F347067

General Info

Members Datasets Scaffolds Average Seq Length
234 166 468 252

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10464274|Ga0105249_104642741
Length 282
Sequence LKFILSLGAPTGAIHFAEYSAFVTLGPTMKTFENKTVLITGGTSGIGKAAALAFAKEGANVVVSGRRVAEGEEVSRGITSAGGSALFVRGDVSREDDIVALVEETVRAFGALHIAFNNAGIEGTFGLLTTEQTVEHYDQVCDINIRGVLLSMKHEIPAMLRSGGGAIVNNSSIGGHIGFNGSSVYVASKFAVIGLTKTAALEFAKQGVRVNSVSPGTVQTEMFDRAFGEGETDVKKTLATENPAGRIGTPEEIASAVLWLSSAGAAFTTGQDIIADGGYTAR

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
120 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
121 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
155 2547132374 Acidovorax radicis N35 Isolate Unclassified
156 2643221559 Lysobacter sp. Root559 Isolate Unclassified
157 2643221573 Lysobacter sp. Root604 Isolate Unclassified
158 2643221586 Lysobacter sp. Root667 Isolate Unclassified
159 2643221612 Lysobacter sp. Root76 Isolate Unclassified
160 2643221717 Acidovorax sp. Root267 Isolate Unclassified
161 2643221720 Lysobacter sp. Root916 Isolate Unclassified
162 2643221727 Lysobacter sp. Root96 Isolate Unclassified
163 2643221728 Lysobacter sp. Root983 Isolate Unclassified
164 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
165 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
166 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.59
Metatranscriptomes 1.28
Isolates 5.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0.43
Rhizoplane 4.27
Rhizosphere 87.18
Stem 0
Stem Tuber 0
Unclassified 4.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10464274 3300009553 Bacteria 1306
2 rootH2_10051126 3300003320 Bacteria 7359
3 JGI25405J52794_10002118 3300003911 Unclassified 3377
4 Ga0065704_10046246 3300005289 Bacteria 893
5 Ga0065704_10257494 3300005289 Unclassified 973
6 Ga0065712_10208025 3300005290 Bacteria 1079
7 Ga0065715_10029539 3300005293 Bacteria 1447
8 Ga0065707_10144315 3300005295 Bacteria 1732
9 Ga0065707_10154006 3300005295 Unclassified 1627
10 Ga0065707_10196636 3300005295 Bacteria 1332
11 Ga0070658_10004708 3300005327 Bacteria 11091
12 Ga0070666_10080777 3300005335 Bacteria 2222
13 Ga0070660_100022119 3300005339 Bacteria 4698
14 Ga0070689_100045873 3300005340 Bacteria 3367
15 Ga0070689_100249903 3300005340 Bacteria 1463
16 Ga0070687_100136626 3300005343 Bacteria 1422
17 Ga0070661_100006641 3300005344 Bacteria 7980
18 Ga0070692_10056564 3300005345 Bacteria 2054
19 Ga0070674_100383724 3300005356 Bacteria 1144
20 Ga0070709_10311904 3300005434 Unclassified 1152
21 Ga0070714_100156252 3300005435 Bacteria 2059
22 Ga0070713_100333887 3300005436 Bacteria 1403
23 Ga0070711_100279746 3300005439 Bacteria 1320
24 Ga0070705_100357119 3300005440 Bacteria 1067
25 Ga0070694_100239542 3300005444 Bacteria 1368
26 Ga0070708_100131300 3300005445 Bacteria 2318
27 Ga0070681_10031549 3300005458 Bacteria 5320
28 Ga0070706_100112509 3300005467 Bacteria 2534
29 Ga0070706_100378986 3300005467 Bacteria 1317
30 Ga0070706_100411771 3300005467 Bacteria 1258
31 Ga0070707_100432847 3300005468 Bacteria 1276
32 Ga0070707_100454321 3300005468 Bacteria 1242
33 Ga0070698_100280839 3300005471 Bacteria 1596
34 Ga0070699_100007604 3300005518 Bacteria 9420
35 Ga0070699_100125566 3300005518 Bacteria 2259
36 Ga0070699_100303129 3300005518 Bacteria 1433
37 Ga0070679_100005031 3300005530 Bacteria 12200
38 Ga0070679_100039072 3300005530 Bacteria 4717
39 Ga0070697_100104818 3300005536 Bacteria 2352
40 Ga0070697_100387239 3300005536 Unclassified 1212
41 Ga0070697_100539150 3300005536 Bacteria 1022
42 Ga0070672_100589235 3300005543 Bacteria 968
43 Ga0070686_100033745 3300005544 Bacteria 3147
44 Ga0070704_100032269 3300005549 Bacteria 3531
45 Ga0070704_100083871 3300005549 Bacteria 2354
46 Ga0070704_100206829 3300005549 Bacteria 1588
47 Ga0070704_100832875 3300005549 Bacteria 826
48 Ga0068855_100017844 3300005563 Bacteria 8529
49 Ga0068855_100339496 3300005563 Bacteria 1657
50 Ga0068855_100803853 3300005563 Bacteria 999
51 Ga0068857_100057615 3300005577 Bacteria 3448
52 Ga0068856_100237615 3300005614 Bacteria 1837
53 Ga0068856_100806055 3300005614 Bacteria 959
54 Ga0068861_100641666 3300005719 Bacteria 980
55 Ga0068860_100408088 3300005843 Bacteria 1345
56 Ga0068860_100548826 3300005843 Bacteria 1158
57 Ga0081455_10000612 3300005937 Bacteria 46251
58 Ga0081538_10140554 3300005981 Bacteria 1114
59 Ga0081538_10175019 3300005981 Bacteria 929
60 Ga0070717_10033129 3300006028 Bacteria 4167
61 Ga0075432_10082903 3300006058 Bacteria 1165
62 Ga0070712_100083006 3300006175 Bacteria 2325
63 Ga0070712_100086455 3300006175 Unclassified 2285
64 Ga0070712_100350302 3300006175 Bacteria 1208
65 Ga0075366_10043872 3300006195 Bacteria 2650
66 Ga0075428_100051903 3300006844 Bacteria 4497
67 Ga0075428_100311162 3300006844 Bacteria 1693
68 Ga0075428_101101262 3300006844 Bacteria 839
69 Ga0075430_100053596 3300006846 Unclassified 3396
70 Ga0075431_100466000 3300006847 Bacteria 1258
71 Ga0075433_10080801 3300006852 Bacteria 2866
72 Ga0075434_100183904 3300006871 Bacteria 2110
73 Ga0075429_100072444 3300006880 Bacteria 3000
74 Ga0068865_100127362 3300006881 Bacteria 1903
75 Ga0075436_100254348 3300006914 Bacteria 1252
76 Ga0075435_100115016 3300007076 Bacteria 2240
77 Ga0075435_100283207 3300007076 Bacteria 1415
78 Ga0075435_100294929 3300007076 Bacteria 1386
79 Ga0075435_100323153 3300007076 Bacteria 1321
80 Ga0075435_100419996 3300007076 Bacteria 1152
81 Ga0099794_10026830 3300007265 Bacteria 2666
82 Ga0099794_10033135 3300007265 Bacteria 2428
83 Ga0105240_10002757 3300009093 Bacteria 27754
84 Ga0105240_10014677 3300009093 Bacteria 10690
85 Ga0105240_10349459 3300009093 Bacteria 1678
86 Ga0111539_10075150 3300009094 Bacteria 3981
87 Ga0114129_10089228 3300009147 Bacteria 4274
88 Ga0114129_10123065 3300009147 Bacteria 3568
89 Ga0114129_10137886 3300009147 Bacteria 3346
90 Ga0105237_10717306 3300009545 Bacteria 1006
91 Ga0105238_10120735 3300009551 Bacteria 2600
92 Ga0105249_10017651 3300009553 Bacteria 6337
93 Ga0105249_10299875 3300009553 Bacteria 1611
94 Ga0157370_10000772 3300013104 Bacteria 40083
95 Ga0157374_10205049 3300013296 Bacteria 1932
96 Ga0157378_10031162 3300013297 Bacteria 4710
97 Ga0157378_10933110 3300013297 Unclassified 900
98 Ga0163162_10103478 3300013306 Bacteria 2942
99 Ga0163162_10486002 3300013306 Bacteria 1366
100 Ga0157372_10103826 3300013307 Bacteria 3248
101 Ga0157372_10164546 3300013307 Bacteria 2565
102 Ga0157372_10351105 3300013307 Bacteria 1718
103 Ga0157379_10171051 3300014968 Bacteria 1961
104 Ga0163161_10111670 3300017792 Bacteria 2044
105 Ga0206351_10697531 3300020077 Unclassified 928
106 Ga0206354_11593030 3300020081 Bacteria 5243
107 Ga0206353_10355933 3300020082 Bacteria 1684
108 Ga0213873_10054857 3300021358 Bacteria 1065
109 Ga0213872_10051628 3300021361 Bacteria 1866
110 Ga0213874_10007244 3300021377 Bacteria 2655
111 Ga0213874_10040049 3300021377 Bacteria 1398
112 Ga0213871_10009685 3300021441 Bacteria 2165
113 Ga0207653_10062817 3300025885 Bacteria 1256
114 Ga0207685_10143050 3300025905 Bacteria 1074
115 Ga0207684_10011751 3300025910 Bacteria 7637
116 Ga0207684_10579402 3300025910 Bacteria 959
117 Ga0207707_10343340 3300025912 Bacteria 1287
118 Ga0207707_10556758 3300025912 Bacteria 974
119 Ga0207695_10007066 3300025913 Bacteria 14399
120 Ga0207693_10034137 3300025915 Unclassified 4013
121 Ga0207693_10136105 3300025915 Unclassified 1931
122 Ga0207693_10157806 3300025915 Bacteria 1785
123 Ga0207663_10200952 3300025916 Bacteria 1438
124 Ga0207657_10020104 3300025919 Bacteria 6320
125 Ga0207649_10156156 3300025920 Bacteria 1576
126 Ga0207652_10020910 3300025921 Bacteria 5395
127 Ga0207652_10063311 3300025921 Bacteria 3198
128 Ga0207646_10231781 3300025922 Bacteria 1668
129 Ga0207646_10388694 3300025922 Bacteria 1260
130 Ga0207646_10790946 3300025922 Bacteria 845
131 Ga0207681_10140171 3300025923 Bacteria 1800
132 Ga0207687_10208406 3300025927 Bacteria 1532
133 Ga0207664_10067724 3300025929 Bacteria 2866
134 Ga0207664_10325315 3300025929 Bacteria 1357
135 Ga0207686_10015088 3300025934 Bacteria 4314
136 Ga0207670_10183387 3300025936 Bacteria 1578
137 Ga0207669_10149778 3300025937 Bacteria 1633
138 Ga0207704_10159100 3300025938 Bacteria 1605
139 Ga0207665_10178714 3300025939 Bacteria 1536
140 Ga0207665_10211596 3300025939 Bacteria 1417
141 Ga0207665_10302799 3300025939 Bacteria 1195
142 Ga0207691_10562011 3300025940 Bacteria 967
143 Ga0207661_10002989 3300025944 Bacteria 11694
144 Ga0207667_10270980 3300025949 Bacteria 1735
145 Ga0207667_10429002 3300025949 Bacteria 1345
146 Ga0207712_10071341 3300025961 Bacteria 2498
147 Ga0207668_10279818 3300025972 Bacteria 1368
148 Ga0207641_10284772 3300026088 Bacteria 1556
149 Ga0207674_10071481 3300026116 Bacteria 3486
150 Ga0207675_100256324 3300026118 Bacteria 1694
151 Ga0207675_100426278 3300026118 Bacteria 1311
152 Ga0209973_1001520 3300027252 Bacteria 2039
153 Ga0209983_1003767 3300027665 Bacteria 3215
154 Ga0209588_1022083 3300027671 Bacteria 2002
155 Ga0209974_10003712 3300027876 Bacteria 5483
156 Ga0207428_10117359 3300027907 Bacteria 2043
157 Ga0268264_10268459 3300028381 Bacteria 1593
158 Ga0265336_10030972 3300028666 Bacteria 1664
159 Ga0265316_10188383 3300031344 Bacteria 1534
160 Ga0307408_100000282 3300031548 Bacteria 50919
161 Ga0307406_10000467 3300031901 Bacteria 23358
162 Ga0373931_0224279 3300035691 Bacteria 1133
163 Ga0373937_0106937 3300036401 Bacteria 2601
164 Ga0395899_0020988 3300037312 Bacteria 4953
165 Ga0395898_0131002 3300037466 Bacteria 2402
166 Ga0395905_0388019 3300037471 Bacteria 1291
167 Ga0395901_0213903 3300038443 Bacteria 2016
168 Ga0395901_1240570 3300038443 Bacteria 710
169 Ga0436365_0239133 3300039437 Bacteria 2427
170 Ga0436363_0292523 3300039450 Bacteria 1592
171 Ga0436363_0552713 3300039450 Bacteria 6756
172 Ga0436362_1172736 3300039453 Bacteria 1005
173 Ga0439439_0004337 3300041406 Bacteria 3189
174 Ga0439445_0042249 3300042004 Bacteria 1214
175 Ga0450923_023316 3300042125 Bacteria 1220
176 Ga0466972_0121587 3300044658 Bacteria 1231
177 Ga0453683_0000255 3300044673 Bacteria 70114
178 Ga0466965_0035914 3300044683 Bacteria 2429
179 Ga0466968_0096826 3300044735 Bacteria 1314
180 Ga0495635_0042690 3300046663 Bacteria 3131
181 Ga0495599_0175667 3300046678 Bacteria 1321
182 Ga0495669_0244222 3300046684 Bacteria 862
183 Ga0495624_0050048 3300046690 Bacteria 2648
184 Ga0495581_0012561 3300047315 Bacteria 4907
185 Ga0495636_0099479 3300047318 Bacteria 1270
186 Ga0495674_0015428 3300047319 Bacteria 7141
187 Ga0495684_0002934 3300047471 Bacteria 13433
188 Ga0496100_0174756 3300048903 Bacteria 1550
189 Ga0496102_0059614 3300048905 Bacteria 3490
190 Ga0496103_0012422 3300048906 Bacteria 5050
191 Ga0496104_0062373 3300048907 Bacteria 3534
192 Ga0496107_0279179 3300048910 Bacteria 1243
193 Ga0496108_0019247 3300048911 Bacteria 5604
194 Ga0496109_0013128 3300048912 Bacteria 7167
195 Ga0496110_0010272 3300048913 Bacteria 7608
196 Ga0496111_0016337 3300048914 Bacteria 5113
197 Ga0496112_0167345 3300048915 Bacteria 2164
198 Ga0496126_0095655 3300048929 Bacteria 2605
199 Ga0501075_0279257 3300049591 Bacteria 1273
200 nmdc:mga0k408_35474_c1 3300050493 Bacteria 2860
201 nmdc:mga05p37_163997_c1 3300050507 Bacteria 2713
202 nmdc:mga05p37_197901_c1 3300050507 Bacteria 2436
203 nmdc:mga05p37_36725_c1 3300050507 Bacteria 6009
204 nmdc:mga05p37_430160_c1 3300050507 Bacteria 1534
205 nmdc:mga05p37_456479_c1 3300050507 Bacteria 1478
206 nmdc:mga05p37_672072_c1 3300050507 Bacteria 1156
207 nmdc:mga09592_247438_c1 3300050508 Bacteria 1545
208 nmdc:mga09592_258949_c1 3300050508 Bacteria 1508
209 nmdc:mga09592_48679_c1 3300050508 Bacteria 3573
210 nmdc:mga06r32_38127_c1 3300050510 Bacteria 4550
211 nmdc:mga08y16_81842_c1 3300050511 Bacteria 3366
212 nmdc:mga0n895_300314_c1 3300050512 Bacteria 1628
213 nmdc:mga0n895_450599_c1 3300050512 Bacteria 1299
214 nmdc:mga0n895_717450_c1 3300050512 Bacteria 995
215 nmdc:mga0rr50_312785_c1 3300050513 Bacteria 1316
216 nmdc:mga0rr50_429869_c1 3300050513 Bacteria 1118
217 nmdc:mga0rr50_505767_c1 3300050513 Bacteria 1027
218 nmdc:mga0rr50_542851_c1 3300050513 Bacteria 990
219 nmdc:mga0a205_381300_c1 3300050515 Bacteria 1275
220 nmdc:mga0a205_772875_c1 3300050515 Bacteria 809
221 nmdc:mga0a205_81986_c1 3300050515 Bacteria 3116
222 Ga0500645_014176 3300053730 Bacteria 2544
223 2548497111 2547132374 Bacteria 5530232
224 2643817395 2643221559 Bacteria 4424915
225 2643880027 2643221573 Bacteria 4784121
226 2643938105 2643221586 Bacteria 4446529
227 2644078422 2643221612 Bacteria 4361984
228 2644647434 2643221717 Bacteria 5676132
229 2644662422 2643221720 Bacteria 4694283
230 2644696868 2643221727 Bacteria 4415595
231 2644701342 2643221728 Bacteria 4797149
232 2873152581 2873151551 Bacteria 8625867
233 2874609029 2874604998 Bacteria 7834745
234 8048131625 8048127548 Bacteria 11053136
235 Ga0105249_10464274
236 rootH2_10051126
237 JGI25405J52794_10002118
238 Ga0065704_10046246
239 Ga0065704_10257494
240 Ga0065712_10208025
241 Ga0065715_10029539
242 Ga0065707_10144315
243 Ga0065707_10154006
244 Ga0065707_10196636
245 Ga0070658_10004708
246 Ga0070666_10080777
247 Ga0070660_100022119
248 Ga0070689_100045873
249 Ga0070689_100249903
250 Ga0070687_100136626
251 Ga0070661_100006641
252 Ga0070692_10056564
253 Ga0070674_100383724
254 Ga0070709_10311904
255 Ga0070714_100156252
256 Ga0070713_100333887
257 Ga0070711_100279746
258 Ga0070705_100357119
259 Ga0070694_100239542
260 Ga0070708_100131300
261 Ga0070681_10031549
262 Ga0070706_100112509
263 Ga0070706_100378986
264 Ga0070706_100411771
265 Ga0070707_100432847
266 Ga0070707_100454321
267 Ga0070698_100280839
268 Ga0070699_100007604
269 Ga0070699_100125566
270 Ga0070699_100303129
271 Ga0070679_100005031
272 Ga0070679_100039072
273 Ga0070697_100104818
274 Ga0070697_100387239
275 Ga0070697_100539150
276 Ga0070672_100589235
277 Ga0070686_100033745
278 Ga0070704_100032269
279 Ga0070704_100083871
280 Ga0070704_100206829
281 Ga0070704_100832875
282 Ga0068855_100017844
283 Ga0068855_100339496
284 Ga0068855_100803853
285 Ga0068857_100057615
286 Ga0068856_100237615
287 Ga0068856_100806055
288 Ga0068861_100641666
289 Ga0068860_100408088
290 Ga0068860_100548826
291 Ga0081455_10000612
292 Ga0081538_10140554
293 Ga0081538_10175019
294 Ga0070717_10033129
295 Ga0075432_10082903
296 Ga0070712_100083006
297 Ga0070712_100086455
298 Ga0070712_100350302
299 Ga0075366_10043872
300 Ga0075428_100051903
301 Ga0075428_100311162
302 Ga0075428_101101262
303 Ga0075430_100053596
304 Ga0075431_100466000
305 Ga0075433_10080801
306 Ga0075434_100183904
307 Ga0075429_100072444
308 Ga0068865_100127362
309 Ga0075436_100254348
310 Ga0075435_100115016
311 Ga0075435_100283207
312 Ga0075435_100294929
313 Ga0075435_100323153
314 Ga0075435_100419996
315 Ga0099794_10026830
316 Ga0099794_10033135
317 Ga0105240_10002757
318 Ga0105240_10014677
319 Ga0105240_10349459
320 Ga0111539_10075150
321 Ga0114129_10089228
322 Ga0114129_10123065
323 Ga0114129_10137886
324 Ga0105237_10717306
325 Ga0105238_10120735
326 Ga0105249_10017651
327 Ga0105249_10299875
328 Ga0157370_10000772
329 Ga0157374_10205049
330 Ga0157378_10031162
331 Ga0157378_10933110
332 Ga0163162_10103478
333 Ga0163162_10486002
334 Ga0157372_10103826
335 Ga0157372_10164546
336 Ga0157372_10351105
337 Ga0157379_10171051
338 Ga0163161_10111670
339 Ga0206351_10697531
340 Ga0206354_11593030
341 Ga0206353_10355933
342 Ga0213873_10054857
343 Ga0213872_10051628
344 Ga0213874_10007244
345 Ga0213874_10040049
346 Ga0213871_10009685
347 Ga0207653_10062817
348 Ga0207685_10143050
349 Ga0207684_10011751
350 Ga0207684_10579402
351 Ga0207707_10343340
352 Ga0207707_10556758
353 Ga0207695_10007066
354 Ga0207693_10034137
355 Ga0207693_10136105
356 Ga0207693_10157806
357 Ga0207663_10200952
358 Ga0207657_10020104
359 Ga0207649_10156156
360 Ga0207652_10020910
361 Ga0207652_10063311
362 Ga0207646_10231781
363 Ga0207646_10388694
364 Ga0207646_10790946
365 Ga0207681_10140171
366 Ga0207687_10208406
367 Ga0207664_10067724
368 Ga0207664_10325315
369 Ga0207686_10015088
370 Ga0207670_10183387
371 Ga0207669_10149778
372 Ga0207704_10159100
373 Ga0207665_10178714
374 Ga0207665_10211596
375 Ga0207665_10302799
376 Ga0207691_10562011
377 Ga0207661_10002989
378 Ga0207667_10270980
379 Ga0207667_10429002
380 Ga0207712_10071341
381 Ga0207668_10279818
382 Ga0207641_10284772
383 Ga0207674_10071481
384 Ga0207675_100256324
385 Ga0207675_100426278
386 Ga0209973_1001520
387 Ga0209983_1003767
388 Ga0209588_1022083
389 Ga0209974_10003712
390 Ga0207428_10117359
391 Ga0268264_10268459
392 Ga0265336_10030972
393 Ga0265316_10188383
394 Ga0307408_100000282
395 Ga0307406_10000467
396 Ga0373931_0224279
397 Ga0373937_0106937
398 Ga0395899_0020988
399 Ga0395898_0131002
400 Ga0395905_0388019
401 Ga0395901_0213903
402 Ga0395901_1240570
403 Ga0436365_0239133
404 Ga0436363_0292523
405 Ga0436363_0552713
406 Ga0436362_1172736
407 Ga0439439_0004337
408 Ga0439445_0042249
409 Ga0450923_023316
410 Ga0466972_0121587
411 Ga0453683_0000255
412 Ga0466965_0035914
413 Ga0466968_0096826
414 Ga0495635_0042690
415 Ga0495599_0175667
416 Ga0495669_0244222
417 Ga0495624_0050048
418 Ga0495581_0012561
419 Ga0495636_0099479
420 Ga0495674_0015428
421 Ga0495684_0002934
422 Ga0496100_0174756
423 Ga0496102_0059614
424 Ga0496103_0012422
425 Ga0496104_0062373
426 Ga0496107_0279179
427 Ga0496108_0019247
428 Ga0496109_0013128
429 Ga0496110_0010272
430 Ga0496111_0016337
431 Ga0496112_0167345
432 Ga0496126_0095655
433 Ga0501075_0279257
434 nmdc:mga0k408_35474_c1
435 nmdc:mga05p37_163997_c1
436 nmdc:mga05p37_197901_c1
437 nmdc:mga05p37_36725_c1
438 nmdc:mga05p37_430160_c1
439 nmdc:mga05p37_456479_c1
440 nmdc:mga05p37_672072_c1
441 nmdc:mga09592_247438_c1
442 nmdc:mga09592_258949_c1
443 nmdc:mga09592_48679_c1
444 nmdc:mga06r32_38127_c1
445 nmdc:mga08y16_81842_c1
446 nmdc:mga0n895_300314_c1
447 nmdc:mga0n895_450599_c1
448 nmdc:mga0n895_717450_c1
449 nmdc:mga0rr50_312785_c1
450 nmdc:mga0rr50_429869_c1
451 nmdc:mga0rr50_505767_c1
452 nmdc:mga0rr50_542851_c1
453 nmdc:mga0a205_381300_c1
454 nmdc:mga0a205_772875_c1
455 nmdc:mga0a205_81986_c1
456 Ga0500645_014176
457 2548497111
458 2643817395
459 2643880027
460 2643938105
461 2644078422
462 2644647434
463 2644662422
464 2644696868
465 2644701342
466 2873152581
467 2874609029
468 8048131625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

35

229

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

280

0.93

PF08659

KR

KR domain

35

220

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9898 8 256
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9893 5 256
7djs-assembly1.cif.gz_B crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9876 8 256
7djs-assembly1.cif.gz_A crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9818 8 256
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.977 5 256
ID Description Score Start End Superfamily
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9893 5 256 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.977 5 256 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9746 4 256 3.40.50.720
5h5xG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9727 2 256 3.40.50.720
1iy8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9708 5 255 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A523QH89-F1-model_v4 SDR family oxidoreductase 0.9862 101 256 GO:0016491
AF-X1T2W3-F1-model_v4 SDR family oxidoreductase 0.9844 93 256 GO:0016491
AF-A0A845DH81-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9814 4 80
AF-A0A7X7F3E3-F1-model_v4 SDR family oxidoreductase 0.9807 98 253
AF-X1T2W3-F1-model_v4 SDR family oxidoreductase 0.9785 93 256 GO:0016491

Map