F346837

General Info

Members Datasets Scaffolds Average Seq Length
234 164 468 295

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100111836|Ga0070694_1001118362
Length 345
Sequence VSILIDRNTRLIVQGITGRDGAFHTQQMLAYGTKVVGGVTPGKGGSEQHGVPVFDSVAEAVAATKANASVIYVPAPFAADAIHEAADAGIALIVCITEGLPVRDTLGAFHKVLALRGVNNALGRPRLVGPNCPGLITPGQSKVGILPGHICIPGPVGVVSKSGTLTYEVVKQLTDHGLGQTTCLGIGGDPIIGTDFIDALTLFEADGKTEAIVLMGEIGGNAEEQAAQFIKRHVTKPVVAFVAGQTAPPGKRMGHAGAIISGGTGTAAEKMAAFEAAGVPVARIPSEIPGLISELLQRRRTRQKNGTARKAESPGRTNGKVARGAAKPSSRALANGRGTTKKKKR

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
81 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
88 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
154 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
158 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
159 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
160 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
161 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
162 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
163 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
164 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.02
Metatranscriptomes 2.56
Isolates 3.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.99
Nodule 0
Rhizoplane 0.43
Rhizosphere 95.3
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100111836 3300005444 Bacteria 1947
2 Ga0065707_10085564 3300005295 Bacteria 6058
3 Ga0070690_100051351 3300005330 Bacteria 2632
4 Ga0070690_100053155 3300005330 Bacteria 2590
5 Ga0070690_100092114 3300005330 Bacteria 1998
6 Ga0070690_100134441 3300005330 Bacteria 1673
7 Ga0070670_100003341 3300005331 Bacteria 13281
8 Ga0070680_100206473 3300005336 Bacteria 1657
9 Ga0070660_100050313 3300005339 Bacteria 3206
10 Ga0070689_100000742 3300005340 Bacteria 19921
11 Ga0070689_100001423 3300005340 Bacteria 15246
12 Ga0070689_100001852 3300005340 Bacteria 13622
13 Ga0070687_100002292 3300005343 Bacteria 7106
14 Ga0070675_100021868 3300005354 Bacteria 5110
15 Ga0070688_100000790 3300005365 Bacteria 15649
16 Ga0070688_100034015 3300005365 Bacteria 3084
17 Ga0070688_100049172 3300005365 Bacteria 2623
18 Ga0070700_100132134 3300005441 Bacteria 1686
19 Ga0070694_100083854 3300005444 Bacteria 2222
20 Ga0070708_100102977 3300005445 Bacteria 2616
21 Ga0070708_100257526 3300005445 Bacteria 1640
22 Ga0070678_100093790 3300005456 Bacteria 2309
23 Ga0070685_10000618 3300005466 Bacteria 19513
24 Ga0070685_10043450 3300005466 Bacteria 2569
25 Ga0070698_100011132 3300005471 Bacteria 9555
26 Ga0070698_100123080 3300005471 Bacteria 2552
27 Ga0070699_100000121 3300005518 Bacteria 72013
28 Ga0070699_100068112 3300005518 Bacteria 3091
29 Ga0070679_100168785 3300005530 Bacteria 2161
30 Ga0068853_100379895 3300005539 Unclassified 1319
31 Ga0070686_100036121 3300005544 Bacteria 3057
32 Ga0070695_100001294 3300005545 Bacteria 13811
33 Ga0070704_100012332 3300005549 Bacteria 5277
34 Ga0068857_100132317 3300005577 Bacteria 2250
35 Ga0070702_100341469 3300005615 Bacteria 1051
36 Ga0068859_100291988 3300005617 Bacteria 1724
37 Ga0068866_10000025 3300005718 Bacteria 59717
38 Ga0068870_10039965 3300005840 Bacteria 2430
39 Ga0068870_10208396 3300005840 Bacteria 1189
40 Ga0068858_100009009 3300005842 Bacteria 9547
41 Ga0068858_100153106 3300005842 Unclassified 2169
42 Ga0081455_10145483 3300005937 Bacteria 1834
43 Ga0081538_10010504 3300005981 Bacteria 7590
44 Ga0081538_10018261 3300005981 Bacteria 5279
45 Ga0075363_100005111 3300006048 Bacteria 5805
46 Ga0075362_10037465 3300006177 Bacteria 2126
47 Ga0075370_10001971 3300006353 Bacteria 9287
48 Ga0075428_100000108 3300006844 Bacteria 70319
49 Ga0075428_100007996 3300006844 Bacteria 11729
50 Ga0075428_100088329 3300006844 Bacteria 3381
51 Ga0075428_100203824 3300006844 Bacteria 2138
52 Ga0075433_10035240 3300006852 Bacteria 4302
53 Ga0075433_10059952 3300006852 Bacteria 3331
54 Ga0075434_100092550 3300006871 Bacteria 3026
55 Ga0075434_100106038 3300006871 Bacteria 2820
56 Ga0075434_100169984 3300006871 Bacteria 2200
57 Ga0075429_100004732 3300006880 Bacteria 11714
58 Ga0068865_100016239 3300006881 Bacteria 4760
59 Ga0075436_100007621 3300006914 Bacteria 7394
60 Ga0097620_100291965 3300006931 Bacteria 1724
61 Ga0105240_10005114 3300009093 Bacteria 19632
62 Ga0105240_10044481 3300009093 Bacteria 5642
63 Ga0105240_10365557 3300009093 Bacteria 1633
64 Ga0105240_10370235 3300009093 Bacteria 1620
65 Ga0111539_10000001 3300009094 Bacteria 1035431
66 Ga0111539_10366103 3300009094 Bacteria 1678
67 Ga0114129_10112445 3300009147 Bacteria 3755
68 Ga0105242_10000754 3300009176 Bacteria 25163
69 Ga0105242_10509650 3300009176 Bacteria 1146
70 Ga0105237_10000162 3300009545 Bacteria 94687
71 Ga0105249_10002827 3300009553 Bacteria 14973
72 Ga0105239_10002183 3300010375 Bacteria 25163
73 Ga0105239_10013870 3300010375 Bacteria 8943
74 Ga0157371_10131201 3300013102 Bacteria 1783
75 Ga0157379_10087264 3300014968 Bacteria 2797
76 Ga0157379_10104377 3300014968 Bacteria 2544
77 Ga0157376_10001564 3300014969 Bacteria 15133
78 Ga0207642_10000081 3300025899 Bacteria 25151
79 Ga0207680_10040745 3300025903 Bacteria 2705
80 Ga0207643_10042279 3300025908 Bacteria 2569
81 Ga0207684_10239291 3300025910 Bacteria 1566
82 Ga0207695_10006701 3300025913 Bacteria 14860
83 Ga0207695_10048305 3300025913 Bacteria 4495
84 Ga0207671_10000004 3300025914 Bacteria 1022356
85 Ga0207660_10152285 3300025917 Bacteria 1778
86 Ga0207652_10035038 3300025921 Bacteria 4235
87 Ga0207681_10082837 3300025923 Bacteria 2269
88 Ga0207650_10006598 3300025925 Bacteria 7911
89 Ga0207659_10031887 3300025926 Bacteria 3612
90 Ga0207686_10000076 3300025934 Bacteria 90345
91 Ga0207709_10064739 3300025935 Bacteria 2297
92 Ga0207670_10000630 3300025936 Bacteria 18876
93 Ga0207670_10000651 3300025936 Bacteria 18367
94 Ga0207670_10028403 3300025936 Bacteria 3551
95 Ga0207670_10037718 3300025936 Bacteria 3151
96 Ga0207669_10014716 3300025937 Bacteria 3928
97 Ga0207669_10163617 3300025937 Bacteria 1575
98 Ga0207704_10001178 3300025938 Bacteria 11650
99 Ga0207704_10485285 3300025938 Bacteria 993
100 Ga0207689_10201919 3300025942 Bacteria 1641
101 Ga0207712_10002506 3300025961 Bacteria 11816
102 Ga0207703_10006466 3300026035 Bacteria 9357
103 Ga0207703_10180105 3300026035 Bacteria 1865
104 Ga0207708_10111514 3300026075 Bacteria 2124
105 Ga0207674_10151966 3300026116 Bacteria 2272
106 Ga0207675_100039232 3300026118 Bacteria 4420
107 Ga0207683_10033758 3300026121 Bacteria 4446
108 Ga0207428_10000002 3300027907 Bacteria 854851
109 Ga0207428_10024621 3300027907 Bacteria 5054
110 Ga0265354_1001547 3300028016 Bacteria 3240
111 Ga0268264_10198524 3300028381 Bacteria 1834
112 Ga0265338_10000951 3300028800 Bacteria 48753
113 Ga0265338_10059698 3300028800 Bacteria 3358
114 Ga0265338_10074581 3300028800 Bacteria 2884
115 Ga0265770_1000789 3300030878 Bacteria 4421
116 Ga0265760_10002000 3300031090 Bacteria 5994
117 Ga0265340_10032750 3300031247 Bacteria 2593
118 Ga0316575_10014963 3300031665 Bacteria 2921
119 Ga0316579_10063743 3300031691 Bacteria 1737
120 Ga0316576_10000894 3300031727 Bacteria 15189
121 Ga0316576_10197996 3300031727 Bacteria 1514
122 Ga0316578_10000651 3300031728 Bacteria 12292
123 Ga0316578_10019825 3300031728 Bacteria 3709
124 Ga0316577_10002446 3300031733 Bacteria 9198
125 Ga0307416_100070488 3300032002 Bacteria 2899
126 Ga0307411_10394329 3300032005 Bacteria 1142
127 Ga0316583_10003630 3300032133 Bacteria 5450
128 Ga0316592_1000186 3300033524 Bacteria 7379
129 Ga0316588_1000620 3300033528 Bacteria 5080
130 Ga0316596_1015055 3300033541 Bacteria 1924
131 Ga0373923_0010931 3300035111 Bacteria 3317
132 Ga0373945_0065453 3300035116 Bacteria 1365
133 Ga0373953_0027301 3300035117 Bacteria 2193
134 Ga0373957_0001392 3300035120 Bacteria 6516
135 Ga0373955_0015534 3300035172 Bacteria 3729
136 Ga0373924_0044904 3300035410 Bacteria 1817
137 Ga0373937_0074370 3300036401 Bacteria 3135
138 Ga0373937_0177504 3300036401 Bacteria 1999
139 Ga0316582_0009201 3300036647 Bacteria 5349
140 Ga0316582_0163075 3300036647 Bacteria 1510
141 Ga0316582_0259736 3300036647 Bacteria 1191
142 Ga0316584_0000022 3300036712 Bacteria 52415
143 Ga0316584_0002980 3300036712 Bacteria 10891
144 Ga0373925_0388961 3300037068 Bacteria 1136
145 Ga0395898_0240849 3300037466 Bacteria 1725
146 Ga0436365_1200090 3300039437 Bacteria 1436
147 Ga0436361_0314635 3300039447 Bacteria 1395
148 Ga0436361_0576627 3300039447 Bacteria 4210
149 Ga0451577_0298830 3300042876 Bacteria 1459
150 Ga0451577_0361207 3300042876 Unclassified 1317
151 Ga0453683_0080658 3300044673 Bacteria 2038
152 Ga0453684_0002152 3300044712 Bacteria 49337
153 Ga0453684_0068672 3300044712 Bacteria 4499
154 Ga0451576_0001691 3300045051 Bacteria 36521
155 Ga0451576_0004122 3300045051 Bacteria 19166
156 Ga0451576_0026897 3300045051 Bacteria 6182
157 Ga0451576_0235657 3300045051 Bacteria 1911
158 Ga0451576_0504442 3300045051 Bacteria 1271
159 Ga0451576_0706733 3300045051 Bacteria 1059
160 Ga0466958_0089814 3300045836 Bacteria 1900
161 Ga0495629_0030812 3300046459 Bacteria 3800
162 Ga0495651_0020836 3300046462 Bacteria 5089
163 Ga0495580_0009102 3300046472 Bacteria 7831
164 Ga0495582_0034651 3300046473 Bacteria 2774
165 Ga0495608_0001370 3300046511 Bacteria 17367
166 Ga0495622_0126274 3300046557 Bacteria 1166
167 Ga0495634_0104105 3300046642 Bacteria 1831
168 Ga0495659_0000180 3300046664 Bacteria 27768
169 Ga0495657_0098001 3300046675 Bacteria 1871
170 Ga0495658_0007684 3300046683 Bacteria 5342
171 Ga0495672_0011209 3300047320 Bacteria 6336
172 Ga0496101_0091441 3300048904 Bacteria 2265
173 Ga0496126_0047162 3300048929 Bacteria 3945
174 Ga0496126_0248039 3300048929 Bacteria 1485
175 Ga0501305_015647 3300049161 Bacteria 1073
176 Ga0501034_0003998 3300049571 Bacteria 16559
177 Ga0501034_0092884 3300049571 Bacteria 3014
178 Ga0501034_0380661 3300049571 Bacteria 1336
179 Ga0501036_0024854 3300049572 Bacteria 5052
180 Ga0501038_0121465 3300049574 Bacteria 2154
181 Ga0501039_0026204 3300049575 Bacteria 4481
182 Ga0501039_0258528 3300049575 Bacteria 1369
183 Ga0501041_0003708 3300049577 Bacteria 8786
184 Ga0501042_0058812 3300049578 Bacteria 2744
185 Ga0501048_0039984 3300049582 Bacteria 3362
186 Ga0501048_0131335 3300049582 Bacteria 1770
187 Ga0501067_0053503 3300049583 Bacteria 2237
188 Ga0501068_0017648 3300049584 Bacteria 4129
189 Ga0501070_0404036 3300049586 Bacteria 1104
190 Ga0501071_0025956 3300049587 Bacteria 4107
191 Ga0501071_0233924 3300049587 Bacteria 1385
192 Ga0501071_0270286 3300049587 Bacteria 1285
193 Ga0501072_0042464 3300049588 Bacteria 3572
194 Ga0501072_0103436 3300049588 Bacteria 2263
195 Ga0501074_0113810 3300049590 Bacteria 1936
196 Ga0501074_0192315 3300049590 Bacteria 1455
197 Ga0501075_0008796 3300049591 Bacteria 7038
198 Ga0501075_0009753 3300049591 Bacteria 6729
199 Ga0501075_0237416 3300049591 Bacteria 1390
200 Ga0501076_0019279 3300049592 Bacteria 5212
201 Ga0501077_0065877 3300049593 Bacteria 2297
202 Ga0501079_0014119 3300049741 Bacteria 6087
203 Ga0501079_0072496 3300049741 Bacteria 2662
204 Ga0501080_0259272 3300049742 Bacteria 1584
205 Ga0501081_0010960 3300049743 Bacteria 5924
206 Ga0501081_0021320 3300049743 Bacteria 4323
207 Ga0501081_0042404 3300049743 Bacteria 3118
208 Ga0501045_0052898 3300049824 Bacteria 2966
209 nmdc:mga03n38_53411_c1 3300050490 Bacteria 1812
210 nmdc:mga07m45_8296_c1 3300050496 Bacteria 5333
211 nmdc:mga05p37_20006_c1 3300050507 Bacteria 8099
212 nmdc:mga09592_6361_c1 3300050508 Bacteria 9622
213 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
214 nmdc:mga08y16_44840_c1 3300050511 Bacteria 4635
215 nmdc:mga0n895_102264_c1 3300050512 Bacteria 2876
216 nmdc:mga0n895_207628_c1 3300050512 Bacteria 1989
217 nmdc:mga0n895_314662_c1 3300050512 Bacteria 1586
218 nmdc:mga0n895_540060_c1 3300050512 Bacteria 1172
219 nmdc:mga0rr50_59479_c1 3300050513 Bacteria 2869
220 nmdc:mga0a205_50726_c1 3300050515 Bacteria 4006
221 Ga0495595_0005114 3300053084 Bacteria 5302
222 Ga0495619_0113517 3300053085 Bacteria 1853
223 Ga0500595_000035 3300053119 Bacteria 106463
224 Ga0500638_000002 3300053162 Bacteria 188968
225 Ga0501084_0043294 3300054114 Bacteria 3766
226 Ga0530510_0072862 3300061734 Bacteria 2493
227 2852674987 2852673933 Bacteria 3347676
228 2881647622 2881644220 Bacteria 5302661
229 3001273075 3001272096 Bacteria 4729684
230 3006970653 3006969106 Bacteria 4739423
231 3006974819 3006973921 Bacteria 4423788
232 3006985541 3006984091 Bacteria 4207523
233 3006989628 3006988479 Bacteria 4767936
234 8022949498 8022948649 Bacteria 5366783
235 Ga0070694_100111836
236 Ga0065707_10085564
237 Ga0070690_100051351
238 Ga0070690_100053155
239 Ga0070690_100092114
240 Ga0070690_100134441
241 Ga0070670_100003341
242 Ga0070680_100206473
243 Ga0070660_100050313
244 Ga0070689_100000742
245 Ga0070689_100001423
246 Ga0070689_100001852
247 Ga0070687_100002292
248 Ga0070675_100021868
249 Ga0070688_100000790
250 Ga0070688_100034015
251 Ga0070688_100049172
252 Ga0070700_100132134
253 Ga0070694_100083854
254 Ga0070708_100102977
255 Ga0070708_100257526
256 Ga0070678_100093790
257 Ga0070685_10000618
258 Ga0070685_10043450
259 Ga0070698_100011132
260 Ga0070698_100123080
261 Ga0070699_100000121
262 Ga0070699_100068112
263 Ga0070679_100168785
264 Ga0068853_100379895
265 Ga0070686_100036121
266 Ga0070695_100001294
267 Ga0070704_100012332
268 Ga0068857_100132317
269 Ga0070702_100341469
270 Ga0068859_100291988
271 Ga0068866_10000025
272 Ga0068870_10039965
273 Ga0068870_10208396
274 Ga0068858_100009009
275 Ga0068858_100153106
276 Ga0081455_10145483
277 Ga0081538_10010504
278 Ga0081538_10018261
279 Ga0075363_100005111
280 Ga0075362_10037465
281 Ga0075370_10001971
282 Ga0075428_100000108
283 Ga0075428_100007996
284 Ga0075428_100088329
285 Ga0075428_100203824
286 Ga0075433_10035240
287 Ga0075433_10059952
288 Ga0075434_100092550
289 Ga0075434_100106038
290 Ga0075434_100169984
291 Ga0075429_100004732
292 Ga0068865_100016239
293 Ga0075436_100007621
294 Ga0097620_100291965
295 Ga0105240_10005114
296 Ga0105240_10044481
297 Ga0105240_10365557
298 Ga0105240_10370235
299 Ga0111539_10000001
300 Ga0111539_10366103
301 Ga0114129_10112445
302 Ga0105242_10000754
303 Ga0105242_10509650
304 Ga0105237_10000162
305 Ga0105249_10002827
306 Ga0105239_10002183
307 Ga0105239_10013870
308 Ga0157371_10131201
309 Ga0157379_10087264
310 Ga0157379_10104377
311 Ga0157376_10001564
312 Ga0207642_10000081
313 Ga0207680_10040745
314 Ga0207643_10042279
315 Ga0207684_10239291
316 Ga0207695_10006701
317 Ga0207695_10048305
318 Ga0207671_10000004
319 Ga0207660_10152285
320 Ga0207652_10035038
321 Ga0207681_10082837
322 Ga0207650_10006598
323 Ga0207659_10031887
324 Ga0207686_10000076
325 Ga0207709_10064739
326 Ga0207670_10000630
327 Ga0207670_10000651
328 Ga0207670_10028403
329 Ga0207670_10037718
330 Ga0207669_10014716
331 Ga0207669_10163617
332 Ga0207704_10001178
333 Ga0207704_10485285
334 Ga0207689_10201919
335 Ga0207712_10002506
336 Ga0207703_10006466
337 Ga0207703_10180105
338 Ga0207708_10111514
339 Ga0207674_10151966
340 Ga0207675_100039232
341 Ga0207683_10033758
342 Ga0207428_10000002
343 Ga0207428_10024621
344 Ga0265354_1001547
345 Ga0268264_10198524
346 Ga0265338_10000951
347 Ga0265338_10059698
348 Ga0265338_10074581
349 Ga0265770_1000789
350 Ga0265760_10002000
351 Ga0265340_10032750
352 Ga0316575_10014963
353 Ga0316579_10063743
354 Ga0316576_10000894
355 Ga0316576_10197996
356 Ga0316578_10000651
357 Ga0316578_10019825
358 Ga0316577_10002446
359 Ga0307416_100070488
360 Ga0307411_10394329
361 Ga0316583_10003630
362 Ga0316592_1000186
363 Ga0316588_1000620
364 Ga0316596_1015055
365 Ga0373923_0010931
366 Ga0373945_0065453
367 Ga0373953_0027301
368 Ga0373957_0001392
369 Ga0373955_0015534
370 Ga0373924_0044904
371 Ga0373937_0074370
372 Ga0373937_0177504
373 Ga0316582_0009201
374 Ga0316582_0163075
375 Ga0316582_0259736
376 Ga0316584_0000022
377 Ga0316584_0002980
378 Ga0373925_0388961
379 Ga0395898_0240849
380 Ga0436365_1200090
381 Ga0436361_0314635
382 Ga0436361_0576627
383 Ga0451577_0298830
384 Ga0451577_0361207
385 Ga0453683_0080658
386 Ga0453684_0002152
387 Ga0453684_0068672
388 Ga0451576_0001691
389 Ga0451576_0004122
390 Ga0451576_0026897
391 Ga0451576_0235657
392 Ga0451576_0504442
393 Ga0451576_0706733
394 Ga0466958_0089814
395 Ga0495629_0030812
396 Ga0495651_0020836
397 Ga0495580_0009102
398 Ga0495582_0034651
399 Ga0495608_0001370
400 Ga0495622_0126274
401 Ga0495634_0104105
402 Ga0495659_0000180
403 Ga0495657_0098001
404 Ga0495658_0007684
405 Ga0495672_0011209
406 Ga0496101_0091441
407 Ga0496126_0047162
408 Ga0496126_0248039
409 Ga0501305_015647
410 Ga0501034_0003998
411 Ga0501034_0092884
412 Ga0501034_0380661
413 Ga0501036_0024854
414 Ga0501038_0121465
415 Ga0501039_0026204
416 Ga0501039_0258528
417 Ga0501041_0003708
418 Ga0501042_0058812
419 Ga0501048_0039984
420 Ga0501048_0131335
421 Ga0501067_0053503
422 Ga0501068_0017648
423 Ga0501070_0404036
424 Ga0501071_0025956
425 Ga0501071_0233924
426 Ga0501071_0270286
427 Ga0501072_0042464
428 Ga0501072_0103436
429 Ga0501074_0113810
430 Ga0501074_0192315
431 Ga0501075_0008796
432 Ga0501075_0009753
433 Ga0501075_0237416
434 Ga0501076_0019279
435 Ga0501077_0065877
436 Ga0501079_0014119
437 Ga0501079_0072496
438 Ga0501080_0259272
439 Ga0501081_0010960
440 Ga0501081_0021320
441 Ga0501081_0042404
442 Ga0501045_0052898
443 nmdc:mga03n38_53411_c1
444 nmdc:mga07m45_8296_c1
445 nmdc:mga05p37_20006_c1
446 nmdc:mga09592_6361_c1
447 nmdc:mga08y16_3_c1
448 nmdc:mga08y16_44840_c1
449 nmdc:mga0n895_102264_c1
450 nmdc:mga0n895_207628_c1
451 nmdc:mga0n895_314662_c1
452 nmdc:mga0n895_540060_c1
453 nmdc:mga0rr50_59479_c1
454 nmdc:mga0a205_50726_c1
455 Ga0495595_0005114
456 Ga0495619_0113517
457 Ga0500595_000035
458 Ga0500638_000002
459 Ga0501084_0043294
460 Ga0530510_0072862
461 2852674987
462 2881647622
463 3001273075
464 3006970653
465 3006974819
466 3006985541
467 3006989628
468 8022949498

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02629

CoA_binding

CoA binding domain

6

99

0.98

PF00549

Ligase_CoA

CoA-ligase

159

280

0.96

PF13607

Succ_CoA_lig

Succinyl-CoA ligase like flavodoxin domain

153

291

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jkj-assembly1.cif.gz_A e. coli scs 0.9818 2 288
2nu7-assembly1.cif.gz_A c123as mutant of e. coli succinyl-coa synthetase 0.9811 2 288
2nu6-assembly1.cif.gz_A c123aa mutant of e. coli succinyl-coa synthetase 0.9809 2 288
2nu8-assembly1.cif.gz_A c123at mutant of e. coli succinyl-coa synthetase 0.9805 2 288
6pfn-assembly2.cif.gz_C succinyl-coa synthase from francisella tularensis 0.9803 2 287
ID Description Score Start End Superfamily
af_A0A1D6EZI1_156_262_3.40.50.261 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 1 121 206 3.40.50.261
1jllA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9801 2 123 3.40.50.720
1jllA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9723 2 123 3.40.50.720
2yv2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9721 4 123 3.40.50.720
af_P9WGC7_135_303_3.40.50.261 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 0.9671 121 287 3.40.50.261
ID Description Score Start End GO Terms
AF-A0A7W0MGU0-F1-model_v4 CoA-binding protein 0.999 1 128 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-A0A2G6FJT6-F1-model_v4 Succinate--CoA ligase subunit alpha 0.9979 1 126 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-A0A2N6AXS6-F1-model_v4 Succinate--CoA ligase subunit alpha 0.9977 1 130 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-A0A357F101-F1-model_v4 Succinate--CoA ligase subunit alpha 0.9971 1 179 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-A0A2V6R583-F1-model_v4 Succinate--CoA ligase subunit alpha 0.9969 1 173 GO:0004775
GO:0004776
GO:0006099
GO:0009361

Map