F346690

General Info

Members Datasets Scaffolds Average Seq Length
234 163 468 196

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10073735|rootH2_100737352
Length 199
Sequence VGKIYDGIDLHQREWIASQPLFFVASAPLDEDGHVNVSPKGPIGTLRVLDDHTVAYLDMVGSGAETVAHIRENGRIVVMLCAFEGPPRILRLHGKGEVVPNDDERFDELNERAGFEAPHEVEAARRAIILVDVTRVSDSCGYGVPLMSYEGERPHMDLSTAKRVRVEGEGAMRAYERDNNSESIDGLPALAGQIIEPNA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 10.26
Rhizosphere 83.76
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10073735 3300003320 Bacteria 1730
2 Ga0070680_100391389 3300005336 Bacteria 1184
3 Ga0070680_100603868 3300005336 Bacteria 942
4 Ga0070682_100290523 3300005337 Bacteria 1195
5 Ga0068868_100616738 3300005338 Bacteria 963
6 Ga0070689_100140013 3300005340 Bacteria 1945
7 Ga0070691_10037557 3300005341 Bacteria 2285
8 Ga0070668_100102122 3300005347 Bacteria 2273
9 Ga0070674_100218348 3300005356 Bacteria 1482
10 Ga0070673_100249272 3300005364 Bacteria 1547
11 Ga0070659_100114889 3300005366 Bacteria 2175
12 Ga0070659_100816293 3300005366 Bacteria 812
13 Ga0070667_100073246 3300005367 Bacteria 2920
14 Ga0070714_100536536 3300005435 Bacteria 1119
15 Ga0070714_101045924 3300005435 Bacteria 795
16 Ga0070701_10300325 3300005438 Bacteria 987
17 Ga0070711_100339902 3300005439 Bacteria 1204
18 Ga0070705_100174659 3300005440 Bacteria 1449
19 Ga0070700_100030465 3300005441 Bacteria 3224
20 Ga0070700_100031968 3300005441 Bacteria 3159
21 Ga0070694_100106751 3300005444 Bacteria 1989
22 Ga0070663_100157694 3300005455 Bacteria 1745
23 Ga0070678_100066822 3300005456 Bacteria 2674
24 Ga0070662_100139724 3300005457 Bacteria 1876
25 Ga0070681_10342390 3300005458 Bacteria 1405
26 Ga0068867_100400359 3300005459 Bacteria 1158
27 Ga0068867_100540449 3300005459 Bacteria 1008
28 Ga0070685_10014072 3300005466 Bacteria 4232
29 Ga0070707_100152781 3300005468 Bacteria 2248
30 Ga0070698_100454153 3300005471 Bacteria 1217
31 Ga0070679_100283784 3300005530 Bacteria 1608
32 Ga0070679_101050129 3300005530 Bacteria 759
33 Ga0070684_100001966 3300005535 Bacteria 15097
34 Ga0070665_100056592 3300005548 Bacteria 3932
35 Ga0070704_100719658 3300005549 Bacteria 887
36 Ga0068855_100031317 3300005563 Bacteria 6352
37 Ga0070664_100066567 3300005564 Bacteria 3077
38 Ga0070664_100296672 3300005564 Bacteria 1460
39 Ga0068854_100045895 3300005578 Bacteria 3109
40 Ga0068854_101034635 3300005578 Bacteria 729
41 Ga0068856_100023629 3300005614 Bacteria 5977
42 Ga0068856_100857475 3300005614 Bacteria 927
43 Ga0068856_101186289 3300005614 Bacteria 780
44 Ga0070702_100042146 3300005615 Bacteria 2565
45 Ga0068859_100018294 3300005617 Bacteria 7044
46 Ga0068859_100619160 3300005617 Bacteria 1175
47 Ga0068859_100951513 3300005617 Bacteria 942
48 Ga0068864_100068465 3300005618 Bacteria 3084
49 Ga0068861_100382164 3300005719 Bacteria 1244
50 Ga0068870_10107899 3300005840 Bacteria 1585
51 Ga0068863_101335886 3300005841 Bacteria 724
52 Ga0068858_100214010 3300005842 Bacteria 1824
53 Ga0068860_100199283 3300005843 Bacteria 1939
54 Ga0068860_100436919 3300005843 Bacteria 1299
55 Ga0068862_100000198 3300005844 Bacteria 66534
56 Ga0068862_100000689 3300005844 Bacteria 34498
57 Ga0068862_100110346 3300005844 Bacteria 2414
58 Ga0081540_1039550 3300005983 Bacteria 2471
59 Ga0081540_1113993 3300005983 Bacteria 1136
60 Ga0075432_10072138 3300006058 Bacteria 1242
61 Ga0070712_100092002 3300006175 Bacteria 2224
62 Ga0075431_100606294 3300006847 Bacteria 1078
63 Ga0075433_10098824 3300006852 Bacteria 2584
64 Ga0075434_100433282 3300006871 Bacteria 1336
65 Ga0068865_100012531 3300006881 Bacteria 5339
66 Ga0097620_100619268 3300006931 Bacteria 1175
67 Ga0097620_100951354 3300006931 Bacteria 942
68 Ga0075435_100032865 3300007076 Bacteria 4099
69 Ga0111539_10056400 3300009094 Bacteria 4669
70 Ga0111539_12185592 3300009094 Bacteria 642
71 Ga0105245_10020437 3300009098 Bacteria 5807
72 Ga0105245_10222243 3300009098 Bacteria 1823
73 Ga0105245_11687145 3300009098 Bacteria 686
74 Ga0114129_10660906 3300009147 Bacteria 1348
75 Ga0105243_10113573 3300009148 Bacteria 2271
76 Ga0105243_10553706 3300009148 Bacteria 1099
77 Ga0105243_10615394 3300009148 Bacteria 1047
78 Ga0105241_10386889 3300009174 Bacteria 1224
79 Ga0105248_10161812 3300009177 Bacteria 2524
80 Ga0105237_10001629 3300009545 Bacteria 29136
81 Ga0105249_10029665 3300009553 Bacteria 4941
82 Ga0105249_10050163 3300009553 Bacteria 3805
83 Ga0105239_10002616 3300010375 Bacteria 22778
84 Ga0105246_10028864 3300011119 Bacteria 3647
85 Ga0105246_10367835 3300011119 Bacteria 1184
86 Ga0105246_10743969 3300011119 Bacteria 864
87 Ga0157374_10011836 3300013296 Bacteria 7568
88 Ga0157372_10003197 3300013307 Bacteria 17685
89 Ga0157372_10730957 3300013307 Bacteria 1151
90 Ga0157375_10684454 3300013308 Bacteria 1180
91 Ga0163163_10625519 3300014325 Bacteria 1140
92 Ga0157380_10082358 3300014326 Bacteria 2634
93 Ga0157380_10410360 3300014326 Bacteria 1288
94 Ga0157380_11012628 3300014326 Bacteria 865
95 Ga0157377_10001602 3300014745 Bacteria 9842
96 Ga0157379_10019158 3300014968 Bacteria 6042
97 Ga0157379_10328531 3300014968 Bacteria 1397
98 Ga0213874_10005192 3300021377 Bacteria 3023
99 Ga0213876_10068598 3300021384 Unclassified 1873
100 Ga0207688_10004242 3300025901 Bacteria 7814
101 Ga0207647_10325453 3300025904 Bacteria 872
102 Ga0207645_10254510 3300025907 Bacteria 1162
103 Ga0207643_10058487 3300025908 Bacteria 2197
104 Ga0207654_10215293 3300025911 Bacteria 1271
105 Ga0207671_10001639 3300025914 Bacteria 25469
106 Ga0207693_10016442 3300025915 Bacteria 5911
107 Ga0207663_10465938 3300025916 Bacteria 977
108 Ga0207660_10279341 3300025917 Bacteria 1325
109 Ga0207662_10368415 3300025918 Bacteria 968
110 Ga0207652_10316447 3300025921 Bacteria 1409
111 Ga0207646_10070586 3300025922 Bacteria 3120
112 Ga0207646_10806381 3300025922 Unclassified 836
113 Ga0207681_10867952 3300025923 Bacteria 755
114 Ga0207659_11083689 3300025926 Bacteria 689
115 Ga0207687_10475916 3300025927 Bacteria 1039
116 Ga0207687_10884720 3300025927 Bacteria 764
117 Ga0207690_10153003 3300025932 Bacteria 1712
118 Ga0207706_10048160 3300025933 Bacteria 3770
119 Ga0207706_10056263 3300025933 Bacteria 3469
120 Ga0207706_10362912 3300025933 Bacteria 1258
121 Ga0207709_10357355 3300025935 Bacteria 1105
122 Ga0207709_10369359 3300025935 Bacteria 1088
123 Ga0207691_10116917 3300025940 Bacteria 2366
124 Ga0207691_10528412 3300025940 Bacteria 1001
125 Ga0207689_10043192 3300025942 Bacteria 3726
126 Ga0207679_10028905 3300025945 Bacteria 3855
127 Ga0207679_10292379 3300025945 Bacteria 1401
128 Ga0207679_10766546 3300025945 Bacteria 878
129 Ga0207667_10039354 3300025949 Bacteria 5039
130 Ga0207712_10010804 3300025961 Bacteria 5807
131 Ga0207668_10025434 3300025972 Bacteria 3832
132 Ga0207668_10026935 3300025972 Bacteria 3740
133 Ga0207668_10197444 3300025972 Bacteria 1600
134 Ga0207658_10009210 3300025986 Bacteria 6693
135 Ga0207677_10265530 3300026023 Bacteria 1401
136 Ga0207703_10043428 3300026035 Bacteria 3608
137 Ga0207678_10174461 3300026067 Bacteria 1836
138 Ga0207708_10000450 3300026075 Bacteria 31989
139 Ga0207708_10015078 3300026075 Bacteria 5793
140 Ga0207708_10096124 3300026075 Bacteria 2289
141 Ga0207702_10238338 3300026078 Bacteria 1703
142 Ga0207648_10056091 3300026089 Bacteria 3439
143 Ga0207675_100354689 3300026118 Bacteria 1438
144 Ga0207683_10018666 3300026121 Bacteria 5919
145 Ga0207698_10033920 3300026142 Bacteria 3714
146 Ga0207428_10091987 3300027907 Bacteria 2354
147 Ga0268265_10000021 3300028380 Bacteria 272292
148 Ga0268265_10033189 3300028380 Bacteria 3750
149 Ga0268265_10670246 3300028380 Bacteria 999
150 Ga0268264_10875658 3300028381 Bacteria 900
151 Ga0265332_10050251 3300031238 Bacteria 1792
152 Ga0265314_10061801 3300031711 Bacteria 2548
153 Ga0307405_10257471 3300031731 Bacteria 1302
154 Ga0307405_10261844 3300031731 Bacteria 1292
155 Ga0307413_10136918 3300031824 Bacteria 1685
156 Ga0307410_10035155 3300031852 Bacteria 3251
157 Ga0326468_10017304 3300031889 Bacteria 820
158 Ga0307407_10356471 3300031903 Bacteria 1037
159 Ga0307409_100009221 3300031995 Bacteria 6049
160 Ga0307409_100310319 3300031995 Bacteria 1472
161 Ga0307409_100665670 3300031995 Bacteria 1037
162 Ga0307416_100013340 3300032002 Bacteria 5581
163 Ga0307416_100281890 3300032002 Bacteria 1639
164 Ga0307414_10214122 3300032004 Bacteria 1577
165 Ga0307414_10517030 3300032004 Bacteria 1059
166 Ga0307411_10108315 3300032005 Bacteria 1982
167 Ga0307415_100005303 3300032126 Bacteria 6824
168 Ga0395898_0009946 3300037466 Bacteria 9963
169 Ga0395905_0073207 3300037471 Bacteria 3212
170 Ga0395905_0482644 3300037471 Bacteria 1139
171 Ga0395901_0004943 3300038443 Bacteria 13457
172 Ga0395901_0139212 3300038443 Bacteria 2551
173 Ga0395901_0178965 3300038443 Bacteria 2224
174 Ga0395901_0250777 3300038443 Bacteria 1844
175 Ga0395901_0279184 3300038443 Bacteria 1736
176 Ga0395901_0468726 3300038443 Bacteria 1286
177 Ga0436365_0052162 3300039437 Bacteria 1484
178 Ga0436365_0389229 3300039437 Unclassified 4096
179 Ga0436365_1931265 3300039437 Bacteria 1125
180 Ga0436363_0378239 3300039450 Bacteria 21783
181 Ga0436363_0765815 3300039450 Bacteria 917
182 Ga0451847_0097449 3300041503 Bacteria 887
183 Ga0451853_0380831 3300041512 Bacteria 871
184 Ga0439464_0166175 3300042439 Bacteria 695
185 Ga0466972_0019417 3300044658 Bacteria 3398
186 Ga0466963_0014477 3300044694 Bacteria 4864
187 Ga0466957_0108606 3300044842 Bacteria 1757
188 Ga0466957_0286448 3300044842 Bacteria 1104
189 Ga0466960_0035801 3300044901 Bacteria 2322
190 Ga0451576_0493391 3300045051 Unclassified 1286
191 Ga0466958_0118892 3300045836 Bacteria 1653
192 Ga0466967_0003760 3300045976 Bacteria 10011
193 Ga0466967_0992086 3300045976 Bacteria 836
194 Ga0495650_0000054 3300046471 Bacteria 313631
195 Ga0495581_0559130 3300047315 Bacteria 664
196 Ga0496101_0315348 3300048904 Bacteria 1226
197 Ga0496102_0104843 3300048905 Bacteria 2630
198 Ga0496103_0409825 3300048906 Bacteria 870
199 Ga0496104_0020218 3300048907 Bacteria 6100
200 Ga0496104_0313915 3300048907 Bacteria 1480
201 Ga0496104_0432071 3300048907 Bacteria 1229
202 Ga0496105_0008994 3300048908 Bacteria 7791
203 Ga0496105_0391208 3300048908 Bacteria 1105
204 Ga0496105_0393278 3300048908 Bacteria 1101
205 Ga0496107_0182353 3300048910 Bacteria 1559
206 Ga0496108_0061875 3300048911 Bacteria 3151
207 Ga0496108_0138537 3300048911 Bacteria 2096
208 Ga0496109_0009337 3300048912 Bacteria 8357
209 Ga0496109_0180145 3300048912 Bacteria 1984
210 Ga0496110_0045801 3300048913 Bacteria 3824
211 Ga0496111_0096533 3300048914 Bacteria 2169
212 Ga0496111_0329584 3300048914 Bacteria 1130
213 Ga0496111_0404693 3300048914 Bacteria 1008
214 Ga0496112_0033127 3300048915 Bacteria 5020
215 Ga0496112_0129698 3300048915 Bacteria 2492
216 Ga0496112_0176476 3300048915 Bacteria 2101
217 Ga0496113_0067005 3300048916 Bacteria 2720
218 Ga0496113_0272137 3300048916 Bacteria 1354
219 Ga0496115_0000228 3300048918 Bacteria 51169
220 Ga0496119_0111616 3300048922 Bacteria 1517
221 Ga0496121_0011370 3300048924 Bacteria 9895
222 Ga0496123_0218800 3300048926 Bacteria 962
223 Ga0501069_0452266 3300049585 Bacteria 763
224 Ga0501081_0012350 3300049743 Bacteria 5610
225 nmdc:mga0yw44_169204_c1 3300050492 Bacteria 1434
226 nmdc:mga05p37_61114_c1 3300050507 Bacteria 4638
227 nmdc:mga0qj67_541216_c1 3300050509 Bacteria 934
228 nmdc:mga06r32_973482_c1 3300050510 Bacteria 802
229 nmdc:mga08y16_1072387_c1 3300050511 Bacteria 782
230 nmdc:mga08y16_47087_c1 3300050511 Bacteria 4514
231 nmdc:mga0n895_17424_c1 3300050512 Bacteria 6619
232 nmdc:mga0rr50_467164_c1 3300050513 Bacteria 1071
233 nmdc:mga08x19_92775_c1 3300050514 Bacteria 1995
234 nmdc:mga0a205_28245_c1 3300050515 Bacteria 5363
235 rootH2_10073735
236 Ga0070680_100391389
237 Ga0070680_100603868
238 Ga0070682_100290523
239 Ga0068868_100616738
240 Ga0070689_100140013
241 Ga0070691_10037557
242 Ga0070668_100102122
243 Ga0070674_100218348
244 Ga0070673_100249272
245 Ga0070659_100114889
246 Ga0070659_100816293
247 Ga0070667_100073246
248 Ga0070714_100536536
249 Ga0070714_101045924
250 Ga0070701_10300325
251 Ga0070711_100339902
252 Ga0070705_100174659
253 Ga0070700_100030465
254 Ga0070700_100031968
255 Ga0070694_100106751
256 Ga0070663_100157694
257 Ga0070678_100066822
258 Ga0070662_100139724
259 Ga0070681_10342390
260 Ga0068867_100400359
261 Ga0068867_100540449
262 Ga0070685_10014072
263 Ga0070707_100152781
264 Ga0070698_100454153
265 Ga0070679_100283784
266 Ga0070679_101050129
267 Ga0070684_100001966
268 Ga0070665_100056592
269 Ga0070704_100719658
270 Ga0068855_100031317
271 Ga0070664_100066567
272 Ga0070664_100296672
273 Ga0068854_100045895
274 Ga0068854_101034635
275 Ga0068856_100023629
276 Ga0068856_100857475
277 Ga0068856_101186289
278 Ga0070702_100042146
279 Ga0068859_100018294
280 Ga0068859_100619160
281 Ga0068859_100951513
282 Ga0068864_100068465
283 Ga0068861_100382164
284 Ga0068870_10107899
285 Ga0068863_101335886
286 Ga0068858_100214010
287 Ga0068860_100199283
288 Ga0068860_100436919
289 Ga0068862_100000198
290 Ga0068862_100000689
291 Ga0068862_100110346
292 Ga0081540_1039550
293 Ga0081540_1113993
294 Ga0075432_10072138
295 Ga0070712_100092002
296 Ga0075431_100606294
297 Ga0075433_10098824
298 Ga0075434_100433282
299 Ga0068865_100012531
300 Ga0097620_100619268
301 Ga0097620_100951354
302 Ga0075435_100032865
303 Ga0111539_10056400
304 Ga0111539_12185592
305 Ga0105245_10020437
306 Ga0105245_10222243
307 Ga0105245_11687145
308 Ga0114129_10660906
309 Ga0105243_10113573
310 Ga0105243_10553706
311 Ga0105243_10615394
312 Ga0105241_10386889
313 Ga0105248_10161812
314 Ga0105237_10001629
315 Ga0105249_10029665
316 Ga0105249_10050163
317 Ga0105239_10002616
318 Ga0105246_10028864
319 Ga0105246_10367835
320 Ga0105246_10743969
321 Ga0157374_10011836
322 Ga0157372_10003197
323 Ga0157372_10730957
324 Ga0157375_10684454
325 Ga0163163_10625519
326 Ga0157380_10082358
327 Ga0157380_10410360
328 Ga0157380_11012628
329 Ga0157377_10001602
330 Ga0157379_10019158
331 Ga0157379_10328531
332 Ga0213874_10005192
333 Ga0213876_10068598
334 Ga0207688_10004242
335 Ga0207647_10325453
336 Ga0207645_10254510
337 Ga0207643_10058487
338 Ga0207654_10215293
339 Ga0207671_10001639
340 Ga0207693_10016442
341 Ga0207663_10465938
342 Ga0207660_10279341
343 Ga0207662_10368415
344 Ga0207652_10316447
345 Ga0207646_10070586
346 Ga0207646_10806381
347 Ga0207681_10867952
348 Ga0207659_11083689
349 Ga0207687_10475916
350 Ga0207687_10884720
351 Ga0207690_10153003
352 Ga0207706_10048160
353 Ga0207706_10056263
354 Ga0207706_10362912
355 Ga0207709_10357355
356 Ga0207709_10369359
357 Ga0207691_10116917
358 Ga0207691_10528412
359 Ga0207689_10043192
360 Ga0207679_10028905
361 Ga0207679_10292379
362 Ga0207679_10766546
363 Ga0207667_10039354
364 Ga0207712_10010804
365 Ga0207668_10025434
366 Ga0207668_10026935
367 Ga0207668_10197444
368 Ga0207658_10009210
369 Ga0207677_10265530
370 Ga0207703_10043428
371 Ga0207678_10174461
372 Ga0207708_10000450
373 Ga0207708_10015078
374 Ga0207708_10096124
375 Ga0207702_10238338
376 Ga0207648_10056091
377 Ga0207675_100354689
378 Ga0207683_10018666
379 Ga0207698_10033920
380 Ga0207428_10091987
381 Ga0268265_10000021
382 Ga0268265_10033189
383 Ga0268265_10670246
384 Ga0268264_10875658
385 Ga0265332_10050251
386 Ga0265314_10061801
387 Ga0307405_10257471
388 Ga0307405_10261844
389 Ga0307413_10136918
390 Ga0307410_10035155
391 Ga0326468_10017304
392 Ga0307407_10356471
393 Ga0307409_100009221
394 Ga0307409_100310319
395 Ga0307409_100665670
396 Ga0307416_100013340
397 Ga0307416_100281890
398 Ga0307414_10214122
399 Ga0307414_10517030
400 Ga0307411_10108315
401 Ga0307415_100005303
402 Ga0395898_0009946
403 Ga0395905_0073207
404 Ga0395905_0482644
405 Ga0395901_0004943
406 Ga0395901_0139212
407 Ga0395901_0178965
408 Ga0395901_0250777
409 Ga0395901_0279184
410 Ga0395901_0468726
411 Ga0436365_0052162
412 Ga0436365_0389229
413 Ga0436365_1931265
414 Ga0436363_0378239
415 Ga0436363_0765815
416 Ga0451847_0097449
417 Ga0451853_0380831
418 Ga0439464_0166175
419 Ga0466972_0019417
420 Ga0466963_0014477
421 Ga0466957_0108606
422 Ga0466957_0286448
423 Ga0466960_0035801
424 Ga0451576_0493391
425 Ga0466958_0118892
426 Ga0466967_0003760
427 Ga0466967_0992086
428 Ga0495650_0000054
429 Ga0495581_0559130
430 Ga0496101_0315348
431 Ga0496102_0104843
432 Ga0496103_0409825
433 Ga0496104_0020218
434 Ga0496104_0313915
435 Ga0496104_0432071
436 Ga0496105_0008994
437 Ga0496105_0391208
438 Ga0496105_0393278
439 Ga0496107_0182353
440 Ga0496108_0061875
441 Ga0496108_0138537
442 Ga0496109_0009337
443 Ga0496109_0180145
444 Ga0496110_0045801
445 Ga0496111_0096533
446 Ga0496111_0329584
447 Ga0496111_0404693
448 Ga0496112_0033127
449 Ga0496112_0129698
450 Ga0496112_0176476
451 Ga0496113_0067005
452 Ga0496113_0272137
453 Ga0496115_0000228
454 Ga0496119_0111616
455 Ga0496121_0011370
456 Ga0496123_0218800
457 Ga0501069_0452266
458 Ga0501081_0012350
459 nmdc:mga0yw44_169204_c1
460 nmdc:mga05p37_61114_c1
461 nmdc:mga0qj67_541216_c1
462 nmdc:mga06r32_973482_c1
463 nmdc:mga08y16_1072387_c1
464 nmdc:mga08y16_47087_c1
465 nmdc:mga0n895_17424_c1
466 nmdc:mga0rr50_467164_c1
467 nmdc:mga08x19_92775_c1
468 nmdc:mga0a205_28245_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

8

103

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kpz-assembly1.cif.gz_A 1.70 a resolution crystal structure of group a streptococcus hupz-v5-his6 0.8263 8 136
7kpz-assembly1.cif.gz_A 1.70 a resolution crystal structure of group a streptococcus hupz-v5-his6 0.7556 8 136
6h00-assembly1.cif.gz_A-2 crystal structure of human pyridoxine 5-phophate oxidase, r116q variant 0.7491 20 102
1wli-assembly1.cif.gz_B l122y mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.7482 14 139
3awh-assembly1.cif.gz_B e13k mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.7434 14 139
ID Description Score Start End Superfamily
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8308 8 138 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8058 8 138 2.30.110.10
af_Q57730_15_149_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7825 8 136 2.30.110.10
6h00A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7491 20 102 2.30.110.10
af_Q2FVN7_2_129_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7274 13 140 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7J9YU07-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9814 1 189
AF-A0A535M2K3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9749 1 190
AF-A0A7W0RD23-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.967 69 190
AF-A0A4R6IZB1-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.962 1 190
AF-A0A7J9YU07-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9612 1 189

Map