 | 3300005330 | Bacteria | 5655 |
| 11 | Ga0070690_100010333 | 3300005330 | Bacteria | 5429 |
| 12 | Ga0070670_100000297 | 3300005331 | Bacteria | 43678 |
| 13 | Ga0070670_100000951 | 3300005331 | Bacteria | 22713 |
| 14 | Ga0070666_10017513 | 3300005335 | Unclassified | 4594 |
| 15 | Ga0070680_100001177 | 3300005336 | Bacteria | 18825 |
| 16 | Ga0070680_100069402 | 3300005336 | Bacteria | 2894 |
| 17 | Ga0070682_100000548 | 3300005337 | Bacteria | 23320 |
| 18 | Ga0070682_100047810 | 3300005337 | Bacteria | 2661 |
| 19 | Ga0070689_100000425 | 3300005340 | Bacteria | 24906 |
| 20 | Ga0070689_100027160 | 3300005340 | Unclassified | 4314 |
| 21 | Ga0070669_100010180 | 3300005353 | Bacteria | 6683 |
| 22 | Ga0070673_100034940 | 3300005364 | Archaea | 3809 |
| 23 | Ga0070688_100013296 | 3300005365 | Unclassified | 4636 |
| 24 | Ga0070659_100027884 | 3300005366 | Bacteria | 4355 |
| 25 | Ga0070703_10001260 | 3300005406 | Bacteria | 7702 |
| 26 | Ga0070705_100007861 | 3300005440 | Bacteria | 5266 |
| 27 | Ga0070700_100000087 | 3300005441 | Bacteria | 62003 |
| 28 | Ga0070700_100002603 | 3300005441 | Bacteria | 9230 |
| 29 | Ga0070700_100029667 | 3300005441 | Archaea | 3263 |
| 30 | Ga0070708_100000281 | 3300005445 | Bacteria | 38291 |
| 31 | Ga0070708_100012045 | 3300005445 | Bacteria | 7048 |
| 32 | Ga0070681_10001035 | 3300005458 | Bacteria | 23588 |
| 33 | Ga0070681_10008122 | 3300005458 | Bacteria | 10271 |
| 34 | Ga0070681_10046626 | 3300005458 | Bacteria | 4332 |
| 35 | Ga0068867_100038806 | 3300005459 | Unclassified | 3469 |
| 36 | Ga0070685_10008831 | 3300005466 | Bacteria | 5194 |
| 37 | Ga0070706_100000146 | 3300005467 | Bacteria | 89818 |
| 38 | Ga0070706_100001677 | 3300005467 | Bacteria | 23063 |
| 39 | Ga0070706_100053356 | 3300005467 | Unclassified | 3731 |
| 40 | Ga0070707_100028948 | 3300005468 | Bacteria | 5273 |
| 41 | Ga0070698_100009193 | 3300005471 | Bacteria | 10606 |
| 42 | Ga0070698_100011852 | 3300005471 | Bacteria | 9249 |
| 43 | Ga0070698_100014956 | 3300005471 | Bacteria | 8204 |
| 44 | Ga0070699_100001043 | 3300005518 | Bacteria | 25801 |
| 45 | Ga0070699_100002373 | 3300005518 | Bacteria | 16893 |
| 46 | Ga0070699_100021971 | 3300005518 | Bacteria | 5498 |
| 47 | Ga0070679_100000253 | 3300005530 | Bacteria | 44883 |
| 48 | Ga0070679_100008007 | 3300005530 | Bacteria | 9924 |
| 49 | Ga0070697_100000135 | 3300005536 | Bacteria | 59315 |
| 50 | Ga0070697_100025601 | 3300005536 | Unclassified | 4706 |
| 51 | Ga0070697_100038797 | 3300005536 | Bacteria | 3849 |
| 52 | Ga0070697_100075080 | 3300005536 | Bacteria | 2778 |
| 53 | Ga0070672_100023453 | 3300005543 | Unclassified | 4549 |
| 54 | Ga0070686_100022363 | 3300005544 | Unclassified | 3765 |
| 55 | Ga0070695_100015882 | 3300005545 | Unclassified | 4550 |
| 56 | Ga0070693_100002752 | 3300005547 | Bacteria | 8092 |
| 57 | Ga0070665_100084116 | 3300005548 | Bacteria | 3187 |
| 58 | Ga0070664_100009988 | 3300005564 | Bacteria | 7694 |
| 59 | Ga0068857_100006099 | 3300005577 | Bacteria | 10297 |
| 60 | Ga0068857_100056302 | 3300005577 | Bacteria | 3489 |
| 61 | Ga0070702_100009654 | 3300005615 | Unclassified | 4732 |
| 62 | Ga0068852_100009711 | 3300005616 | Bacteria | 7149 |
| 63 | Ga0068852_100045085 | 3300005616 | Bacteria | 3749 |
| 64 | Ga0068859_100005380 | 3300005617 | Bacteria | 13019 |
| 65 | Ga0068859_100009279 | 3300005617 | Bacteria | 9932 |
| 66 | Ga0068859_100017673 | 3300005617 | Bacteria | 7170 |
| 67 | Ga0068859_100066006 | 3300005617 | Unclassified | 3653 |
| 68 | Ga0068864_100002514 | 3300005618 | Bacteria | 15153 |
| 69 | Ga0068864_100040742 | 3300005618 | Unclassified | 3972 |
| 70 | Ga0068861_100015233 | 3300005719 | Bacteria | 5413 |
| 71 | Ga0068861_100030289 | 3300005719 | Bacteria | 3964 |
| 72 | Ga0068863_100013418 | 3300005841 | Bacteria | 7900 |
| 73 | Ga0068863_100027431 | 3300005841 | Bacteria | 5431 |
| 74 | Ga0068858_100020163 | 3300005842 | Bacteria | 6234 |
| 75 | Ga0068858_100038801 | 3300005842 | Unclassified | 4418 |
| 76 | Ga0068858_100094939 | 3300005842 | Bacteria | 2778 |
| 77 | Ga0068858_100114450 | 3300005842 | Bacteria | 2520 |
| 78 | Ga0068860_100047765 | 3300005843 | Unclassified | 4079 |
| 79 | Ga0068860_100112195 | 3300005843 | Bacteria | 2607 |
| 80 | Ga0068862_100009067 | 3300005844 | Bacteria | 8238 |
| 81 | Ga0068862_100010948 | 3300005844 | Bacteria | 7489 |
| 82 | Ga0068862_100027800 | 3300005844 | Bacteria | 4763 |
| 83 | Ga0081539_10000537 | 3300005985 | Bacteria | 78553 |
| 84 | Ga0081539_10036955 | 3300005985 | Unclassified | 2915 |
| 85 | Ga0070715_10000081 | 3300006163 | Bacteria | 26482 |
| 86 | Ga0070716_100013732 | 3300006173 | Unclassified | 4135 |
| 87 | Ga0097621_100034189 | 3300006237 | Unclassified | 4053 |
| 88 | Ga0068871_100036334 | 3300006358 | Unclassified | 3922 |
| 89 | Ga0075428_100002494 | 3300006844 | Bacteria | 19977 |
| 90 | Ga0075428_100145171 | 3300006844 | Bacteria | 2579 |
| 91 | Ga0075430_100027700 | 3300006846 | Bacteria | 4813 |
| 92 | Ga0075430_100030033 | 3300006846 | Bacteria | 4615 |
| 93 | Ga0075431_100003186 | 3300006847 | Bacteria | 15862 |
| 94 | Ga0075431_100033464 | 3300006847 | Bacteria | 5297 |
| 95 | Ga0075433_10002352 | 3300006852 | Bacteria | 14386 |
| 96 | Ga0075433_10009324 | 3300006852 | Bacteria | 7848 |
| 97 | Ga0075433_10030562 | 3300006852 | Bacteria | 4597 |
| 98 | Ga0075434_100001672 | 3300006871 | Bacteria | 18920 |
| 99 | Ga0075434_100047067 | 3300006871 | Bacteria | 4281 |
| 100 | Ga0075429_100012422 | 3300006880 | Bacteria | 7389 |
| 101 | Ga0068865_100009980 | 3300006881 | Bacteria | 5900 |
| 102 | Ga0097620_100005380 | 3300006931 | Bacteria | 13019 |
| 103 | Ga0097620_100009279 | 3300006931 | Bacteria | 9932 |
| 104 | Ga0097620_100017673 | 3300006931 | Bacteria | 7170 |
| 105 | Ga0097620_100066011 | 3300006931 | Unclassified | 3653 |
| 106 | Ga0075435_100028519 | 3300007076 | Bacteria | 4378 |
| 107 | Ga0111539_10000228 | 3300009094 | Bacteria | 67465 |
| 108 | Ga0111539_10004986 | 3300009094 | Bacteria | 17271 |
| 109 | Ga0111539_10034910 | 3300009094 | Bacteria | 6091 |
| 110 | Ga0105247_10000944 | 3300009101 | Bacteria | 21912 |
| 111 | Ga0105247_10055492 | 3300009101 | Bacteria | 2445 |
| 112 | Ga0114129_10006704 | 3300009147 | Bacteria | 16354 |
| 113 | Ga0114129_10009329 | 3300009147 | Bacteria | 13999 |
| 114 | Ga0114129_10010021 | 3300009147 | Bacteria | 13509 |
| 115 | Ga0114129_10012476 | 3300009147 | Bacteria | 12098 |
| 116 | Ga0114129_10033587 | 3300009147 | Bacteria | 7249 |
| 117 | Ga0114129_10058400 | 3300009147 | Bacteria | 5396 |
| 118 | Ga0105243_10005615 | 3300009148 | Bacteria | 9773 |
| 119 | Ga0105243_10101505 | 3300009148 | Bacteria | 2389 |
| 120 | Ga0105242_10036398 | 3300009176 | Unclassified | 3948 |
| 121 | Ga0105248_10006400 | 3300009177 | Bacteria | 12919 |
| 122 | Ga0105248_10008081 | 3300009177 | Bacteria | 11549 |
| 123 | Ga0105248_10009196 | 3300009177 | Bacteria | 10872 |
| 124 | Ga0105248_10102048 | 3300009177 | Archaea | 3233 |
| 125 | Ga0105237_10049323 | 3300009545 | Bacteria | 4232 |
| 126 | Ga0105237_10081870 | 3300009545 | Bacteria | 3219 |
| 127 | Ga0105238_10097190 | 3300009551 | Bacteria | 2931 |
| 128 | Ga0105249_10000082 | 3300009553 | Bacteria | 137479 |
| 129 | Ga0105249_10055801 | 3300009553 | Bacteria | 3616 |
| 130 | Ga0105249_10077243 | 3300009553 | Bacteria | 3087 |
| 131 | Ga0105246_10011182 | 3300011119 | Bacteria | 5564 |
| 132 | Ga0105246_10019014 | 3300011119 | Bacteria | 4382 |
| 133 | Ga0157373_10001858 | 3300013100 | Bacteria | 16027 |
| 134 | Ga0157374_10047468 | 3300013296 | Unclassified | 3982 |
| 135 | Ga0157378_10001322 | 3300013297 | Bacteria | 22280 |
| 136 | Ga0157378_10008601 | 3300013297 | Bacteria | 8883 |
| 137 | Ga0163162_10000002 | 3300013306 | Bacteria | 717331 |
| 138 | Ga0163162_10001013 | 3300013306 | Bacteria | 26117 |
| 139 | Ga0163162_10011990 | 3300013306 | Bacteria | 8453 |
| 140 | Ga0163162_10040952 | 3300013306 | Bacteria | 4634 |
| 141 | Ga0157372_10008458 | 3300013307 | Bacteria | 10924 |
| 142 | Ga0157375_10004041 | 3300013308 | Bacteria | 12730 |
| 143 | Ga0157375_10008670 | 3300013308 | Bacteria | 8909 |
| 144 | Ga0157375_10042956 | 3300013308 | Bacteria | 4380 |
| 145 | Ga0163163_10002089 | 3300014325 | Bacteria | 16871 |
| 146 | Ga0163163_10042249 | 3300014325 | Bacteria | 4464 |
| 147 | Ga0157380_10002345 | 3300014326 | Bacteria | 12725 |
| 148 | Ga0157380_10011006 | 3300014326 | Bacteria | 6524 |
| 149 | Ga0157380_10017133 | 3300014326 | Bacteria | 5358 |
| 150 | Ga0157379_10052947 | 3300014968 | Unclassified | 3625 |
| 151 | Ga0157376_10008177 | 3300014969 | Bacteria | 7527 |
| 152 | Ga0163161_10015337 | 3300017792 | Bacteria | 5342 |
| 153 | Ga0163161_10029578 | 3300017792 | Unclassified | 3894 |
| 154 | Ga0207653_10001574 | 3300025885 | Bacteria | 7379 |
| 155 | Ga0207685_10000023 | 3300025905 | Bacteria | 115280 |
| 156 | Ga0207643_10000772 | 3300025908 | Bacteria | 19526 |
| 157 | Ga0207643_10005629 | 3300025908 | Bacteria | 6697 |
| 158 | Ga0207684_10000327 | 3300025910 | Bacteria | 67005 |
| 159 | Ga0207684_10041373 | 3300025910 | Bacteria | 3908 |
| 160 | Ga0207707_10000142 | 3300025912 | Bacteria | 74613 |
| 161 | Ga0207707_10007357 | 3300025912 | Bacteria | 9590 |
| 162 | Ga0207660_10001107 | 3300025917 | Bacteria | 18007 |
| 163 | Ga0207662_10002776 | 3300025918 | Bacteria | 8852 |
| 164 | Ga0207662_10029220 | 3300025918 | Bacteria | 3193 |
| 165 | Ga0207652_10000361 | 3300025921 | Bacteria | 47204 |
| 166 | Ga0207681_10002484 | 3300025923 | Bacteria | 11702 |
| 167 | Ga0207681_10064741 | 3300025923 | Bacteria | 2525 |
| 168 | Ga0207650_10000313 | 3300025925 | Bacteria | 47889 |
| 169 | Ga0207650_10006386 | 3300025925 | Bacteria | 8027 |
| 170 | Ga0207670_10003326 | 3300025936 | Bacteria | 8522 |
| 171 | Ga0207665_10009584 | 3300025939 | Bacteria | 6360 |
| 172 | Ga0207691_10000900 | 3300025940 | Bacteria | 29470 |
| 173 | Ga0207711_10005593 | 3300025941 | Bacteria | 10623 |
| 174 | Ga0207711_10032527 | 3300025941 | Unclassified | 4410 |
| 175 | Ga0207689_10005860 | 3300025942 | Bacteria | 10891 |
| 176 | Ga0207712_10000075 | 3300025961 | Bacteria | 120693 |
| 177 | Ga0207712_10002045 | 3300025961 | Bacteria | 13239 |
| 178 | Ga0207712_10021739 | 3300025961 | Bacteria | 4215 |
| 179 | Ga0207668_10002494 | 3300025972 | Bacteria | 10746 |
| 180 | Ga0207703_10035883 | 3300026035 | Bacteria | 3942 |
| 181 | Ga0207708_10000149 | 3300026075 | Bacteria | 56107 |
| 182 | Ga0207708_10039563 | 3300026075 | Archaea | 3593 |
| 183 | Ga0207708_10043423 | 3300026075 | Bacteria | 3426 |
| 184 | Ga0207648_10011405 | 3300026089 | Bacteria | 8374 |
| 185 | Ga0207676_10005806 | 3300026095 | Bacteria | 8726 |
| 186 | Ga0207674_10000115 | 3300026116 | Bacteria | 93114 |
| 187 | Ga0207674_10011394 | 3300026116 | Bacteria | 9993 |
| 188 | Ga0207675_100004070 | 3300026118 | Bacteria | 14154 |
| 189 | Ga0207675_100006388 | 3300026118 | Bacteria | 11168 |
| 190 | Ga0207675_100078481 | 3300026118 | Bacteria | 3093 |
| 191 | Ga0207675_100089534 | 3300026118 | Bacteria | 2892 |
| 192 | Ga0207698_10036118 | 3300026142 | Bacteria | 3623 |
| 193 | Ga0207428_10004885 | 3300027907 | Bacteria | 12629 |
| 194 | Ga0268265_10025671 | 3300028380 | Bacteria | 4186 |
| 195 | Ga0268264_10025622 | 3300028381 | Unclassified | 4818 |
| 196 | Ga0307513_10013668 | 3300031456 | Bacteria | 9954 |
| 197 | Ga0307412_10025637 | 3300031911 | Bacteria | 3653 |
| 198 | Ga0307414_10014280 | 3300032004 | Unclassified | 4756 |
| 199 | Ga0373937_0045164 | 3300036401 | Bacteria | 4025 |
| 200 | Ga0395901_0108712 | 3300038443 | Unclassified | 2911 |
| 201 | Ga0242420_000398 | 3300038996 | Bacteria | 4831 |
| 202 | Ga0495663_0000250 | 3300046525 | Bacteria | 20919 |
| 203 | Ga0495598_0000043 | 3300046537 | Bacteria | 19015 |
| 204 | Ga0495598_0010709 | 3300046537 | Bacteria | 2204 |
| 205 | Ga0495613_0014724 | 3300046689 | Bacteria | 5805 |
| 206 | Ga0496104_0067757 | 3300048907 | Bacteria | 3391 |
| 207 | Ga0496106_0043924 | 3300048909 | Unclassified | 3355 |
| 208 | Ga0496108_0097011 | 3300048911 | Bacteria | 2512 |
| 209 | Ga0496109_0000005 | 3300048912 | Bacteria | 358226 |
| 210 | Ga0501291_000993 | 3300049514 | Bacteria | 3277 |
| 211 | Ga0501038_0002990 | 3300049574 | Bacteria | 15762 |
| 212 | Ga0501207_003839 | 3300049654 | Bacteria | 2021 |
| 213 | Ga0501216_000732 | 3300049660 | Bacteria | 4074 |
| 214 | Ga0501216_001945 | 3300049660 | Unclassified | 2871 |
| 215 | Ga0501216_005359 | 3300049660 | Bacteria | 1931 |
| 216 | Ga0501227_000607 | 3300049665 | Bacteria | 7795 |
| 217 | Ga0501227_002288 | 3300049665 | Unclassified | 4234 |
| 218 | Ga0501235_002175 | 3300049669 | Bacteria | 4208 |
| 219 | Ga0501247_003492 | 3300049677 | Bacteria | 1685 |
| 220 | Ga0501225_0002994 | 3300049705 | Bacteria | 5158 |
| 221 | Ga0501283_000742 | 3300049779 | Bacteria | 4272 |
| 222 | Ga0501226_001358 | 3300049853 | Unclassified | 3163 |
| 223 | nmdc:mga05p37_35989_c1 | 3300050507 | Bacteria | 6074 |
| 224 | nmdc:mga06r32_4789_c1 | 3300050510 | Bacteria | 12177 |
| 225 | nmdc:mga08y16_20377_c1 | 3300050511 | Bacteria | 6999 |
| 226 | nmdc:mga0n895_35324_c1 | 3300050512 | Unclassified | 4818 |
| 227 | nmdc:mga0rr50_2949_c1 | 3300050513 | Bacteria | 9730 |
| 228 | nmdc:mga0rr50_47940_c1 | 3300050513 | Bacteria | 3155 |
| 229 | nmdc:mga0a205_330_c1 | 3300050515 | Bacteria | 35421 |
| 230 | nmdc:mga0a205_37996_c1 | 3300050515 | Bacteria | 4631 |
| 231 | nmdc:mga0a205_48637_c1 | 3300050515 | Bacteria | 4093 |
| 232 | nmdc:mga0a205_70837_c1 | 3300050515 | Unclassified | 3367 |
| 233 | Ga0501084_0138090 | 3300054114 | Bacteria | 2052 |
| 234 | Ga0530510_0036321 | 3300061734 | Unclassified | 3552 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049660 | Ga0501216_005359 | Ga0501216_005359_305_1897 | 516 |
| 2 | 3300049677 | Ga0501247_003492 | Ga0501247_003492_18_1610 | 516 |
| 3 | 3300046537 | Ga0495598_0010709 | Ga0495598_0010709_70_2121 | 520 |
| 4 | 3300006844 | Ga0075428_100145171 | Ga0075428_1001451712 | 524 |
| 5 | 3300009553 | Ga0105249_10000082 | Ga0105249_1000008236 | 526 |
| 6 | 3300013306 | Ga0163162_10000002 | Ga0163162_10000002521 | 526 |
| 7 | 3300049654 | Ga0501207_003839 | Ga0501207_003839_18_1604 | 527 |
| 8 | 3300025961 | Ga0207712_10000075 | Ga0207712_1000007570 | 532 |
| 9 | 3300006871 | Ga0075434_100047067 | Ga0075434_1000470672 | 536 |
| 10 | 3300050512 | nmdc:mga0n895_35324_c1 | nmdc:mga0n895_35324_c1_1269_3467 | 536 |
| 11 | 3300006163 | Ga0070715_10000081 | Ga0070715_1000008111 | 537 |
| 12 | 3300025905 | Ga0207685_10000023 | Ga0207685_10000023109 | 537 |
| 13 | 3300046689 | Ga0495613_0014724 | Ga0495613_0014724_2137_4398 | 540 |
| 14 | 3300025972 | Ga0207668_10002494 | Ga0207668_100024947 | 543 |
| 15 | 3300036401 | Ga0373937_0045164 | Ga0373937_0045164_306_2567 | 543 |
| 16 | 3300054114 | Ga0501084_0138090 | Ga0501084_0138090_66_1802 | 545 |
| 17 | 3300048912 | Ga0496109_0000005 | Ga0496109_0000005_117222_119426 | 553 |
| 18 | 3300061734 | Ga0530510_0036321 | Ga0530510_0036321_20_2068 | 557 |
| 19 | 3300005295 | Ga0065707_10002183 | Ga0065707_100021832 | 562 |
| 20 | 3300009147 | Ga0114129_10009329 | Ga0114129_100093295 | 563 |
| 21 | 3300038996 | Ga0242420_000398 | Ga0242420_000398_2712_4751 | 563 |
| 22 | 3300005471 | Ga0070698_100011852 | Ga0070698_1000118524 | 564 |
| 23 | 3300005518 | Ga0070699_100021971 | Ga0070699_1000219713 | 566 |
| 24 | 3300049665 | Ga0501227_002288 | Ga0501227_002288_693_2792 | 566 |
| 25 | 3300031456 | Ga0307513_10013668 | Ga0307513_100136681 | 569 |
| 26 | 3300005536 | Ga0070697_100000135 | Ga0070697_10000013513 | 570 |
| 27 | 3300006844 | Ga0075428_100002494 | Ga0075428_10000249414 | 572 |
| 28 | 3300006847 | Ga0075431_100003186 | Ga0075431_10000318611 | 572 |
| 29 | 3300009094 | Ga0111539_10034910 | Ga0111539_100349104 | 572 |
| 30 | 3300027907 | Ga0207428_10004885 | Ga0207428_100048852 | 572 |
| 31 | 3300028380 | Ga0268265_10025671 | Ga0268265_100256712 | 572 |
| 32 | 3300050510 | nmdc:mga06r32_4789_c1 | nmdc:mga06r32_4789_c1_4945_7194 | 572 |
| 33 | 3300050511 | nmdc:mga08y16_20377_c1 | nmdc:mga08y16_20377_c1_3856_6105 | 572 |
| 34 | 3300005445 | Ga0070708_100000281 | Ga0070708_10000028117 | 576 |
| 35 | 3300005467 | Ga0070706_100001677 | Ga0070706_10000167718 | 576 |
| 36 | 3300005468 | Ga0070707_100028948 | Ga0070707_1000289483 | 576 |
| 37 | 3300005518 | Ga0070699_100002373 | Ga0070699_10000237314 | 576 |
| 38 | 3300005536 | Ga0070697_100025601 | Ga0070697_1000256014 | 576 |
| 39 | 3300006852 | Ga0075433_10002352 | Ga0075433_1000235212 | 576 |
| 40 | 3300006871 | Ga0075434_100001672 | Ga0075434_1000016724 | 576 |
| 41 | 3300050515 | nmdc:mga0a205_330_c1 | nmdc:mga0a205_330_c1_8946_11204 | 576 |
| 42 | 3300005331 | Ga0070670_100000951 | Ga0070670_10000095125 | 577 |
| 43 | 3300025923 | Ga0207681_10002484 | Ga0207681_100024847 | 577 |
| 44 | 3300025925 | Ga0207650_10006386 | Ga0207650_100063866 | 577 |
| 45 | 3300005471 | Ga0070698_100009193 | Ga0070698_10000919310 | 583 |
| 46 | 3300005536 | Ga0070697_100038797 | Ga0070697_1000387973 | 583 |
| 47 | 3300005337 | Ga0070682_100047810 | Ga0070682_1000478102 | 584 |
| 48 | 3300005406 | Ga0070703_10001260 | Ga0070703_100012606 | 584 |
| 49 | 3300005440 | Ga0070705_100007861 | Ga0070705_1000078615 | 584 |
| 50 | 3300005547 | Ga0070693_100002752 | Ga0070693_1000027524 | 584 |
| 51 | 3300005616 | Ga0068852_100009711 | Ga0068852_1000097111 | 584 |
| 52 | 3300005617 | Ga0068859_100005380 | Ga0068859_1000053805 | 584 |
| 53 | 3300005842 | Ga0068858_100094939 | Ga0068858_1000949392 | 584 |
| 54 | 3300006931 | Ga0097620_100005380 | Ga0097620_1000053805 | 584 |
| 55 | 3300009545 | Ga0105237_10081870 | Ga0105237_100818702 | 584 |
| 56 | 3300025885 | Ga0207653_10001574 | Ga0207653_100015746 | 584 |
| 57 | 3300005293 | Ga0065715_10089590 | Ga0065715_100895905 | 586 |
| 58 | 3300005458 | Ga0070681_10008122 | Ga0070681_100081228 | 586 |
| 59 | 3300005543 | Ga0070672_100023453 | Ga0070672_1000234531 | 586 |
| 60 | 3300005545 | Ga0070695_100015882 | Ga0070695_1000158823 | 586 |
| 61 | 3300009545 | Ga0105237_10049323 | Ga0105237_100493233 | 586 |
| 62 | 3300025912 | Ga0207707_10007357 | Ga0207707_100073578 | 586 |
| 63 | 3300049660 | Ga0501216_001945 | Ga0501216_001945_271_2484 | 587 |
| 64 | 3300049665 | Ga0501227_000607 | Ga0501227_000607_3870_6083 | 587 |
| 65 | 3300009147 | Ga0114129_10012476 | Ga0114129_100124767 | 588 |
| 66 | 3300050507 | nmdc:mga05p37_35989_c1 | nmdc:mga05p37_35989_c1_1685_3883 | 588 |
| 67 | 3300005518 | Ga0070699_100001043 | Ga0070699_10000104320 | 589 |
| 68 | 3300006852 | Ga0075433_10030562 | Ga0075433_100305623 | 589 |
| 69 | 3300014326 | Ga0157380_10002345 | Ga0157380_100023452 | 589 |
| 70 | 3300050515 | nmdc:mga0a205_37996_c1 | nmdc:mga0a205_37996_c1_1629_3833 | 589 |
| 71 | 3300050515 | nmdc:mga0a205_48637_c1 | nmdc:mga0a205_48637_c1_306_2516 | 589 |
| 72 | 3300005330 | Ga0070690_100009424 | Ga0070690_1000094242 | 590 |
| 73 | 3300005844 | Ga0068862_100027800 | Ga0068862_1000278002 | 590 |
| 74 | 3300009101 | Ga0105247_10055492 | Ga0105247_100554922 | 590 |
| 75 | 3300009551 | Ga0105238_10097190 | Ga0105238_100971902 | 590 |
| 76 | 3300009553 | Ga0105249_10077243 | Ga0105249_100772432 | 590 |
| 77 | 3300013308 | Ga0157375_10008670 | Ga0157375_100086702 | 590 |
| 78 | 3300005353 | Ga0070669_100010180 | Ga0070669_1000101806 | 591 |
| 79 | 3300005617 | Ga0068859_100017673 | Ga0068859_1000176734 | 591 |
| 80 | 3300005844 | Ga0068862_100009067 | Ga0068862_1000090674 | 591 |
| 81 | 3300006931 | Ga0097620_100017673 | Ga0097620_1000176734 | 591 |
| 82 | 3300014326 | Ga0157380_10017133 | Ga0157380_100171334 | 591 |
| 83 | 3300025923 | Ga0207681_10064741 | Ga0207681_100647412 | 591 |
| 84 | 3300026075 | Ga0207708_10043423 | Ga0207708_100434232 | 591 |
| 85 | 3300007076 | Ga0075435_100028519 | Ga0075435_1000285191 | 593 |
| 86 | 3300050513 | nmdc:mga0rr50_2949_c1 | nmdc:mga0rr50_2949_c1_3299_5503 | 593 |
| 87 | 3300005467 | Ga0070706_100053356 | Ga0070706_1000533562 | 594 |
| 88 | 3300006173 | Ga0070716_100013732 | Ga0070716_1000137322 | 594 |
| 89 | 3300025910 | Ga0207684_10041373 | Ga0207684_100413732 | 594 |
| 90 | 3300025939 | Ga0207665_10009584 | Ga0207665_100095843 | 594 |
| 91 | 3300048911 | Ga0496108_0097011 | Ga0496108_0097011_298_2460 | 594 |
| 92 | 3300005616 | Ga0068852_100045085 | Ga0068852_1000450852 | 595 |
| 93 | 3300005985 | Ga0081539_10036955 | Ga0081539_100369551 | 595 |
| 94 | 3300009177 | Ga0105248_10008081 | Ga0105248_100080812 | 595 |
| 95 | 3300013297 | Ga0157378_10001322 | Ga0157378_1000132218 | 595 |
| 96 | 3300013306 | Ga0163162_10001013 | Ga0163162_1000101314 | 595 |
| 97 | 3300013306 | Ga0163162_10040952 | Ga0163162_100409522 | 595 |
| 98 | 3300013308 | Ga0157375_10004041 | Ga0157375_100040416 | 595 |
| 99 | 3300017792 | Ga0163161_10015337 | Ga0163161_100153373 | 595 |
| 100 | 3300025918 | Ga0207662_10029220 | Ga0207662_100292202 | 595 |
| 101 | 3300026118 | Ga0207675_100089534 | Ga0207675_1000895342 | 595 |
| 102 | 3300026142 | Ga0207698_10036118 | Ga0207698_100361182 | 595 |
| 103 | 3300005288 | Ga0065714_10064424 | Ga0065714_10064424100 | 596 |
| 104 | 3300005290 | Ga0065712_10000117 | Ga0065712_10000117100 | 596 |
| 105 | 3300006846 | Ga0075430_100027700 | Ga0075430_1000277004 | 596 |
| 106 | 3300006847 | Ga0075431_100033464 | Ga0075431_1000334645 | 596 |
| 107 | 3300006880 | Ga0075429_100012422 | Ga0075429_1000124223 | 596 |
| 108 | 3300009147 | Ga0114129_10058400 | Ga0114129_100584004 | 596 |
| 109 | 3300009177 | Ga0105248_10006400 | Ga0105248_100064004 | 596 |
| 110 | 3300025941 | Ga0207711_10005593 | Ga0207711_100055935 | 596 |
| 111 | 3300005441 | Ga0070700_100000087 | Ga0070700_10000008748 | 597 |
| 112 | 3300026075 | Ga0207708_10000149 | Ga0207708_1000014940 | 597 |
| 113 | 3300005290 | Ga0065712_10004776 | Ga0065712_100047762 | 598 |
| 114 | 3300005330 | Ga0070690_100010333 | Ga0070690_1000103333 | 598 |
| 115 | 3300005335 | Ga0070666_10017513 | Ga0070666_100175133 | 598 |
| 116 | 3300005340 | Ga0070689_100027160 | Ga0070689_1000271603 | 598 |
| 117 | 3300005364 | Ga0070673_100034940 | Ga0070673_1000349402 | 598 |
| 118 | 3300005365 | Ga0070688_100013296 | Ga0070688_1000132964 | 598 |
| 119 | 3300005441 | Ga0070700_100029667 | Ga0070700_1000296672 | 598 |
| 120 | 3300005459 | Ga0068867_100038806 | Ga0068867_1000388062 | 598 |
| 121 | 3300005466 | Ga0070685_10008831 | Ga0070685_100088314 | 598 |
| 122 | 3300005544 | Ga0070686_100022363 | Ga0070686_1000223633 | 598 |
| 123 | 3300005615 | Ga0070702_100009654 | Ga0070702_1000096542 | 598 |
| 124 | 3300005841 | Ga0068863_100013418 | Ga0068863_1000134184 | 598 |
| 125 | 3300005842 | Ga0068858_100038801 | Ga0068858_1000388013 | 598 |
| 126 | 3300005843 | Ga0068860_100047765 | Ga0068860_1000477652 | 598 |
| 127 | 3300005844 | Ga0068862_100010948 | Ga0068862_1000109485 | 598 |
| 128 | 3300006237 | Ga0097621_100034189 | Ga0097621_1000341892 | 598 |
| 129 | 3300006358 | Ga0068871_100036334 | Ga0068871_1000363342 | 598 |
| 130 | 3300006881 | Ga0068865_100009980 | Ga0068865_1000099803 | 598 |
| 131 | 3300009148 | Ga0105243_10005615 | Ga0105243_100056157 | 598 |
| 132 | 3300009176 | Ga0105242_10036398 | Ga0105242_100363984 | 598 |
| 133 | 3300009177 | Ga0105248_10102048 | Ga0105248_101020483 | 598 |
| 134 | 3300011119 | Ga0105246_10011182 | Ga0105246_100111823 | 598 |
| 135 | 3300013296 | Ga0157374_10047468 | Ga0157374_100474682 | 598 |
| 136 | 3300013297 | Ga0157378_10008601 | Ga0157378_100086012 | 598 |
| 137 | 3300014968 | Ga0157379_10052947 | Ga0157379_100529472 | 598 |
| 138 | 3300014969 | Ga0157376_10008177 | Ga0157376_100081777 | 598 |
| 139 | 3300017792 | Ga0163161_10029578 | Ga0163161_100295783 | 598 |
| 140 | 3300025908 | Ga0207643_10005629 | Ga0207643_100056296 | 598 |
| 141 | 3300025918 | Ga0207662_10002776 | Ga0207662_100027766 | 598 |
| 142 | 3300025940 | Ga0207691_10000900 | Ga0207691_100009008 | 598 |
| 143 | 3300025941 | Ga0207711_10032527 | Ga0207711_100325272 | 598 |
| 144 | 3300025942 | Ga0207689_10005860 | Ga0207689_100058606 | 598 |
| 145 | 3300026075 | Ga0207708_10039563 | Ga0207708_100395632 | 598 |
| 146 | 3300026089 | Ga0207648_10011405 | Ga0207648_100114055 | 598 |
| 147 | 3300026118 | Ga0207675_100006388 | Ga0207675_1000063888 | 598 |
| 148 | 3300050515 | nmdc:mga0a205_70837_c1 | nmdc:mga0a205_70837_c1_488_2686 | 598 |
| 149 | 3300005843 | Ga0068860_100112195 | Ga0068860_1001121951 | 601 |
| 150 | 3300049660 | Ga0501216_000732 | Ga0501216_000732_1032_3233 | 603 |
| 151 | 3300005337 | Ga0070682_100000548 | Ga0070682_10000054813 | 604 |
| 152 | 3300013307 | Ga0157372_10008458 | Ga0157372_100084585 | 604 |
| 153 | 3300046525 | Ga0495663_0000250 | Ga0495663_0000250_16313_18532 | 604 |
| 154 | 3300046537 | Ga0495598_0000043 | Ga0495598_0000043_3862_6084 | 604 |
| 155 | 3300005336 | Ga0070680_100001177 | Ga0070680_1000011773 | 605 |
| 156 | 3300005458 | Ga0070681_10001035 | Ga0070681_1000103518 | 605 |
| 157 | 3300005530 | Ga0070679_100000253 | Ga0070679_10000025333 | 605 |
| 158 | 3300005617 | Ga0068859_100009279 | Ga0068859_1000092797 | 605 |
| 159 | 3300006931 | Ga0097620_100009279 | Ga0097620_1000092797 | 605 |
| 160 | 3300013308 | Ga0157375_10042956 | Ga0157375_100429563 | 605 |
| 161 | 3300014325 | Ga0163163_10042249 | Ga0163163_100422493 | 605 |
| 162 | 3300025912 | Ga0207707_10000142 | Ga0207707_1000014222 | 605 |
| 163 | 3300025917 | Ga0207660_10001107 | Ga0207660_100011073 | 605 |
| 164 | 3300025921 | Ga0207652_10000361 | Ga0207652_1000036123 | 605 |
| 165 | 3300038443 | Ga0395901_0108712 | Ga0395901_0108712_17_2263 | 605 |
| 166 | 3300049853 | Ga0501226_001358 | Ga0501226_001358_150_2363 | 605 |
| 167 | 3300050513 | nmdc:mga0rr50_47940_c1 | nmdc:mga0rr50_47940_c1_499_2709 | 605 |
| 168 | 3300025908 | Ga0207643_10000772 | Ga0207643_100007729 | 606 |
| 169 | 3300048907 | Ga0496104_0067757 | Ga0496104_0067757_114_2324 | 606 |
| 170 | 3300005536 | Ga0070697_100075080 | Ga0070697_1000750801 | 607 |
| 171 | 3300005548 | Ga0070665_100084116 | Ga0070665_1000841162 | 607 |
| 172 | 3300005618 | Ga0068864_100002514 | Ga0068864_1000025143 | 607 |
| 173 | 3300005842 | Ga0068858_100020163 | Ga0068858_1000201634 | 607 |
| 174 | 3300014326 | Ga0157380_10011006 | Ga0157380_100110065 | 607 |
| 175 | 3300026035 | Ga0207703_10035883 | Ga0207703_100358832 | 607 |
| 176 | 3300026095 | Ga0207676_10005806 | Ga0207676_100058062 | 607 |
| 177 | 3300005445 | Ga0070708_100012045 | Ga0070708_1000120454 | 608 |
| 178 | 3300005577 | Ga0068857_100056302 | Ga0068857_1000563021 | 608 |
| 179 | 3300032004 | Ga0307414_10014280 | Ga0307414_100142804 | 608 |
| 180 | 3300005336 | Ga0070680_100069402 | Ga0070680_1000694021 | 610 |
| 181 | 3300006852 | Ga0075433_10009324 | Ga0075433_100093244 | 614 |
| 182 | 3300009147 | Ga0114129_10006704 | Ga0114129_100067045 | 614 |
| 183 | 3300049514 | Ga0501291_000993 | Ga0501291_000993_273_2495 | 614 |
| 184 | 3300049779 | Ga0501283_000742 | Ga0501283_000742_995_3217 | 614 |
| 185 | 3300005366 | Ga0070659_100027884 | Ga0070659_1000278843 | 615 |
| 186 | 3300005458 | Ga0070681_10046626 | Ga0070681_100466263 | 615 |
| 187 | 3300005530 | Ga0070679_100008007 | Ga0070679_1000080072 | 615 |
| 188 | 3300005719 | Ga0068861_100015233 | Ga0068861_1000152334 | 615 |
| 189 | 3300009147 | Ga0114129_10033587 | Ga0114129_100335875 | 615 |
| 190 | 3300009148 | Ga0105243_10101505 | Ga0105243_101015051 | 615 |
| 191 | 3300026118 | Ga0207675_100078481 | Ga0207675_1000784812 | 615 |
| 192 | 3300005842 | Ga0068858_100114450 | Ga0068858_1001144501 | 616 |
| 193 | 3300013306 | Ga0163162_10011990 | Ga0163162_100119908 | 616 |
| 194 | 3300005564 | Ga0070664_100009988 | Ga0070664_1000099885 | 617 |
| 195 | 3300005577 | Ga0068857_100006099 | Ga0068857_1000060997 | 617 |
| 196 | 3300026116 | Ga0207674_10000115 | Ga0207674_1000011532 | 617 |
| 197 | 3300005467 | Ga0070706_100000146 | Ga0070706_10000014672 | 619 |
| 198 | 3300009177 | Ga0105248_10009196 | Ga0105248_100091966 | 619 |
| 199 | 3300025910 | Ga0207684_10000327 | Ga0207684_1000032754 | 619 |
| 200 | 3300048909 | Ga0496106_0043924 | Ga0496106_0043924_1121_3328 | 619 |
| 201 | 3300049574 | Ga0501038_0002990 | Ga0501038_0002990_9930_12152 | 619 |
| 202 | 3300005985 | Ga0081539_10000537 | Ga0081539_1000053722 | 620 |
| 203 | 3300025961 | Ga0207712_10021739 | Ga0207712_100217392 | 621 |
| 204 | 3300031911 | Ga0307412_10025637 | Ga0307412_100256372 | 621 |
| 205 | 3300049669 | Ga0501235_002175 | Ga0501235_002175_1714_3930 | 621 |
| 206 | 3300049705 | Ga0501225_0002994 | Ga0501225_0002994_402_2618 | 621 |
| 207 | 3300006846 | Ga0075430_100030033 | Ga0075430_1000300332 | 622 |
| 208 | 3300009147 | Ga0114129_10010021 | Ga0114129_100100218 | 622 |
| 209 | 3300026116 | Ga0207674_10011394 | Ga0207674_100113945 | 623 |
| 210 | 3300009094 | Ga0111539_10004986 | Ga0111539_100049868 | 624 |
| 211 | 3300009553 | Ga0105249_10055801 | Ga0105249_100558011 | 624 |
| 212 | 3300011119 | Ga0105246_10019014 | Ga0105246_100190142 | 624 |
| 213 | 3300013100 | Ga0157373_10001858 | Ga0157373_1000185815 | 624 |
| 214 | 3300025961 | Ga0207712_10002045 | Ga0207712_100020455 | 624 |
| 215 | 3300005295 | Ga0065707_10001764 | Ga0065707_100017643 | 625 |
| 216 | 3300005340 | Ga0070689_100000425 | Ga0070689_10000042523 | 625 |
| 217 | 3300005441 | Ga0070700_100002603 | Ga0070700_1000026037 | 625 |
| 218 | 3300005471 | Ga0070698_100014956 | Ga0070698_1000149562 | 625 |
| 219 | 3300005617 | Ga0068859_100066006 | Ga0068859_1000660063 | 625 |
| 220 | 3300005618 | Ga0068864_100040742 | Ga0068864_1000407422 | 625 |
| 221 | 3300005841 | Ga0068863_100027431 | Ga0068863_1000274313 | 625 |
| 222 | 3300006931 | Ga0097620_100066011 | Ga0097620_1000660113 | 625 |
| 223 | 3300009094 | Ga0111539_10000228 | Ga0111539_1000022813 | 625 |
| 224 | 3300025936 | Ga0207670_10003326 | Ga0207670_100033269 | 625 |
| 225 | 3300028381 | Ga0268264_10025622 | Ga0268264_100256222 | 625 |
| 226 | 3300005719 | Ga0068861_100030289 | Ga0068861_1000302893 | 626 |
| 227 | 3300026118 | Ga0207675_100004070 | Ga0207675_1000040703 | 626 |
| 228 | 3300005290 | Ga0065712_10072735 | Ga0065712_100727353 | 628 |
| 229 | 3300005293 | Ga0065715_10091714 | Ga0065715_100917142 | 628 |
| 230 | 3300009101 | Ga0105247_10000944 | Ga0105247_1000094415 | 628 |
| 231 | 3300002459 | JGI24751J29686_10000099 | JGI24751J29686_1000009923 | 629 |
| 232 | 3300005331 | Ga0070670_100000297 | Ga0070670_10000029725 | 629 |
| 233 | 3300014325 | Ga0163163_10002089 | Ga0163163_100020893 | 629 |
| 234 | 3300025925 | Ga0207650_10000313 | Ga0207650_1000031323 | 629 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6aem-assembly2.cif.gz_B | crystal structure of the pkd1 domain of vibrio anguillarum epp | 0.8719 | 536 | 628 |
| 4l9d-assembly2.cif.gz_B | crystal structure of the pkd1 domain from vibrio cholerae metalloprotease prtv | 0.8626 | 536 | 628 |
| 4l9d-assembly2.cif.gz_B | crystal structure of the pkd1 domain from vibrio cholerae metalloprotease prtv | 0.8242 | 536 | 628 |
| 6aem-assembly2.cif.gz_B | crystal structure of the pkd1 domain of vibrio anguillarum epp | 0.807 | 536 | 628 |
| 8oty-assembly1.cif.gz_A | crystal structure of the titin domain fn3-90 | 0.7713 | 451 | 533 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6aemA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8696 | 536 | 628 | 2.60.40.10 |
| af_Q8WZ42_26414_26508_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8237 | 451 | 534 | 2.60.40.10 |
| af_Q8WZ42_15406_15507_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8236 | 451 | 533 | 2.60.40.10 |
| af_Q8WZ42_18928_19021_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.811 | 451 | 531 | 2.60.40.10 |
| 6aemA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.805 | 536 | 628 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y8LZX1-F1-model_v4 | Bacterial Ig-like domain-containing protein | 0.9853 | 554 | 629 |
|
| AF-A0A2E8HLV7-F1-model_v4 | Penicillin-binding C-terminal domain-containing protein | 0.9608 | 555 | 629 |
|
| AF-A0A2V9M2W5-F1-model_v4 | Bacterial Ig-like domain-containing protein | 0.9588 | 534 | 628 |
|
| AF-A0A838RZV9-F1-model_v4 | Uncharacterized protein | 0.9566 | 463 | 629 |
|
| AF-A0A3C0CV30-F1-model_v4 | Uncharacterized protein | 0.9523 | 556 | 629 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar