F346432

General Info

Members Datasets Scaffolds Average Seq Length
233 148 466 148

Family's Representative Sequence

Representative Sequence 3300046664|Ga0495659_0160976|Ga0495659_0160976_318_767
Length 139
Sequence MAHLTVNGQSHDIDVDPSTPLLWVLREQVGLTGTKYGCGIAQCGACTVHVDGMAMRSCSMPVSTVEGKQITTIEGLAQSGTLHKVQQAWIAHDVPQCGYCQSGMIMAVAALLKEANITNICRCGTYQQVRAAIHAAANA

Samples

Sample ID Description Type Environment
1 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
55 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
56 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
57 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
58 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
72 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
75 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
76 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
77 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
78 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
79 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
80 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
81 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
82 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
83 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
86 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
94 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
104 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
105 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
141 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
147 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
148 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 1.29
Isolates 0.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 13.3
Rhizosphere 81.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495659_0160976 3300046664 Bacteria 906
2 JGI25153J46596_10006132 3300003215 Bacteria 6161
3 Ga0070674_101329951 3300005356 Bacteria 641
4 Ga0070709_10055198 3300005434 Bacteria 2507
5 Ga0070709_10925301 3300005434 Bacteria 690
6 Ga0070714_100016245 3300005435 Bacteria 6003
7 Ga0070714_100883453 3300005435 Bacteria 867
8 Ga0070713_100408884 3300005436 Bacteria 1268
9 Ga0070710_10131827 3300005437 Bacteria 1524
10 Ga0070710_10321609 3300005437 Bacteria 1016
11 Ga0070711_100515522 3300005439 Bacteria 987
12 Ga0070711_100573141 3300005439 Bacteria 939
13 Ga0070678_100427755 3300005456 Bacteria 1155
14 Ga0068867_100021394 3300005459 Bacteria 4615
15 Ga0070706_100035140 3300005467 Bacteria 4628
16 Ga0070706_100078520 3300005467 Bacteria 3056
17 Ga0070706_100618694 3300005467 Bacteria 1006
18 Ga0070707_100071057 3300005468 Bacteria 3353
19 Ga0070698_100016484 3300005471 Bacteria 7796
20 Ga0070698_100053090 3300005471 Bacteria 4120
21 Ga0070699_100366805 3300005518 Bacteria 1299
22 Ga0070699_101493311 3300005518 Bacteria 620
23 Ga0070697_100028284 3300005536 Bacteria 4488
24 Ga0070704_100060055 3300005549 Bacteria 2715
25 Ga0068856_100072863 3300005614 Bacteria 3401
26 Ga0068852_101868375 3300005616 Bacteria 623
27 Ga0068866_10018196 3300005718 Bacteria 3173
28 Ga0068861_100228554 3300005719 Bacteria 1576
29 Ga0081455_10171357 3300005937 Bacteria 1653
30 Ga0081455_10175907 3300005937 Bacteria 1625
31 Ga0081455_10366723 3300005937 Bacteria 1011
32 Ga0081539_10000008 3300005985 Bacteria 525071
33 Ga0070717_10121075 3300006028 Bacteria 2242
34 Ga0070712_100265304 3300006175 Bacteria 1377
35 Ga0075428_100012475 3300006844 Bacteria 9451
36 Ga0075428_100547723 3300006844 Bacteria 1237
37 Ga0075428_100743866 3300006844 Bacteria 1043
38 Ga0075428_100881015 3300006844 Bacteria 950
39 Ga0075430_100086989 3300006846 Bacteria 2615
40 Ga0075431_100041732 3300006847 Bacteria 4731
41 Ga0075431_100658922 3300006847 Bacteria 1027
42 Ga0075431_100666810 3300006847 Bacteria 1020
43 Ga0075431_100821644 3300006847 Bacteria 902
44 Ga0075431_100916027 3300006847 Bacteria 846
45 Ga0075433_10206580 3300006852 Bacteria 1746
46 Ga0075433_11109106 3300006852 Bacteria 688
47 Ga0075434_100740544 3300006871 Bacteria 1000
48 Ga0075434_101068274 3300006871 Bacteria 821
49 Ga0075429_100029383 3300006880 Bacteria 4774
50 Ga0075429_100511735 3300006880 Bacteria 1052
51 Ga0068865_100800835 3300006881 Bacteria 813
52 Ga0099794_10098280 3300007265 Bacteria 1459
53 Ga0099795_10015611 3300007788 Bacteria 2384
54 Ga0099795_10094409 3300007788 Bacteria 1164
55 Ga0099795_10224289 3300007788 Bacteria 801
56 Ga0111539_10008515 3300009094 Bacteria 13033
57 Ga0114129_10012532 3300009147 Bacteria 12074
58 Ga0114129_10092872 3300009147 Bacteria 4181
59 Ga0114129_10105767 3300009147 Bacteria 3888
60 Ga0114129_11023374 3300009147 Bacteria 1039
61 Ga0114129_11891469 3300009147 Bacteria 724
62 Ga0099796_10162948 3300010159 Bacteria 885
63 Ga0157373_10440896 3300013100 Bacteria 936
64 Ga0157380_10741880 3300014326 Bacteria 992
65 Ga0157379_10050739 3300014968 Bacteria 3704
66 Ga0206356_10030355 3300020070 Bacteria 623
67 Ga0209758_1005137 3300025297 Bacteria 10331
68 Ga0207692_10178842 3300025898 Bacteria 1234
69 Ga0207692_10200626 3300025898 Bacteria 1172
70 Ga0207699_10112153 3300025906 Bacteria 1749
71 Ga0207684_10022391 3300025910 Bacteria 5392
72 Ga0207684_10023561 3300025910 Bacteria 5256
73 Ga0207684_10841465 3300025910 Bacteria 774
74 Ga0207684_10932977 3300025910 Bacteria 728
75 Ga0207693_10180690 3300025915 Bacteria 1660
76 Ga0207693_11245439 3300025915 Bacteria 559
77 Ga0207663_10609495 3300025916 Bacteria 858
78 Ga0207646_10258138 3300025922 Bacteria 1575
79 Ga0207664_10002586 3300025929 Bacteria 11979
80 Ga0207664_10482391 3300025929 Bacteria 1109
81 Ga0209968_1009502 3300027526 Bacteria 1488
82 Ga0209971_1067897 3300027682 Bacteria 865
83 Ga0209974_10024173 3300027876 Bacteria 2010
84 Ga0207428_10107319 3300027907 Bacteria 2151
85 Ga0307411_10138008 3300032005 Bacteria 1794
86 Ga0373948_0090061 3300034817 Bacteria 711
87 Ga0373929_0045281 3300035085 Bacteria 991
88 Ga0373949_0134791 3300035090 Bacteria 703
89 Ga0373941_0149629 3300035115 Bacteria 855
90 Ga0373931_0754929 3300035691 Bacteria 646
91 Ga0395899_0017015 3300037312 Bacteria 5541
92 Ga0395900_0003092 3300037418 Bacteria 18074
93 Ga0395898_0009202 3300037466 Bacteria 10398
94 Ga0395901_0001902 3300038443 Bacteria 21558
95 Ga0395901_0592475 3300038443 Bacteria 1119
96 Ga0436365_0398286 3300039437 Bacteria 872
97 Ga0436365_0429560 3300039437 Bacteria 1087
98 Ga0436365_1832566 3300039437 Bacteria 750
99 Ga0436361_0646020 3300039447 Bacteria 688
100 Ga0466966_0071580 3300044684 Bacteria 2172
101 Ga0466963_0520957 3300044694 Bacteria 839
102 Ga0466968_0183433 3300044735 Bacteria 974
103 Ga0466957_0016922 3300044842 Bacteria 4267
104 Ga0466959_0320035 3300045049 Bacteria 1060
105 Ga0466958_0047824 3300045836 Bacteria 2583
106 Ga0495590_0227619 3300046457 Bacteria 690
107 Ga0495591_133338 3300046458 Bacteria 602
108 Ga0495638_0362968 3300046460 Bacteria 761
109 Ga0495584_0012608 3300046491 Bacteria 4316
110 Ga0495584_0166306 3300046491 Bacteria 1121
111 Ga0495644_0182810 3300046523 Bacteria 806
112 Ga0495648_0398949 3300046524 Bacteria 615
113 Ga0495598_0444854 3300046537 Bacteria 512
114 Ga0495656_0016412 3300046615 Bacteria 2809
115 Ga0495611_0103104 3300046648 Bacteria 1326
116 Ga0495659_0053753 3300046664 Bacteria 1472
117 Ga0495659_0136181 3300046664 Bacteria 977
118 Ga0495599_0159397 3300046678 Bacteria 1395
119 Ga0495623_0552611 3300046679 Bacteria 602
120 Ga0495670_0189575 3300046691 Bacteria 1087
121 Ga0495671_0444784 3300046692 Bacteria 620
122 Ga0495600_0090850 3300046809 Bacteria 1992
123 Ga0495684_0701490 3300047471 Bacteria 671
124 Ga0495615_0108066 3300048090 Bacteria 793
125 Ga0496100_0995650 3300048903 Bacteria 659
126 Ga0496101_0018415 3300048904 Bacteria 4749
127 Ga0496101_0156793 3300048904 Bacteria 1744
128 Ga0496102_0067058 3300048905 Bacteria 3291
129 Ga0496102_0457875 3300048905 Bacteria 1196
130 Ga0496103_0484618 3300048906 Bacteria 792
131 Ga0496104_0008255 3300048907 Bacteria 9246
132 Ga0496104_0115412 3300048907 Bacteria 2576
133 Ga0496104_0139631 3300048907 Bacteria 2328
134 Ga0496105_0014972 3300048908 Bacteria 6173
135 Ga0496105_0274661 3300048908 Bacteria 1360
136 Ga0496106_0173455 3300048909 Bacteria 1710
137 Ga0496107_0114943 3300048910 Bacteria 1980
138 Ga0496108_0040934 3300048911 Bacteria 3865
139 Ga0496108_0096718 3300048911 Bacteria 2515
140 Ga0496109_0101710 3300048912 Bacteria 2667
141 Ga0496109_0119867 3300048912 Bacteria 2450
142 Ga0496109_0137026 3300048912 Bacteria 2288
143 Ga0496110_0044576 3300048913 Bacteria 3873
144 Ga0496110_0093237 3300048913 Bacteria 2695
145 Ga0496110_0273966 3300048913 Bacteria 1536
146 Ga0496111_0088210 3300048914 Bacteria 2271
147 Ga0496112_0012054 3300048915 Bacteria 7931
148 Ga0496112_0079372 3300048915 Bacteria 3246
149 Ga0496112_1224605 3300048915 Bacteria 667
150 Ga0496113_0049373 3300048916 Bacteria 3133
151 Ga0496113_0138110 3300048916 Bacteria 1916
152 Ga0496114_0698680 3300048917 Bacteria 889
153 Ga0496115_0036807 3300048918 Bacteria 3876
154 Ga0496115_0196667 3300048918 Bacteria 1666
155 Ga0496115_0595407 3300048918 Bacteria 879
156 Ga0496117_0060552 3300048920 Bacteria 2608
157 Ga0496118_0023400 3300048921 Bacteria 5367
158 Ga0496120_0127925 3300048923 Bacteria 1305
159 Ga0496121_0017920 3300048924 Bacteria 7184
160 Ga0501318_025905 3300049534 Bacteria 771
161 Ga0501031_0307616 3300049568 Bacteria 1027
162 Ga0501033_0646908 3300049570 Bacteria 722
163 Ga0501036_1268252 3300049572 Bacteria 599
164 Ga0501037_0543656 3300049573 Bacteria 785
165 Ga0501039_0049010 3300049575 Bacteria 3265
166 Ga0501039_0402410 3300049575 Bacteria 1075
167 Ga0501039_1382961 3300049575 Bacteria 542
168 Ga0501040_0167450 3300049576 Bacteria 1555
169 Ga0501040_0212838 3300049576 Bacteria 1374
170 Ga0501041_0267872 3300049577 Bacteria 1074
171 Ga0501042_0109520 3300049578 Bacteria 1989
172 Ga0501042_0259797 3300049578 Bacteria 1254
173 Ga0501046_0292462 3300049580 Bacteria 1191
174 Ga0501048_0140000 3300049582 Bacteria 1711
175 Ga0501048_0966163 3300049582 Bacteria 613
176 Ga0501067_0726357 3300049583 Bacteria 559
177 Ga0501071_0183770 3300049587 Bacteria 1567
178 Ga0501071_0694286 3300049587 Bacteria 783
179 Ga0501072_0033148 3300049588 Bacteria 4047
180 Ga0501072_0181332 3300049588 Bacteria 1679
181 Ga0501072_0845094 3300049588 Bacteria 716
182 Ga0501073_1048532 3300049589 Bacteria 561
183 Ga0501074_0171181 3300049590 Bacteria 1550
184 Ga0501075_0180974 3300049591 Bacteria 1608
185 Ga0501075_0364502 3300049591 Bacteria 1101
186 Ga0501075_0749800 3300049591 Bacteria 743
187 Ga0501076_0856097 3300049592 Bacteria 750
188 Ga0501077_0050112 3300049593 Bacteria 2654
189 Ga0501077_0083351 3300049593 Bacteria 2026
190 Ga0501079_0034785 3300049741 Bacteria 3877
191 Ga0501079_0231469 3300049741 Bacteria 1443
192 Ga0501079_1391463 3300049741 Bacteria 552
193 Ga0501081_0023050 3300049743 Bacteria 4170
194 Ga0501081_0101023 3300049743 Bacteria 2039
195 Ga0501081_0160228 3300049743 Bacteria 1621
196 Ga0501083_0246616 3300049744 Bacteria 1163
197 Ga0501083_0265242 3300049744 Bacteria 1117
198 Ga0501035_0354952 3300049822 Bacteria 1226
199 Ga0501044_0642714 3300049823 Bacteria 951
200 Ga0501045_0354896 3300049824 Bacteria 1091
201 nmdc:mga05p37_1746858_c1 3300050507 Bacteria 604
202 nmdc:mga05p37_216528_c1 3300050507 Bacteria 2313
203 nmdc:mga05p37_353138_c1 3300050507 Bacteria 1731
204 nmdc:mga05p37_80925_c1 3300050507 Bacteria 4001
205 nmdc:mga09592_232807_c2 3300050508 Bacteria 575
206 nmdc:mga09592_36097_c1 3300050508 Bacteria 4140
207 nmdc:mga09592_491886_c1 3300050508 Bacteria 1056
208 nmdc:mga0qj67_17701_c1 3300050509 Bacteria 5422
209 nmdc:mga06r32_1014405_c1 3300050510 Bacteria 782
210 nmdc:mga06r32_298786_c1 3300050510 Bacteria 1596
211 nmdc:mga06r32_535848_c1 3300050510 Bacteria 1146
212 nmdc:mga06r32_549178_c1 3300050510 Bacteria 1129
213 nmdc:mga08y16_12280_c1 3300050511 Bacteria 9004
214 nmdc:mga0n895_1468910_c1 3300050512 Bacteria 649
215 nmdc:mga0n895_2139168_c1 3300050512 Bacteria 516
216 nmdc:mga0n895_756454_c1 3300050512 Bacteria 964
217 nmdc:mga08x19_840285_c1 3300050514 Bacteria 652
218 nmdc:mga0a205_266007_c1 3300050515 Bacteria 1592
219 Ga0495655_0177110 3300053083 Bacteria 686
220 Ga0495595_0089053 3300053084 Bacteria 1479
221 Ga0500616_0002075 3300053153 Bacteria 17550
222 Ga0501084_0082185 3300054114 Bacteria 2703
223 Ga0501084_0125136 3300054114 Bacteria 2163
224 Ga0501084_0252710 3300054114 Bacteria 1488
225 Ga0501084_1115005 3300054114 Bacteria 662
226 Ga0587083_0126679 3300059505 Bacteria 666
227 Ga0501082_0131078 3300060353 Bacteria 2175
228 Ga0501082_0603431 3300060353 Bacteria 960
229 Ga0530510_0006100 3300061734 Bacteria 8369
230 Ga0530510_0029225 3300061734 Bacteria 3955
231 Ga0530510_0499803 3300061734 Bacteria 922
232 2891090505 2891088606 Bacteria 4762464
233 3005588265 3005587118 Bacteria 7794411
234 Ga0495659_0160976
235 JGI25153J46596_10006132
236 Ga0070674_101329951
237 Ga0070709_10055198
238 Ga0070709_10925301
239 Ga0070714_100016245
240 Ga0070714_100883453
241 Ga0070713_100408884
242 Ga0070710_10131827
243 Ga0070710_10321609
244 Ga0070711_100515522
245 Ga0070711_100573141
246 Ga0070678_100427755
247 Ga0068867_100021394
248 Ga0070706_100035140
249 Ga0070706_100078520
250 Ga0070706_100618694
251 Ga0070707_100071057
252 Ga0070698_100016484
253 Ga0070698_100053090
254 Ga0070699_100366805
255 Ga0070699_101493311
256 Ga0070697_100028284
257 Ga0070704_100060055
258 Ga0068856_100072863
259 Ga0068852_101868375
260 Ga0068866_10018196
261 Ga0068861_100228554
262 Ga0081455_10171357
263 Ga0081455_10175907
264 Ga0081455_10366723
265 Ga0081539_10000008
266 Ga0070717_10121075
267 Ga0070712_100265304
268 Ga0075428_100012475
269 Ga0075428_100547723
270 Ga0075428_100743866
271 Ga0075428_100881015
272 Ga0075430_100086989
273 Ga0075431_100041732
274 Ga0075431_100658922
275 Ga0075431_100666810
276 Ga0075431_100821644
277 Ga0075431_100916027
278 Ga0075433_10206580
279 Ga0075433_11109106
280 Ga0075434_100740544
281 Ga0075434_101068274
282 Ga0075429_100029383
283 Ga0075429_100511735
284 Ga0068865_100800835
285 Ga0099794_10098280
286 Ga0099795_10015611
287 Ga0099795_10094409
288 Ga0099795_10224289
289 Ga0111539_10008515
290 Ga0114129_10012532
291 Ga0114129_10092872
292 Ga0114129_10105767
293 Ga0114129_11023374
294 Ga0114129_11891469
295 Ga0099796_10162948
296 Ga0157373_10440896
297 Ga0157380_10741880
298 Ga0157379_10050739
299 Ga0206356_10030355
300 Ga0209758_1005137
301 Ga0207692_10178842
302 Ga0207692_10200626
303 Ga0207699_10112153
304 Ga0207684_10022391
305 Ga0207684_10023561
306 Ga0207684_10841465
307 Ga0207684_10932977
308 Ga0207693_10180690
309 Ga0207693_11245439
310 Ga0207663_10609495
311 Ga0207646_10258138
312 Ga0207664_10002586
313 Ga0207664_10482391
314 Ga0209968_1009502
315 Ga0209971_1067897
316 Ga0209974_10024173
317 Ga0207428_10107319
318 Ga0307411_10138008
319 Ga0373948_0090061
320 Ga0373929_0045281
321 Ga0373949_0134791
322 Ga0373941_0149629
323 Ga0373931_0754929
324 Ga0395899_0017015
325 Ga0395900_0003092
326 Ga0395898_0009202
327 Ga0395901_0001902
328 Ga0395901_0592475
329 Ga0436365_0398286
330 Ga0436365_0429560
331 Ga0436365_1832566
332 Ga0436361_0646020
333 Ga0466966_0071580
334 Ga0466963_0520957
335 Ga0466968_0183433
336 Ga0466957_0016922
337 Ga0466959_0320035
338 Ga0466958_0047824
339 Ga0495590_0227619
340 Ga0495591_133338
341 Ga0495638_0362968
342 Ga0495584_0012608
343 Ga0495584_0166306
344 Ga0495644_0182810
345 Ga0495648_0398949
346 Ga0495598_0444854
347 Ga0495656_0016412
348 Ga0495611_0103104
349 Ga0495659_0053753
350 Ga0495659_0136181
351 Ga0495599_0159397
352 Ga0495623_0552611
353 Ga0495670_0189575
354 Ga0495671_0444784
355 Ga0495600_0090850
356 Ga0495684_0701490
357 Ga0495615_0108066
358 Ga0496100_0995650
359 Ga0496101_0018415
360 Ga0496101_0156793
361 Ga0496102_0067058
362 Ga0496102_0457875
363 Ga0496103_0484618
364 Ga0496104_0008255
365 Ga0496104_0115412
366 Ga0496104_0139631
367 Ga0496105_0014972
368 Ga0496105_0274661
369 Ga0496106_0173455
370 Ga0496107_0114943
371 Ga0496108_0040934
372 Ga0496108_0096718
373 Ga0496109_0101710
374 Ga0496109_0119867
375 Ga0496109_0137026
376 Ga0496110_0044576
377 Ga0496110_0093237
378 Ga0496110_0273966
379 Ga0496111_0088210
380 Ga0496112_0012054
381 Ga0496112_0079372
382 Ga0496112_1224605
383 Ga0496113_0049373
384 Ga0496113_0138110
385 Ga0496114_0698680
386 Ga0496115_0036807
387 Ga0496115_0196667
388 Ga0496115_0595407
389 Ga0496117_0060552
390 Ga0496118_0023400
391 Ga0496120_0127925
392 Ga0496121_0017920
393 Ga0501318_025905
394 Ga0501031_0307616
395 Ga0501033_0646908
396 Ga0501036_1268252
397 Ga0501037_0543656
398 Ga0501039_0049010
399 Ga0501039_0402410
400 Ga0501039_1382961
401 Ga0501040_0167450
402 Ga0501040_0212838
403 Ga0501041_0267872
404 Ga0501042_0109520
405 Ga0501042_0259797
406 Ga0501046_0292462
407 Ga0501048_0140000
408 Ga0501048_0966163
409 Ga0501067_0726357
410 Ga0501071_0183770
411 Ga0501071_0694286
412 Ga0501072_0033148
413 Ga0501072_0181332
414 Ga0501072_0845094
415 Ga0501073_1048532
416 Ga0501074_0171181
417 Ga0501075_0180974
418 Ga0501075_0364502
419 Ga0501075_0749800
420 Ga0501076_0856097
421 Ga0501077_0050112
422 Ga0501077_0083351
423 Ga0501079_0034785
424 Ga0501079_0231469
425 Ga0501079_1391463
426 Ga0501081_0023050
427 Ga0501081_0101023
428 Ga0501081_0160228
429 Ga0501083_0246616
430 Ga0501083_0265242
431 Ga0501035_0354952
432 Ga0501044_0642714
433 Ga0501045_0354896
434 nmdc:mga05p37_1746858_c1
435 nmdc:mga05p37_216528_c1
436 nmdc:mga05p37_353138_c1
437 nmdc:mga05p37_80925_c1
438 nmdc:mga09592_232807_c2
439 nmdc:mga09592_36097_c1
440 nmdc:mga09592_491886_c1
441 nmdc:mga0qj67_17701_c1
442 nmdc:mga06r32_1014405_c1
443 nmdc:mga06r32_298786_c1
444 nmdc:mga06r32_535848_c1
445 nmdc:mga06r32_549178_c1
446 nmdc:mga08y16_12280_c1
447 nmdc:mga0n895_1468910_c1
448 nmdc:mga0n895_2139168_c1
449 nmdc:mga0n895_756454_c1
450 nmdc:mga08x19_840285_c1
451 nmdc:mga0a205_266007_c1
452 Ga0495655_0177110
453 Ga0495595_0089053
454 Ga0500616_0002075
455 Ga0501084_0082185
456 Ga0501084_0125136
457 Ga0501084_0252710
458 Ga0501084_1115005
459 Ga0587083_0126679
460 Ga0501082_0131078
461 Ga0501082_0603431
462 Ga0530510_0006100
463 Ga0530510_0029225
464 Ga0530510_0499803
465 2891090505
466 3005588265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

72

134

0.93

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

4

77

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9184 2 147
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9134 2 147
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9123 2 147
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9049 2 147
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9049 2 147
ID Description Score Start End Superfamily
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9089 76 147 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8949 76 147 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8876 77 147 1.10.150.120
1alo002 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8855 72 147 1.10.150.120
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8846 77 147 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A537T6Y3-F1-model_v4 (2Fe-2S)-binding protein 0.9393 1 147 GO:0016491
GO:0046872
GO:0051537
AF-A0A2T0XJA2-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit 0.9362 1 148 GO:0016491
GO:0046872
GO:0051537
AF-A0A540VME1-F1-model_v4 (2Fe-2S)-binding protein 0.9358 2 147 GO:0016491
GO:0046872
GO:0051537
AF-A0A520J0J4-F1-model_v4 (2Fe-2S)-binding protein 0.9356 3 147 GO:0016491
GO:0046872
GO:0051537
AF-A0A3S2V5D0-F1-model_v4 (2Fe-2S)-binding protein 0.9355 2 147 GO:0016491
GO:0046872
GO:0051537

Map