F346453

General Info

Members Datasets Scaffolds Average Seq Length
233 197 466 143

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0464852|Ga0496100_0464852_330_824
Length 164
Sequence MMLKGIDPLLGPELLCALRAMGHGDEIAIVDANYPAQAHAKRCLRADGHSATAMLEAILTVLPLDRMVEAPAFRPVPPDRPAHAIHNEFDAIVAAYEPGLPVASLTGQSFYDRVKSAFLILATGERRLYGNIILRKGVIEEDVDAHASVTAKGRHNRQIERLAQ

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
14 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
15 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
16 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
20 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
21 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
22 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
23 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
24 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
25 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
30 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
33 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
34 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
35 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
36 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
37 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
41 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
42 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
43 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
44 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
45 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
46 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
47 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
48 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
49 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
50 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
51 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
55 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
56 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
57 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
58 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
59 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
60 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
61 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
62 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
63 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
64 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
65 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
66 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
67 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
68 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
71 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
93 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
129 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
130 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
131 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
134 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
135 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
136 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
139 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
140 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
141 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
142 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
143 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
144 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
145 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
146 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
147 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
148 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
149 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
150 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
151 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
152 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
153 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
154 2643221591 Devosia sp. Root685 Isolate Unclassified
155 2643221607 Rhizobium sp. Root73 Isolate Unclassified
156 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
157 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
158 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
159 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
160 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
161 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
162 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
163 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
164 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
165 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
166 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
167 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
168 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
169 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
170 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
171 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
172 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
173 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
174 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
175 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
176 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
177 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
178 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
179 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
180 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
181 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
182 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
183 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
184 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
185 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
186 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
187 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
188 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
189 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
190 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
191 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
192 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
193 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
194 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
195 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
196 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
197 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 74.25
Metatranscriptomes 0
Isolates 25.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.44
Nodule 19.74
Rhizoplane 9.87
Rhizosphere 44.64
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0464852 3300048903 Bacteria 971
2 JGI25162J39368_1000691 3300002737 Bacteria 23463
3 JGI25165J46597_1000570 3300003214 Bacteria 33114
4 rootH1_10044912 3300003316 Bacteria 1355
5 rootH2_10012843 3300003320 Bacteria 20638
6 rootH2_10038159 3300003320 Bacteria 4566
7 rootH2_10130214 3300003320 Bacteria 2051
8 rootH1_10088557 3300003323 Bacteria 4769
9 Ga0070658_10014596 3300005327 Bacteria 6304
10 Ga0070658_10113328 3300005327 Bacteria 2248
11 Ga0070670_100000804 3300005331 Bacteria 24410
12 Ga0068869_100065171 3300005334 Bacteria 2681
13 Ga0070661_100414606 3300005344 Bacteria 1067
14 Ga0070667_100131593 3300005367 Bacteria 2184
15 Ga0068853_100774226 3300005539 Bacteria 918
16 Ga0075366_10050086 3300006195 Bacteria 2480
17 Ga0075370_10005704 3300006353 Bacteria 6212
18 Ga0079104_1031135 3300006946 Bacteria 1325
19 Ga0099826_10159108 3300006948 Bacteria 1282
20 Ga0105239_10542400 3300010375 Bacteria 1324
21 Ga0182008_10156788 3300014497 Bacteria 1144
22 Ga0183365_10008 3300015684 Bacteria 74681
23 Ga0213872_10235114 3300021361 Bacteria 776
24 Ga0228711_1001182 3300022739 Bacteria 37363
25 Ga0228710_1000008 3300022740 Bacteria 174306
26 Ga0209437_100056 3300025233 Bacteria 363071
27 Ga0209233_1000071 3300025261 Bacteria 363290
28 Ga0209025_1054791 3300025294 Bacteria 1548
29 Ga0209025_1090841 3300025294 Bacteria 999
30 Ga0207650_10000782 3300025925 Bacteria 24485
31 Ga0207689_10146217 3300025942 Bacteria 1947
32 Ga0207658_10111744 3300025986 Bacteria 2161
33 Ga0209281_1000306 3300027111 Bacteria 87720
34 Ga0209282_1000121 3300027666 Bacteria 49713
35 Ga0307515_10000029 3300028794 Bacteria 365410
36 Ga0307515_10001776 3300028794 Bacteria 48034
37 Ga0307515_10003164 3300028794 Bacteria 34834
38 Ga0265330_10062555 3300031235 Bacteria 1618
39 Ga0265330_10081277 3300031235 Bacteria 1396
40 Ga0265325_10061237 3300031241 Bacteria 1909
41 Ga0265325_10128961 3300031241 Bacteria 1213
42 Ga0265340_10162763 3300031247 Bacteria 1013
43 Ga0265339_10029854 3300031249 Bacteria 3090
44 Ga0265331_10032929 3300031250 Bacteria 2565
45 Ga0265316_10110310 3300031344 Bacteria 2084
46 Ga0265316_10156103 3300031344 Bacteria 1708
47 Ga0265316_10747521 3300031344 Bacteria 688
48 Ga0307513_10059335 3300031456 Bacteria 4061
49 Ga0307408_100196950 3300031548 Bacteria 1627
50 Ga0307408_101547113 3300031548 Bacteria 628
51 Ga0265313_10236044 3300031595 Bacteria 750
52 Ga0265314_10047505 3300031711 Bacteria 3020
53 Ga0265314_10174084 3300031711 Bacteria 1296
54 Ga0265314_10437729 3300031711 Bacteria 699
55 Ga0265342_10297529 3300031712 Bacteria 851
56 Ga0307412_10056445 3300031911 Bacteria 2617
57 Ga0315914_1000754 3300031967 Bacteria 43901
58 Ga0307414_10475138 3300032004 Bacteria 1101
59 Ga0315913_1000195 3300033430 Bacteria 44144
60 Ga0315915_1000247 3300033464 Bacteria 49711
61 Ga0373935_0198389 3300035692 Bacteria 1386
62 Ga0373927_0006032 3300035695 Bacteria 8301
63 Ga0373937_0230618 3300036401 Bacteria 1744
64 Ga0373925_0013378 3300037068 Bacteria 5938
65 Ga0395900_1757163 3300037418 Bacteria 531
66 Ga0395905_0001768 3300037471 Bacteria 25105
67 Ga0395905_0075179 3300037471 Bacteria 3166
68 Ga0400483_175737 3300039062 Bacteria 1479
69 Ga0436360_0930916 3300039438 Bacteria 647
70 Ga0436361_1050540 3300039447 Bacteria 6102
71 Ga0436363_0184174 3300039450 Bacteria 8586
72 Ga0436363_1384368 3300039450 Bacteria 804
73 Ga0439436_0003404 3300041404 Bacteria 4827
74 Ga0439465_0009935 3300041413 Bacteria 2997
75 Ga0451787_005620 3300041441 Bacteria 507
76 Ga0451797_0273708 3300041453 Bacteria 552
77 Ga0451837_0495496 3300041494 Bacteria 882
78 Ga0451849_0337198 3300041505 Bacteria 960
79 Ga0439449_0024260 3300042007 Bacteria 2268
80 Ga0450922_028294 3300042124 Bacteria 603
81 Ga0450907_031361 3300042146 Bacteria 904
82 Ga0439434_0016593 3300042435 Bacteria 2201
83 Ga0466961_0796970 3300044693 Unclassified 564
84 Ga0466963_0275328 3300044694 Bacteria 1183
85 Ga0466964_0482442 3300044706 Bacteria 663
86 Ga0466968_0607715 3300044735 Bacteria 553
87 Ga0466959_0399370 3300045049 Archaea 934
88 Ga0451576_1211660 3300045051 Bacteria 788
89 Ga0495592_0053052 3300046454 Bacteria 3008
90 Ga0495629_0018906 3300046459 Bacteria 4925
91 Ga0495638_0337056 3300046460 Bacteria 800
92 Ga0495651_0133072 3300046462 Bacteria 1813
93 Ga0495653_0542930 3300046463 Bacteria 720
94 Ga0495650_0056694 3300046471 Bacteria 1589
95 Ga0495582_0217905 3300046473 Bacteria 1092
96 Ga0495664_0670857 3300046477 Bacteria 614
97 Ga0495585_0498296 3300046492 Bacteria 579
98 Ga0495606_0001403 3300046507 Bacteria 32404
99 Ga0495606_0085984 3300046507 Bacteria 1944
100 Ga0495606_0348369 3300046507 Bacteria 787
101 Ga0495643_0152629 3300046522 Bacteria 1142
102 Ga0495587_0323410 3300046536 Bacteria 861
103 Ga0495667_0151006 3300046559 Bacteria 1496
104 Ga0495634_0175068 3300046642 Bacteria 1347
105 Ga0495625_0152668 3300046660 Bacteria 1552
106 Ga0495635_0165396 3300046663 Bacteria 1505
107 Ga0495588_0034678 3300046674 Bacteria 2554
108 Ga0495657_0135577 3300046675 Bacteria 1538
109 Ga0495599_0687203 3300046678 Bacteria 591
110 Ga0495646_0399214 3300046680 Bacteria 715
111 Ga0495658_0014577 3300046683 Bacteria 4020
112 Ga0495624_0047297 3300046690 Bacteria 2734
113 Ga0495600_0094470 3300046809 Bacteria 1950
114 Ga0495600_0193679 3300046809 Bacteria 1306
115 Ga0495604_0021862 3300047317 Bacteria 5106
116 Ga0495675_0098179 3300047444 Bacteria 1835
117 Ga0495686_0003455 3300047472 Bacteria 13690
118 Ga0495686_0020873 3300047472 Bacteria 4364
119 Ga0495686_0048383 3300047472 Bacteria 2681
120 Ga0496101_0027868 3300048904 Bacteria 3940
121 Ga0496104_0005747 3300048907 Bacteria 10856
122 Ga0496104_0037086 3300048907 Bacteria 4558
123 Ga0496104_0043632 3300048907 Bacteria 4211
124 Ga0496104_0078213 3300048907 Bacteria 3152
125 Ga0496105_0005244 3300048908 Bacteria 9822
126 Ga0496105_0021899 3300048908 Bacteria 5173
127 Ga0496107_0652452 3300048910 Bacteria 776
128 Ga0496109_0601859 3300048912 Bacteria 1035
129 Ga0496110_0044962 3300048913 Bacteria 3857
130 Ga0496110_0596576 3300048913 Bacteria 1002
131 Ga0496111_0076538 3300048914 Bacteria 2439
132 Ga0496112_0022401 3300048915 Bacteria 6021
133 Ga0496113_0016520 3300048916 Bacteria 5101
134 Ga0496114_0047460 3300048917 Bacteria 3572
135 Ga0496114_0290120 3300048917 Bacteria 1443
136 Ga0496114_0404484 3300048917 Bacteria 1209
137 Ga0496115_0237171 3300048918 Unclassified 1503
138 Ga0496115_0955773 3300048918 Bacteria 657
139 Ga0496116_0031124 3300048919 Bacteria 3826
140 Ga0496119_0000198 3300048922 Bacteria 84746
141 Ga0496119_0402063 3300048922 Bacteria 653
142 Ga0496123_0359078 3300048926 Bacteria 675
143 Ga0496123_0364379 3300048926 Bacteria 668
144 Ga0496124_0148075 3300048927 Bacteria 1845
145 Ga0496124_0216336 3300048927 Bacteria 1445
146 Ga0496125_0000279 3300048928 Bacteria 102551
147 Ga0496125_0074704 3300048928 Bacteria 2627
148 Ga0496126_0296789 3300048929 Bacteria 1335
149 Ga0495682_0209611 3300049460 Bacteria 691
150 Ga0501034_0447558 3300049571 Bacteria 1210
151 Ga0501034_1006829 3300049571 Unclassified 717
152 Ga0501036_1428211 3300049572 Unclassified 561
153 Ga0501080_0167378 3300049742 Bacteria 2028
154 Ga0501035_0400055 3300049822 Bacteria 1143
155 Ga0501045_0452244 3300049824 Bacteria 955
156 nmdc:mga00v17_241068_c1 3300050491 Bacteria 1172
157 nmdc:mga0k408_45733_c1 3300050493 Bacteria 2526
158 Ga0495601_0194910 3300053077 Bacteria 1324
159 Ga0495619_0044994 3300053085 Bacteria 2899
160 Ga0495619_0144591 3300053085 Bacteria 1639
161 Ga0500644_0008519 3300053088 Bacteria 2710
162 Ga0500556_0081382 3300053104 Bacteria 1225
163 Ga0500595_115816 3300053119 Bacteria 759
164 Ga0500608_255319 3300053122 Bacteria 681
165 Ga0500618_011529 3300053125 Bacteria 2342
166 Ga0500618_071271 3300053125 Bacteria 779
167 Ga0500559_0088159 3300053136 Bacteria 1418
168 Ga0500559_0096754 3300053136 Bacteria 1356
169 Ga0500590_100776 3300053148 Bacteria 1387
170 Ga0500622_0000117 3300053156 Bacteria 82720
171 Ga0500627_0027760 3300053158 Bacteria 2346
172 Ga0500565_004142 3300053734 Bacteria 1206
173 Ga0501084_1513660 3300054114 Bacteria 561
174 2511134683 2510917022 Bacteria 6504556
175 2512531731 2512047086 Bacteria 6850303
176 2512972970 2512875026 Bacteria 6861065
177 2513604448 2513237089 Bacteria 6553624
178 2513986783 2513237156 Bacteria 6402557
179 2513996529 2513237159 Bacteria 6810126
180 2514007147 2513237160 Bacteria 6650282
181 2517568413 2517487022 Bacteria 7227575
182 2561469314 2558860983 Bacteria 4133860
183 2585164679 2582581283 Bacteria 6030556
184 2585273764 2582581307 Bacteria 6597605
185 2585392148 2582581866 Bacteria 6859583
186 2585559938 2585427531 Bacteria 6992870
187 2585900614 2585427608 Bacteria 6544331
188 2585905883 2585427609 Bacteria 6667127
189 2587979002 2585428125 Bacteria 6662905
190 2643965783 2643221591 Bacteria 4397626
191 2644047452 2643221607 Bacteria 6314006
192 2644199870 2643221636 Bacteria 6583769
193 2644480241 2643221686 Bacteria 6310811
194 2778177129 2775507266 Bacteria 7392367
195 2802718538 2802428858 Bacteria 6636079
196 2802724219 2802428859 Bacteria 6667919
197 2802730120 2802428860 Bacteria 6525526
198 2802737462 2802428861 Bacteria 6534206
199 2802742378 2802428862 Bacteria 6633353
200 2802749061 2802428863 Bacteria 6410669
201 2837653823 2837651117 Bacteria 3772164
202 2842521455 2842521101 Bacteria 6569494
203 2842923081 2842922631 Bacteria 5824079
204 2882458156 2882456835 Bacteria 6863978
205 2902796739 2902792274 Bacteria 7270173
206 2915986461 2915980308 Bacteria 6624279
207 2916065201 2916061851 Bacteria 6737736
208 2921252691 2921250672 Bacteria 6677771
209 2937031554 2937029754 Bacteria 6424026
210 2937037761 2937036028 Bacteria 6846469
211 2937083276 2937078374 Bacteria 6610289
212 2937088776 2937084907 Bacteria 6618516
213 2957377752 2957375807 Bacteria 6425588
214 2957438885 2957437181 Bacteria 6568994
215 2960593399 2960591022 Bacteria 6622873
216 2960637187 2960631154 Bacteria 6732508
217 2960684437 2960680706 Bacteria 6624464
218 2960698590 2960693952 Bacteria 6749742
219 2967690373 2967686174 Bacteria 6678622
220 2967730339 2967728569 Bacteria 6641507
221 2970027287 2970026789 Bacteria 6785236
222 2970125237 2970122695 Bacteria 6625855
223 2970144229 2970143518 Bacteria 6446480
224 2977531131 2977530762 Bacteria 6951399
225 2977545874 2977544691 Bacteria 6875412
226 641336614 641228493 Bacteria 3999591
227 643390405 643348555 Bacteria 3914947
228 8003999494 8003999396 Bacteria 7063185
229 8005661772 8005658619 Bacteria 4500593
230 8018150606 8018150411 Bacteria 5549903
231 8024491591 8024486573 Bacteria 6540512
232 8054006673 8054002106 Bacteria 7987183
233 8055433132 8055431914 Bacteria 4551896
234 Ga0496100_0464852
235 JGI25162J39368_1000691
236 JGI25165J46597_1000570
237 rootH1_10044912
238 rootH2_10012843
239 rootH2_10038159
240 rootH2_10130214
241 rootH1_10088557
242 Ga0070658_10014596
243 Ga0070658_10113328
244 Ga0070670_100000804
245 Ga0068869_100065171
246 Ga0070661_100414606
247 Ga0070667_100131593
248 Ga0068853_100774226
249 Ga0075366_10050086
250 Ga0075370_10005704
251 Ga0079104_1031135
252 Ga0099826_10159108
253 Ga0105239_10542400
254 Ga0182008_10156788
255 Ga0183365_10008
256 Ga0213872_10235114
257 Ga0228711_1001182
258 Ga0228710_1000008
259 Ga0209437_100056
260 Ga0209233_1000071
261 Ga0209025_1054791
262 Ga0209025_1090841
263 Ga0207650_10000782
264 Ga0207689_10146217
265 Ga0207658_10111744
266 Ga0209281_1000306
267 Ga0209282_1000121
268 Ga0307515_10000029
269 Ga0307515_10001776
270 Ga0307515_10003164
271 Ga0265330_10062555
272 Ga0265330_10081277
273 Ga0265325_10061237
274 Ga0265325_10128961
275 Ga0265340_10162763
276 Ga0265339_10029854
277 Ga0265331_10032929
278 Ga0265316_10110310
279 Ga0265316_10156103
280 Ga0265316_10747521
281 Ga0307513_10059335
282 Ga0307408_100196950
283 Ga0307408_101547113
284 Ga0265313_10236044
285 Ga0265314_10047505
286 Ga0265314_10174084
287 Ga0265314_10437729
288 Ga0265342_10297529
289 Ga0307412_10056445
290 Ga0315914_1000754
291 Ga0307414_10475138
292 Ga0315913_1000195
293 Ga0315915_1000247
294 Ga0373935_0198389
295 Ga0373927_0006032
296 Ga0373937_0230618
297 Ga0373925_0013378
298 Ga0395900_1757163
299 Ga0395905_0001768
300 Ga0395905_0075179
301 Ga0400483_175737
302 Ga0436360_0930916
303 Ga0436361_1050540
304 Ga0436363_0184174
305 Ga0436363_1384368
306 Ga0439436_0003404
307 Ga0439465_0009935
308 Ga0451787_005620
309 Ga0451797_0273708
310 Ga0451837_0495496
311 Ga0451849_0337198
312 Ga0439449_0024260
313 Ga0450922_028294
314 Ga0450907_031361
315 Ga0439434_0016593
316 Ga0466961_0796970
317 Ga0466963_0275328
318 Ga0466964_0482442
319 Ga0466968_0607715
320 Ga0466959_0399370
321 Ga0451576_1211660
322 Ga0495592_0053052
323 Ga0495629_0018906
324 Ga0495638_0337056
325 Ga0495651_0133072
326 Ga0495653_0542930
327 Ga0495650_0056694
328 Ga0495582_0217905
329 Ga0495664_0670857
330 Ga0495585_0498296
331 Ga0495606_0001403
332 Ga0495606_0085984
333 Ga0495606_0348369
334 Ga0495643_0152629
335 Ga0495587_0323410
336 Ga0495667_0151006
337 Ga0495634_0175068
338 Ga0495625_0152668
339 Ga0495635_0165396
340 Ga0495588_0034678
341 Ga0495657_0135577
342 Ga0495599_0687203
343 Ga0495646_0399214
344 Ga0495658_0014577
345 Ga0495624_0047297
346 Ga0495600_0094470
347 Ga0495600_0193679
348 Ga0495604_0021862
349 Ga0495675_0098179
350 Ga0495686_0003455
351 Ga0495686_0020873
352 Ga0495686_0048383
353 Ga0496101_0027868
354 Ga0496104_0005747
355 Ga0496104_0037086
356 Ga0496104_0043632
357 Ga0496104_0078213
358 Ga0496105_0005244
359 Ga0496105_0021899
360 Ga0496107_0652452
361 Ga0496109_0601859
362 Ga0496110_0044962
363 Ga0496110_0596576
364 Ga0496111_0076538
365 Ga0496112_0022401
366 Ga0496113_0016520
367 Ga0496114_0047460
368 Ga0496114_0290120
369 Ga0496114_0404484
370 Ga0496115_0237171
371 Ga0496115_0955773
372 Ga0496116_0031124
373 Ga0496119_0000198
374 Ga0496119_0402063
375 Ga0496123_0359078
376 Ga0496123_0364379
377 Ga0496124_0148075
378 Ga0496124_0216336
379 Ga0496125_0000279
380 Ga0496125_0074704
381 Ga0496126_0296789
382 Ga0495682_0209611
383 Ga0501034_0447558
384 Ga0501034_1006829
385 Ga0501036_1428211
386 Ga0501080_0167378
387 Ga0501035_0400055
388 Ga0501045_0452244
389 nmdc:mga00v17_241068_c1
390 nmdc:mga0k408_45733_c1
391 Ga0495601_0194910
392 Ga0495619_0044994
393 Ga0495619_0144591
394 Ga0500644_0008519
395 Ga0500556_0081382
396 Ga0500595_115816
397 Ga0500608_255319
398 Ga0500618_011529
399 Ga0500618_071271
400 Ga0500559_0088159
401 Ga0500559_0096754
402 Ga0500590_100776
403 Ga0500622_0000117
404 Ga0500627_0027760
405 Ga0500565_004142
406 Ga0501084_1513660
407 2511134683
408 2512531731
409 2512972970
410 2513604448
411 2513986783
412 2513996529
413 2514007147
414 2517568413
415 2561469314
416 2585164679
417 2585273764
418 2585392148
419 2585559938
420 2585900614
421 2585905883
422 2587979002
423 2643965783
424 2644047452
425 2644199870
426 2644480241
427 2778177129
428 2802718538
429 2802724219
430 2802730120
431 2802737462
432 2802742378
433 2802749061
434 2837653823
435 2842521455
436 2842923081
437 2882458156
438 2902796739
439 2915986461
440 2916065201
441 2921252691
442 2937031554
443 2937037761
444 2937083276
445 2937088776
446 2957377752
447 2957438885
448 2960593399
449 2960637187
450 2960684437
451 2960698590
452 2967690373
453 2967730339
454 2970027287
455 2970125237
456 2970144229
457 2977531131
458 2977545874
459 641336614
460 643390405
461 8003999494
462 8005661772
463 8018150606
464 8024491591
465 8054006673
466 8055433132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05025

RbsD_FucU

RbsD / FucU transport protein family

4

139

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ob5-assembly1.cif.gz_A-2 crystal structure of protein atu2016, putative sugar binding protein 0.9501 1 141
3mvk-assembly1.cif.gz_G the crystal structure of fucu from bifidobacterium longum to 1.65a 0.9328 3 141
3mvk-assembly5.cif.gz_D the crystal structure of fucu from bifidobacterium longum to 1.65a 0.9297 5 141
2wcu-assembly1.cif.gz_B crystal structure of mammalian fucu 0.9257 1 141
2ob5-assembly1.cif.gz_A-2 crystal structure of protein atu2016, putative sugar binding protein 0.9247 1 141
ID Description Score Start End Superfamily
af_D4ACG8_1_149_3.40.1650.10 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.9262 1 141 3.40.1650.10
4a34B01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.9217 10 138 3.40.1650.10
2wcvA01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.9149 10 138 3.40.1650.10
4a34B01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.9148 10 138 3.40.1650.10
2ob5A00 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.914 1 141 3.40.1650.10
ID Description Score Start End GO Terms
AF-A0A526V3P6-F1-model_v4 Transporter 0.992 46 142 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193
AF-A0A530R8N4-F1-model_v4 D-ribose pyranase (EC 5.4.99.62) 0.991 57 142 GO:0005996
GO:0048029
GO:0062193
AF-A0A087N938-F1-model_v4 Uncharacterized protein 0.9882 20 144 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193
AF-A0A4S1G652-F1-model_v4 Transporter 0.9871 28 144 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193
AF-A0A1G3FWD7-F1-model_v4 Transporter 0.9864 1 142 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193

Map