F347205

General Info

Members Datasets Scaffolds Average Seq Length
234 137 234 610

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100078481|Ga0207675_1000784812
Length 690
Sequence LLRHLRKHLAGFVGALLLTAVSAPATYSGQPIIWETSGRADLLKGDARGVSISDTGMLMLAPRLTEVFNTEQAFVWSSAVDAQGNVYLGTGHDGKIFRVSADGRGSLLYDKPESSLLIATNQKAFALFDAHLREIHALAPAADGSIYALALSDAASTGRQPAAATAPQPTDGSGVPSTSVTITAIDESGAPIQTAGQPTRSRTDIASARSAVFRILPDGATDVVWSSPSVTAFAIAPALQPGSVLIGTADKGRIYSVTNDGRDTLLLQSTEGQISSFQVRGNQVYAASSNQGKVFRFGPELIAEGTYESPVRDAKLTASWGRIWWRGSGNVELQTRSGNGERPDATWSEWSGSYRDPGGSPISSPRARFIQWRALLRSTGSGPTWMEDASLAYLPRNVAPEVLSITSLPIGVGLQQLAQVQVDPNVESSGLDPSLFGAVAVVPPRRIFQRGARSFQWQAEDRNGDTLEYAIYYRPLNETTFRLLRDKLRDNFYTIDGATLADGRYIIKIIASDAPDNPMGQALTGERLSEPVDIDNTPPVLRALTPQASSGNRVAFEVDDATGKIKRGDFSLDGAPWTPLFPDDGIADSGHEQYSVELPALAPGEHTVSLRAFDGTAQVWRSWWVDGRAPTDIGAPLSGTFTNDVGTLTGDGARSRWSRIHTGAPRWEQTVSKDGTNWETNWVADFERVA

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
113 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
114 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
123 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
124 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
125 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
126 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
127 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
128 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
129 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.71
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000099 3300002459 Bacteria 47837
2 Ga0065714_10064424 3300005288 Bacteria 236118
3 Ga0065712_10000117 3300005290 Bacteria 235194
4 Ga0065712_10004776 3300005290 Unclassified 4505
5 Ga0065712_10072735 3300005290 Bacteria 4631
6 Ga0065715_10089590 3300005293 Bacteria 9335
7 Ga0065715_10091714 3300005293 Bacteria 5590
8 Ga0065707_10001764 3300005295 Bacteria 8859
9 Ga0065707_10002183 3300005295 Bacteria 5827
10 Ga0070690_100009424 3300005330 Bacteria 5655
11 Ga0070690_100010333 3300005330 Bacteria 5429
12 Ga0070670_100000297 3300005331 Bacteria 43678
13 Ga0070670_100000951 3300005331 Bacteria 22713
14 Ga0070666_10017513 3300005335 Unclassified 4594
15 Ga0070680_100001177 3300005336 Bacteria 18825
16 Ga0070680_100069402 3300005336 Bacteria 2894
17 Ga0070682_100000548 3300005337 Bacteria 23320
18 Ga0070682_100047810 3300005337 Bacteria 2661
19 Ga0070689_100000425 3300005340 Bacteria 24906
20 Ga0070689_100027160 3300005340 Unclassified 4314
21 Ga0070669_100010180 3300005353 Bacteria 6683
22 Ga0070673_100034940 3300005364 Archaea 3809
23 Ga0070688_100013296 3300005365 Unclassified 4636
24 Ga0070659_100027884 3300005366 Bacteria 4355
25 Ga0070703_10001260 3300005406 Bacteria 7702
26 Ga0070705_100007861 3300005440 Bacteria 5266
27 Ga0070700_100000087 3300005441 Bacteria 62003
28 Ga0070700_100002603 3300005441 Bacteria 9230
29 Ga0070700_100029667 3300005441 Archaea 3263
30 Ga0070708_100000281 3300005445 Bacteria 38291
31 Ga0070708_100012045 3300005445 Bacteria 7048
32 Ga0070681_10001035 3300005458 Bacteria 23588
33 Ga0070681_10008122 3300005458 Bacteria 10271
34 Ga0070681_10046626 3300005458 Bacteria 4332
35 Ga0068867_100038806 3300005459 Unclassified 3469
36 Ga0070685_10008831 3300005466 Bacteria 5194
37 Ga0070706_100000146 3300005467 Bacteria 89818
38 Ga0070706_100001677 3300005467 Bacteria 23063
39 Ga0070706_100053356 3300005467 Unclassified 3731
40 Ga0070707_100028948 3300005468 Bacteria 5273
41 Ga0070698_100009193 3300005471 Bacteria 10606
42 Ga0070698_100011852 3300005471 Bacteria 9249
43 Ga0070698_100014956 3300005471 Bacteria 8204
44 Ga0070699_100001043 3300005518 Bacteria 25801
45 Ga0070699_100002373 3300005518 Bacteria 16893
46 Ga0070699_100021971 3300005518 Bacteria 5498
47 Ga0070679_100000253 3300005530 Bacteria 44883
48 Ga0070679_100008007 3300005530 Bacteria 9924
49 Ga0070697_100000135 3300005536 Bacteria 59315
50 Ga0070697_100025601 3300005536 Unclassified 4706
51 Ga0070697_100038797 3300005536 Bacteria 3849
52 Ga0070697_100075080 3300005536 Bacteria 2778
53 Ga0070672_100023453 3300005543 Unclassified 4549
54 Ga0070686_100022363 3300005544 Unclassified 3765
55 Ga0070695_100015882 3300005545 Unclassified 4550
56 Ga0070693_100002752 3300005547 Bacteria 8092
57 Ga0070665_100084116 3300005548 Bacteria 3187
58 Ga0070664_100009988 3300005564 Bacteria 7694
59 Ga0068857_100006099 3300005577 Bacteria 10297
60 Ga0068857_100056302 3300005577 Bacteria 3489
61 Ga0070702_100009654 3300005615 Unclassified 4732
62 Ga0068852_100009711 3300005616 Bacteria 7149
63 Ga0068852_100045085 3300005616 Bacteria 3749
64 Ga0068859_100005380 3300005617 Bacteria 13019
65 Ga0068859_100009279 3300005617 Bacteria 9932
66 Ga0068859_100017673 3300005617 Bacteria 7170
67 Ga0068859_100066006 3300005617 Unclassified 3653
68 Ga0068864_100002514 3300005618 Bacteria 15153
69 Ga0068864_100040742 3300005618 Unclassified 3972
70 Ga0068861_100015233 3300005719 Bacteria 5413
71 Ga0068861_100030289 3300005719 Bacteria 3964
72 Ga0068863_100013418 3300005841 Bacteria 7900
73 Ga0068863_100027431 3300005841 Bacteria 5431
74 Ga0068858_100020163 3300005842 Bacteria 6234
75 Ga0068858_100038801 3300005842 Unclassified 4418
76 Ga0068858_100094939 3300005842 Bacteria 2778
77 Ga0068858_100114450 3300005842 Bacteria 2520
78 Ga0068860_100047765 3300005843 Unclassified 4079
79 Ga0068860_100112195 3300005843 Bacteria 2607
80 Ga0068862_100009067 3300005844 Bacteria 8238
81 Ga0068862_100010948 3300005844 Bacteria 7489
82 Ga0068862_100027800 3300005844 Bacteria 4763
83 Ga0081539_10000537 3300005985 Bacteria 78553
84 Ga0081539_10036955 3300005985 Unclassified 2915
85 Ga0070715_10000081 3300006163 Bacteria 26482
86 Ga0070716_100013732 3300006173 Unclassified 4135
87 Ga0097621_100034189 3300006237 Unclassified 4053
88 Ga0068871_100036334 3300006358 Unclassified 3922
89 Ga0075428_100002494 3300006844 Bacteria 19977
90 Ga0075428_100145171 3300006844 Bacteria 2579
91 Ga0075430_100027700 3300006846 Bacteria 4813
92 Ga0075430_100030033 3300006846 Bacteria 4615
93 Ga0075431_100003186 3300006847 Bacteria 15862
94 Ga0075431_100033464 3300006847 Bacteria 5297
95 Ga0075433_10002352 3300006852 Bacteria 14386
96 Ga0075433_10009324 3300006852 Bacteria 7848
97 Ga0075433_10030562 3300006852 Bacteria 4597
98 Ga0075434_100001672 3300006871 Bacteria 18920
99 Ga0075434_100047067 3300006871 Bacteria 4281
100 Ga0075429_100012422 3300006880 Bacteria 7389
101 Ga0068865_100009980 3300006881 Bacteria 5900
102 Ga0097620_100005380 3300006931 Bacteria 13019
103 Ga0097620_100009279 3300006931 Bacteria 9932
104 Ga0097620_100017673 3300006931 Bacteria 7170
105 Ga0097620_100066011 3300006931 Unclassified 3653
106 Ga0075435_100028519 3300007076 Bacteria 4378
107 Ga0111539_10000228 3300009094 Bacteria 67465
108 Ga0111539_10004986 3300009094 Bacteria 17271
109 Ga0111539_10034910 3300009094 Bacteria 6091
110 Ga0105247_10000944 3300009101 Bacteria 21912
111 Ga0105247_10055492 3300009101 Bacteria 2445
112 Ga0114129_10006704 3300009147 Bacteria 16354
113 Ga0114129_10009329 3300009147 Bacteria 13999
114 Ga0114129_10010021 3300009147 Bacteria 13509
115 Ga0114129_10012476 3300009147 Bacteria 12098
116 Ga0114129_10033587 3300009147 Bacteria 7249
117 Ga0114129_10058400 3300009147 Bacteria 5396
118 Ga0105243_10005615 3300009148 Bacteria 9773
119 Ga0105243_10101505 3300009148 Bacteria 2389
120 Ga0105242_10036398 3300009176 Unclassified 3948
121 Ga0105248_10006400 3300009177 Bacteria 12919
122 Ga0105248_10008081 3300009177 Bacteria 11549
123 Ga0105248_10009196 3300009177 Bacteria 10872
124 Ga0105248_10102048 3300009177 Archaea 3233
125 Ga0105237_10049323 3300009545 Bacteria 4232
126 Ga0105237_10081870 3300009545 Bacteria 3219
127 Ga0105238_10097190 3300009551 Bacteria 2931
128 Ga0105249_10000082 3300009553 Bacteria 137479
129 Ga0105249_10055801 3300009553 Bacteria 3616
130 Ga0105249_10077243 3300009553 Bacteria 3087
131 Ga0105246_10011182 3300011119 Bacteria 5564
132 Ga0105246_10019014 3300011119 Bacteria 4382
133 Ga0157373_10001858 3300013100 Bacteria 16027
134 Ga0157374_10047468 3300013296 Unclassified 3982
135 Ga0157378_10001322 3300013297 Bacteria 22280
136 Ga0157378_10008601 3300013297 Bacteria 8883
137 Ga0163162_10000002 3300013306 Bacteria 717331
138 Ga0163162_10001013 3300013306 Bacteria 26117
139 Ga0163162_10011990 3300013306 Bacteria 8453
140 Ga0163162_10040952 3300013306 Bacteria 4634
141 Ga0157372_10008458 3300013307 Bacteria 10924
142 Ga0157375_10004041 3300013308 Bacteria 12730
143 Ga0157375_10008670 3300013308 Bacteria 8909
144 Ga0157375_10042956 3300013308 Bacteria 4380
145 Ga0163163_10002089 3300014325 Bacteria 16871
146 Ga0163163_10042249 3300014325 Bacteria 4464
147 Ga0157380_10002345 3300014326 Bacteria 12725
148 Ga0157380_10011006 3300014326 Bacteria 6524
149 Ga0157380_10017133 3300014326 Bacteria 5358
150 Ga0157379_10052947 3300014968 Unclassified 3625
151 Ga0157376_10008177 3300014969 Bacteria 7527
152 Ga0163161_10015337 3300017792 Bacteria 5342
153 Ga0163161_10029578 3300017792 Unclassified 3894
154 Ga0207653_10001574 3300025885 Bacteria 7379
155 Ga0207685_10000023 3300025905 Bacteria 115280
156 Ga0207643_10000772 3300025908 Bacteria 19526
157 Ga0207643_10005629 3300025908 Bacteria 6697
158 Ga0207684_10000327 3300025910 Bacteria 67005
159 Ga0207684_10041373 3300025910 Bacteria 3908
160 Ga0207707_10000142 3300025912 Bacteria 74613
161 Ga0207707_10007357 3300025912 Bacteria 9590
162 Ga0207660_10001107 3300025917 Bacteria 18007
163 Ga0207662_10002776 3300025918 Bacteria 8852
164 Ga0207662_10029220 3300025918 Bacteria 3193
165 Ga0207652_10000361 3300025921 Bacteria 47204
166 Ga0207681_10002484 3300025923 Bacteria 11702
167 Ga0207681_10064741 3300025923 Bacteria 2525
168 Ga0207650_10000313 3300025925 Bacteria 47889
169 Ga0207650_10006386 3300025925 Bacteria 8027
170 Ga0207670_10003326 3300025936 Bacteria 8522
171 Ga0207665_10009584 3300025939 Bacteria 6360
172 Ga0207691_10000900 3300025940 Bacteria 29470
173 Ga0207711_10005593 3300025941 Bacteria 10623
174 Ga0207711_10032527 3300025941 Unclassified 4410
175 Ga0207689_10005860 3300025942 Bacteria 10891
176 Ga0207712_10000075 3300025961 Bacteria 120693
177 Ga0207712_10002045 3300025961 Bacteria 13239
178 Ga0207712_10021739 3300025961 Bacteria 4215
179 Ga0207668_10002494 3300025972 Bacteria 10746
180 Ga0207703_10035883 3300026035 Bacteria 3942
181 Ga0207708_10000149 3300026075 Bacteria 56107
182 Ga0207708_10039563 3300026075 Archaea 3593
183 Ga0207708_10043423 3300026075 Bacteria 3426
184 Ga0207648_10011405 3300026089 Bacteria 8374
185 Ga0207676_10005806 3300026095 Bacteria 8726
186 Ga0207674_10000115 3300026116 Bacteria 93114
187 Ga0207674_10011394 3300026116 Bacteria 9993
188 Ga0207675_100004070 3300026118 Bacteria 14154
189 Ga0207675_100006388 3300026118 Bacteria 11168
190 Ga0207675_100078481 3300026118 Bacteria 3093
191 Ga0207675_100089534 3300026118 Bacteria 2892
192 Ga0207698_10036118 3300026142 Bacteria 3623
193 Ga0207428_10004885 3300027907 Bacteria 12629
194 Ga0268265_10025671 3300028380 Bacteria 4186
195 Ga0268264_10025622 3300028381 Unclassified 4818
196 Ga0307513_10013668 3300031456 Bacteria 9954
197 Ga0307412_10025637 3300031911 Bacteria 3653
198 Ga0307414_10014280 3300032004 Unclassified 4756
199 Ga0373937_0045164 3300036401 Bacteria 4025
200 Ga0395901_0108712 3300038443 Unclassified 2911
201 Ga0242420_000398 3300038996 Bacteria 4831
202 Ga0495663_0000250 3300046525 Bacteria 20919
203 Ga0495598_0000043 3300046537 Bacteria 19015
204 Ga0495598_0010709 3300046537 Bacteria 2204
205 Ga0495613_0014724 3300046689 Bacteria 5805
206 Ga0496104_0067757 3300048907 Bacteria 3391
207 Ga0496106_0043924 3300048909 Unclassified 3355
208 Ga0496108_0097011 3300048911 Bacteria 2512
209 Ga0496109_0000005 3300048912 Bacteria 358226
210 Ga0501291_000993 3300049514 Bacteria 3277
211 Ga0501038_0002990 3300049574 Bacteria 15762
212 Ga0501207_003839 3300049654 Bacteria 2021
213 Ga0501216_000732 3300049660 Bacteria 4074
214 Ga0501216_001945 3300049660 Unclassified 2871
215 Ga0501216_005359 3300049660 Bacteria 1931
216 Ga0501227_000607 3300049665 Bacteria 7795
217 Ga0501227_002288 3300049665 Unclassified 4234
218 Ga0501235_002175 3300049669 Bacteria 4208
219 Ga0501247_003492 3300049677 Bacteria 1685
220 Ga0501225_0002994 3300049705 Bacteria 5158
221 Ga0501283_000742 3300049779 Bacteria 4272
222 Ga0501226_001358 3300049853 Unclassified 3163
223 nmdc:mga05p37_35989_c1 3300050507 Bacteria 6074
224 nmdc:mga06r32_4789_c1 3300050510 Bacteria 12177
225 nmdc:mga08y16_20377_c1 3300050511 Bacteria 6999
226 nmdc:mga0n895_35324_c1 3300050512 Unclassified 4818
227 nmdc:mga0rr50_2949_c1 3300050513 Bacteria 9730
228 nmdc:mga0rr50_47940_c1 3300050513 Bacteria 3155
229 nmdc:mga0a205_330_c1 3300050515 Bacteria 35421
230 nmdc:mga0a205_37996_c1 3300050515 Bacteria 4631
231 nmdc:mga0a205_48637_c1 3300050515 Bacteria 4093
232 nmdc:mga0a205_70837_c1 3300050515 Unclassified 3367
233 Ga0501084_0138090 3300054114 Bacteria 2052
234 Ga0530510_0036321 3300061734 Unclassified 3552

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049660 Ga0501216_005359 Ga0501216_005359_305_1897 516
2 3300049677 Ga0501247_003492 Ga0501247_003492_18_1610 516
3 3300046537 Ga0495598_0010709 Ga0495598_0010709_70_2121 520
4 3300006844 Ga0075428_100145171 Ga0075428_1001451712 524
5 3300009553 Ga0105249_10000082 Ga0105249_1000008236 526
6 3300013306 Ga0163162_10000002 Ga0163162_10000002521 526
7 3300049654 Ga0501207_003839 Ga0501207_003839_18_1604 527
8 3300025961 Ga0207712_10000075 Ga0207712_1000007570 532
9 3300006871 Ga0075434_100047067 Ga0075434_1000470672 536
10 3300050512 nmdc:mga0n895_35324_c1 nmdc:mga0n895_35324_c1_1269_3467 536
11 3300006163 Ga0070715_10000081 Ga0070715_1000008111 537
12 3300025905 Ga0207685_10000023 Ga0207685_10000023109 537
13 3300046689 Ga0495613_0014724 Ga0495613_0014724_2137_4398 540
14 3300025972 Ga0207668_10002494 Ga0207668_100024947 543
15 3300036401 Ga0373937_0045164 Ga0373937_0045164_306_2567 543
16 3300054114 Ga0501084_0138090 Ga0501084_0138090_66_1802 545
17 3300048912 Ga0496109_0000005 Ga0496109_0000005_117222_119426 553
18 3300061734 Ga0530510_0036321 Ga0530510_0036321_20_2068 557
19 3300005295 Ga0065707_10002183 Ga0065707_100021832 562
20 3300009147 Ga0114129_10009329 Ga0114129_100093295 563
21 3300038996 Ga0242420_000398 Ga0242420_000398_2712_4751 563
22 3300005471 Ga0070698_100011852 Ga0070698_1000118524 564
23 3300005518 Ga0070699_100021971 Ga0070699_1000219713 566
24 3300049665 Ga0501227_002288 Ga0501227_002288_693_2792 566
25 3300031456 Ga0307513_10013668 Ga0307513_100136681 569
26 3300005536 Ga0070697_100000135 Ga0070697_10000013513 570
27 3300006844 Ga0075428_100002494 Ga0075428_10000249414 572
28 3300006847 Ga0075431_100003186 Ga0075431_10000318611 572
29 3300009094 Ga0111539_10034910 Ga0111539_100349104 572
30 3300027907 Ga0207428_10004885 Ga0207428_100048852 572
31 3300028380 Ga0268265_10025671 Ga0268265_100256712 572
32 3300050510 nmdc:mga06r32_4789_c1 nmdc:mga06r32_4789_c1_4945_7194 572
33 3300050511 nmdc:mga08y16_20377_c1 nmdc:mga08y16_20377_c1_3856_6105 572
34 3300005445 Ga0070708_100000281 Ga0070708_10000028117 576
35 3300005467 Ga0070706_100001677 Ga0070706_10000167718 576
36 3300005468 Ga0070707_100028948 Ga0070707_1000289483 576
37 3300005518 Ga0070699_100002373 Ga0070699_10000237314 576
38 3300005536 Ga0070697_100025601 Ga0070697_1000256014 576
39 3300006852 Ga0075433_10002352 Ga0075433_1000235212 576
40 3300006871 Ga0075434_100001672 Ga0075434_1000016724 576
41 3300050515 nmdc:mga0a205_330_c1 nmdc:mga0a205_330_c1_8946_11204 576
42 3300005331 Ga0070670_100000951 Ga0070670_10000095125 577
43 3300025923 Ga0207681_10002484 Ga0207681_100024847 577
44 3300025925 Ga0207650_10006386 Ga0207650_100063866 577
45 3300005471 Ga0070698_100009193 Ga0070698_10000919310 583
46 3300005536 Ga0070697_100038797 Ga0070697_1000387973 583
47 3300005337 Ga0070682_100047810 Ga0070682_1000478102 584
48 3300005406 Ga0070703_10001260 Ga0070703_100012606 584
49 3300005440 Ga0070705_100007861 Ga0070705_1000078615 584
50 3300005547 Ga0070693_100002752 Ga0070693_1000027524 584
51 3300005616 Ga0068852_100009711 Ga0068852_1000097111 584
52 3300005617 Ga0068859_100005380 Ga0068859_1000053805 584
53 3300005842 Ga0068858_100094939 Ga0068858_1000949392 584
54 3300006931 Ga0097620_100005380 Ga0097620_1000053805 584
55 3300009545 Ga0105237_10081870 Ga0105237_100818702 584
56 3300025885 Ga0207653_10001574 Ga0207653_100015746 584
57 3300005293 Ga0065715_10089590 Ga0065715_100895905 586
58 3300005458 Ga0070681_10008122 Ga0070681_100081228 586
59 3300005543 Ga0070672_100023453 Ga0070672_1000234531 586
60 3300005545 Ga0070695_100015882 Ga0070695_1000158823 586
61 3300009545 Ga0105237_10049323 Ga0105237_100493233 586
62 3300025912 Ga0207707_10007357 Ga0207707_100073578 586
63 3300049660 Ga0501216_001945 Ga0501216_001945_271_2484 587
64 3300049665 Ga0501227_000607 Ga0501227_000607_3870_6083 587
65 3300009147 Ga0114129_10012476 Ga0114129_100124767 588
66 3300050507 nmdc:mga05p37_35989_c1 nmdc:mga05p37_35989_c1_1685_3883 588
67 3300005518 Ga0070699_100001043 Ga0070699_10000104320 589
68 3300006852 Ga0075433_10030562 Ga0075433_100305623 589
69 3300014326 Ga0157380_10002345 Ga0157380_100023452 589
70 3300050515 nmdc:mga0a205_37996_c1 nmdc:mga0a205_37996_c1_1629_3833 589
71 3300050515 nmdc:mga0a205_48637_c1 nmdc:mga0a205_48637_c1_306_2516 589
72 3300005330 Ga0070690_100009424 Ga0070690_1000094242 590
73 3300005844 Ga0068862_100027800 Ga0068862_1000278002 590
74 3300009101 Ga0105247_10055492 Ga0105247_100554922 590
75 3300009551 Ga0105238_10097190 Ga0105238_100971902 590
76 3300009553 Ga0105249_10077243 Ga0105249_100772432 590
77 3300013308 Ga0157375_10008670 Ga0157375_100086702 590
78 3300005353 Ga0070669_100010180 Ga0070669_1000101806 591
79 3300005617 Ga0068859_100017673 Ga0068859_1000176734 591
80 3300005844 Ga0068862_100009067 Ga0068862_1000090674 591
81 3300006931 Ga0097620_100017673 Ga0097620_1000176734 591
82 3300014326 Ga0157380_10017133 Ga0157380_100171334 591
83 3300025923 Ga0207681_10064741 Ga0207681_100647412 591
84 3300026075 Ga0207708_10043423 Ga0207708_100434232 591
85 3300007076 Ga0075435_100028519 Ga0075435_1000285191 593
86 3300050513 nmdc:mga0rr50_2949_c1 nmdc:mga0rr50_2949_c1_3299_5503 593
87 3300005467 Ga0070706_100053356 Ga0070706_1000533562 594
88 3300006173 Ga0070716_100013732 Ga0070716_1000137322 594
89 3300025910 Ga0207684_10041373 Ga0207684_100413732 594
90 3300025939 Ga0207665_10009584 Ga0207665_100095843 594
91 3300048911 Ga0496108_0097011 Ga0496108_0097011_298_2460 594
92 3300005616 Ga0068852_100045085 Ga0068852_1000450852 595
93 3300005985 Ga0081539_10036955 Ga0081539_100369551 595
94 3300009177 Ga0105248_10008081 Ga0105248_100080812 595
95 3300013297 Ga0157378_10001322 Ga0157378_1000132218 595
96 3300013306 Ga0163162_10001013 Ga0163162_1000101314 595
97 3300013306 Ga0163162_10040952 Ga0163162_100409522 595
98 3300013308 Ga0157375_10004041 Ga0157375_100040416 595
99 3300017792 Ga0163161_10015337 Ga0163161_100153373 595
100 3300025918 Ga0207662_10029220 Ga0207662_100292202 595
101 3300026118 Ga0207675_100089534 Ga0207675_1000895342 595
102 3300026142 Ga0207698_10036118 Ga0207698_100361182 595
103 3300005288 Ga0065714_10064424 Ga0065714_10064424100 596
104 3300005290 Ga0065712_10000117 Ga0065712_10000117100 596
105 3300006846 Ga0075430_100027700 Ga0075430_1000277004 596
106 3300006847 Ga0075431_100033464 Ga0075431_1000334645 596
107 3300006880 Ga0075429_100012422 Ga0075429_1000124223 596
108 3300009147 Ga0114129_10058400 Ga0114129_100584004 596
109 3300009177 Ga0105248_10006400 Ga0105248_100064004 596
110 3300025941 Ga0207711_10005593 Ga0207711_100055935 596
111 3300005441 Ga0070700_100000087 Ga0070700_10000008748 597
112 3300026075 Ga0207708_10000149 Ga0207708_1000014940 597
113 3300005290 Ga0065712_10004776 Ga0065712_100047762 598
114 3300005330 Ga0070690_100010333 Ga0070690_1000103333 598
115 3300005335 Ga0070666_10017513 Ga0070666_100175133 598
116 3300005340 Ga0070689_100027160 Ga0070689_1000271603 598
117 3300005364 Ga0070673_100034940 Ga0070673_1000349402 598
118 3300005365 Ga0070688_100013296 Ga0070688_1000132964 598
119 3300005441 Ga0070700_100029667 Ga0070700_1000296672 598
120 3300005459 Ga0068867_100038806 Ga0068867_1000388062 598
121 3300005466 Ga0070685_10008831 Ga0070685_100088314 598
122 3300005544 Ga0070686_100022363 Ga0070686_1000223633 598
123 3300005615 Ga0070702_100009654 Ga0070702_1000096542 598
124 3300005841 Ga0068863_100013418 Ga0068863_1000134184 598
125 3300005842 Ga0068858_100038801 Ga0068858_1000388013 598
126 3300005843 Ga0068860_100047765 Ga0068860_1000477652 598
127 3300005844 Ga0068862_100010948 Ga0068862_1000109485 598
128 3300006237 Ga0097621_100034189 Ga0097621_1000341892 598
129 3300006358 Ga0068871_100036334 Ga0068871_1000363342 598
130 3300006881 Ga0068865_100009980 Ga0068865_1000099803 598
131 3300009148 Ga0105243_10005615 Ga0105243_100056157 598
132 3300009176 Ga0105242_10036398 Ga0105242_100363984 598
133 3300009177 Ga0105248_10102048 Ga0105248_101020483 598
134 3300011119 Ga0105246_10011182 Ga0105246_100111823 598
135 3300013296 Ga0157374_10047468 Ga0157374_100474682 598
136 3300013297 Ga0157378_10008601 Ga0157378_100086012 598
137 3300014968 Ga0157379_10052947 Ga0157379_100529472 598
138 3300014969 Ga0157376_10008177 Ga0157376_100081777 598
139 3300017792 Ga0163161_10029578 Ga0163161_100295783 598
140 3300025908 Ga0207643_10005629 Ga0207643_100056296 598
141 3300025918 Ga0207662_10002776 Ga0207662_100027766 598
142 3300025940 Ga0207691_10000900 Ga0207691_100009008 598
143 3300025941 Ga0207711_10032527 Ga0207711_100325272 598
144 3300025942 Ga0207689_10005860 Ga0207689_100058606 598
145 3300026075 Ga0207708_10039563 Ga0207708_100395632 598
146 3300026089 Ga0207648_10011405 Ga0207648_100114055 598
147 3300026118 Ga0207675_100006388 Ga0207675_1000063888 598
148 3300050515 nmdc:mga0a205_70837_c1 nmdc:mga0a205_70837_c1_488_2686 598
149 3300005843 Ga0068860_100112195 Ga0068860_1001121951 601
150 3300049660 Ga0501216_000732 Ga0501216_000732_1032_3233 603
151 3300005337 Ga0070682_100000548 Ga0070682_10000054813 604
152 3300013307 Ga0157372_10008458 Ga0157372_100084585 604
153 3300046525 Ga0495663_0000250 Ga0495663_0000250_16313_18532 604
154 3300046537 Ga0495598_0000043 Ga0495598_0000043_3862_6084 604
155 3300005336 Ga0070680_100001177 Ga0070680_1000011773 605
156 3300005458 Ga0070681_10001035 Ga0070681_1000103518 605
157 3300005530 Ga0070679_100000253 Ga0070679_10000025333 605
158 3300005617 Ga0068859_100009279 Ga0068859_1000092797 605
159 3300006931 Ga0097620_100009279 Ga0097620_1000092797 605
160 3300013308 Ga0157375_10042956 Ga0157375_100429563 605
161 3300014325 Ga0163163_10042249 Ga0163163_100422493 605
162 3300025912 Ga0207707_10000142 Ga0207707_1000014222 605
163 3300025917 Ga0207660_10001107 Ga0207660_100011073 605
164 3300025921 Ga0207652_10000361 Ga0207652_1000036123 605
165 3300038443 Ga0395901_0108712 Ga0395901_0108712_17_2263 605
166 3300049853 Ga0501226_001358 Ga0501226_001358_150_2363 605
167 3300050513 nmdc:mga0rr50_47940_c1 nmdc:mga0rr50_47940_c1_499_2709 605
168 3300025908 Ga0207643_10000772 Ga0207643_100007729 606
169 3300048907 Ga0496104_0067757 Ga0496104_0067757_114_2324 606
170 3300005536 Ga0070697_100075080 Ga0070697_1000750801 607
171 3300005548 Ga0070665_100084116 Ga0070665_1000841162 607
172 3300005618 Ga0068864_100002514 Ga0068864_1000025143 607
173 3300005842 Ga0068858_100020163 Ga0068858_1000201634 607
174 3300014326 Ga0157380_10011006 Ga0157380_100110065 607
175 3300026035 Ga0207703_10035883 Ga0207703_100358832 607
176 3300026095 Ga0207676_10005806 Ga0207676_100058062 607
177 3300005445 Ga0070708_100012045 Ga0070708_1000120454 608
178 3300005577 Ga0068857_100056302 Ga0068857_1000563021 608
179 3300032004 Ga0307414_10014280 Ga0307414_100142804 608
180 3300005336 Ga0070680_100069402 Ga0070680_1000694021 610
181 3300006852 Ga0075433_10009324 Ga0075433_100093244 614
182 3300009147 Ga0114129_10006704 Ga0114129_100067045 614
183 3300049514 Ga0501291_000993 Ga0501291_000993_273_2495 614
184 3300049779 Ga0501283_000742 Ga0501283_000742_995_3217 614
185 3300005366 Ga0070659_100027884 Ga0070659_1000278843 615
186 3300005458 Ga0070681_10046626 Ga0070681_100466263 615
187 3300005530 Ga0070679_100008007 Ga0070679_1000080072 615
188 3300005719 Ga0068861_100015233 Ga0068861_1000152334 615
189 3300009147 Ga0114129_10033587 Ga0114129_100335875 615
190 3300009148 Ga0105243_10101505 Ga0105243_101015051 615
191 3300026118 Ga0207675_100078481 Ga0207675_1000784812 615
192 3300005842 Ga0068858_100114450 Ga0068858_1001144501 616
193 3300013306 Ga0163162_10011990 Ga0163162_100119908 616
194 3300005564 Ga0070664_100009988 Ga0070664_1000099885 617
195 3300005577 Ga0068857_100006099 Ga0068857_1000060997 617
196 3300026116 Ga0207674_10000115 Ga0207674_1000011532 617
197 3300005467 Ga0070706_100000146 Ga0070706_10000014672 619
198 3300009177 Ga0105248_10009196 Ga0105248_100091966 619
199 3300025910 Ga0207684_10000327 Ga0207684_1000032754 619
200 3300048909 Ga0496106_0043924 Ga0496106_0043924_1121_3328 619
201 3300049574 Ga0501038_0002990 Ga0501038_0002990_9930_12152 619
202 3300005985 Ga0081539_10000537 Ga0081539_1000053722 620
203 3300025961 Ga0207712_10021739 Ga0207712_100217392 621
204 3300031911 Ga0307412_10025637 Ga0307412_100256372 621
205 3300049669 Ga0501235_002175 Ga0501235_002175_1714_3930 621
206 3300049705 Ga0501225_0002994 Ga0501225_0002994_402_2618 621
207 3300006846 Ga0075430_100030033 Ga0075430_1000300332 622
208 3300009147 Ga0114129_10010021 Ga0114129_100100218 622
209 3300026116 Ga0207674_10011394 Ga0207674_100113945 623
210 3300009094 Ga0111539_10004986 Ga0111539_100049868 624
211 3300009553 Ga0105249_10055801 Ga0105249_100558011 624
212 3300011119 Ga0105246_10019014 Ga0105246_100190142 624
213 3300013100 Ga0157373_10001858 Ga0157373_1000185815 624
214 3300025961 Ga0207712_10002045 Ga0207712_100020455 624
215 3300005295 Ga0065707_10001764 Ga0065707_100017643 625
216 3300005340 Ga0070689_100000425 Ga0070689_10000042523 625
217 3300005441 Ga0070700_100002603 Ga0070700_1000026037 625
218 3300005471 Ga0070698_100014956 Ga0070698_1000149562 625
219 3300005617 Ga0068859_100066006 Ga0068859_1000660063 625
220 3300005618 Ga0068864_100040742 Ga0068864_1000407422 625
221 3300005841 Ga0068863_100027431 Ga0068863_1000274313 625
222 3300006931 Ga0097620_100066011 Ga0097620_1000660113 625
223 3300009094 Ga0111539_10000228 Ga0111539_1000022813 625
224 3300025936 Ga0207670_10003326 Ga0207670_100033269 625
225 3300028381 Ga0268264_10025622 Ga0268264_100256222 625
226 3300005719 Ga0068861_100030289 Ga0068861_1000302893 626
227 3300026118 Ga0207675_100004070 Ga0207675_1000040703 626
228 3300005290 Ga0065712_10072735 Ga0065712_100727353 628
229 3300005293 Ga0065715_10091714 Ga0065715_100917142 628
230 3300009101 Ga0105247_10000944 Ga0105247_1000094415 628
231 3300002459 JGI24751J29686_10000099 JGI24751J29686_1000009923 629
232 3300005331 Ga0070670_100000297 Ga0070670_10000029725 629
233 3300014325 Ga0163163_10002089 Ga0163163_100020893 629
234 3300025925 Ga0207650_10000313 Ga0207650_1000031323 629

Structural Annotation

Top 5 Hits

ID Description Score Start End
6aem-assembly2.cif.gz_B crystal structure of the pkd1 domain of vibrio anguillarum epp 0.8719 536 628
4l9d-assembly2.cif.gz_B crystal structure of the pkd1 domain from vibrio cholerae metalloprotease prtv 0.8626 536 628
4l9d-assembly2.cif.gz_B crystal structure of the pkd1 domain from vibrio cholerae metalloprotease prtv 0.8242 536 628
6aem-assembly2.cif.gz_B crystal structure of the pkd1 domain of vibrio anguillarum epp 0.807 536 628
8oty-assembly1.cif.gz_A crystal structure of the titin domain fn3-90 0.7713 451 533
ID Description Score Start End Superfamily
6aemA00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8696 536 628 2.60.40.10
af_Q8WZ42_26414_26508_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8237 451 534 2.60.40.10
af_Q8WZ42_15406_15507_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8236 451 533 2.60.40.10
af_Q8WZ42_18928_19021_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.811 451 531 2.60.40.10
6aemA00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.805 536 628 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7Y8LZX1-F1-model_v4 Bacterial Ig-like domain-containing protein 0.9853 554 629
AF-A0A2E8HLV7-F1-model_v4 Penicillin-binding C-terminal domain-containing protein 0.9608 555 629
AF-A0A2V9M2W5-F1-model_v4 Bacterial Ig-like domain-containing protein 0.9588 534 628
AF-A0A838RZV9-F1-model_v4 Uncharacterized protein 0.9566 463 629
AF-A0A3C0CV30-F1-model_v4 Uncharacterized protein 0.9523 556 629

Feature Viewer

pLDDT pTM Quality
80.57 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map