F345854

General Info

Members Datasets Scaffolds Average Seq Length
233 140 466 386

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100060923|Ga0070707_1000609233
Length 431
Sequence MAYLDSTQRLVAKGILTSLDSHGRAMRKGPSSRASGFTESVIREMTRLCQAYGAVNLAQGFPDFDPPVSIKRAAATAISKGYNQYSTTYGTIGLRKAIARKMKTYNHIDCGIDEITVTCGTTEGMIASQLALLDRGEEVVIFEPFYENYGPDAILSGAKCRYVRMKEPDFRIEEESLKQAFNRKTKAVIINTPHNPTGKVLSRQELGLIRDLCQDHDSYAITDEIYEHILYDGHEHVSIGSLPGMEDRTITISGFSKTYSVTGWRVGYVVASKPLTSAIRKVHDFLTVCAPTPLQEACTVALQLPESYYEDLRENYRKGREMLVDSLKGAGFGVFQPEGAYYVWTTTTNTGFKDDRNLAMHLITKIGVGGVPGSSFFHNPSHGRLRFRFSFSKKPETIRRAIKRLEKFSPKRQGARSSHAKTRRLSVTAGF

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
132 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
133 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
134 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
138 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
139 2738543013 Variovorax sp. BT01 Isolate Unclassified
140 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.32
Nodule 0.43
Rhizoplane 0
Rhizosphere 68.67
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100060923 3300005468 Archaea 3619
2 JGI24740J21852_10000583 3300001979 Bacteria 15702
3 JGI25155J39150_1000146 3300002704 Bacteria 32665
4 JGI25156J39149_1000194 3300002705 Bacteria 42441
5 JGI25154J39366_1000126 3300002738 Bacteria 61290
6 JGI25157J39369_1000138 3300002741 Bacteria 61290
7 JGI25150J39212_1002479 3300002774 Bacteria 4571
8 JGI25159J45721_1001410 3300002987 Bacteria 9985
9 JGI25159J45721_1001793 3300002987 Bacteria 8607
10 JGI25151J46595_10009976 3300003187 Bacteria 4453
11 JGI25151J46595_10022133 3300003187 Bacteria 2644
12 JGI25151J46595_10031848 3300003187 Bacteria 2053
13 JGI25160J50197_1000321 3300003354 Bacteria 33340
14 JGI25161J50226_1000070 3300003374 Bacteria 89592
15 Ga0055526_1005382 3300003771 Bacteria 7372
16 Ga0055526_1008456 3300003771 Bacteria 5131
17 Ga0055537_1000034 3300003773 Bacteria 98043
18 Ga0055537_1007181 3300003773 Bacteria 2724
19 Ga0055524_1000016 3300003775 Bacteria 244926
20 Ga0055536_1003256 3300003781 Bacteria 8802
21 Ga0055536_1029174 3300003781 Bacteria 1487
22 Ga0055534_1000839 3300003784 Bacteria 14152
23 Ga0055534_1012177 3300003784 Bacteria 1713
24 Ga0055528_1005116 3300003790 Bacteria 6174
25 Ga0055530_10000431 3300003791 Bacteria 37213
26 Ga0055540_1000031 3300003792 Bacteria 177859
27 Ga0055531_10000933 3300003794 Bacteria 23635
28 Ga0055531_10009488 3300003794 Bacteria 4967
29 Ga0065712_10097925 3300005290 Bacteria 2121
30 Ga0065715_10123062 3300005293 Bacteria 2187
31 Ga0070670_100009490 3300005331 Bacteria 8308
32 Ga0068868_100144886 3300005338 Bacteria 1952
33 Ga0070689_100100684 3300005340 Bacteria 2286
34 Ga0070671_100077725 3300005355 Bacteria 2774
35 Ga0070688_100025750 3300005365 Bacteria 3487
36 Ga0070709_10098305 3300005434 Bacteria 1945
37 Ga0070714_100053587 3300005435 Bacteria 3444
38 Ga0070714_100078190 3300005435 Bacteria 2875
39 Ga0070708_100021805 3300005445 Archaea 5424
40 Ga0070708_100027363 3300005445 Bacteria 4892
41 Ga0070708_100030552 3300005445 Bacteria 4658
42 Ga0070708_100036212 3300005445 Bacteria 4304
43 Ga0070708_100036436 3300005445 Bacteria 4290
44 Ga0070708_100066596 3300005445 Bacteria 3233
45 Ga0070681_10199021 3300005458 Bacteria 1922
46 Ga0070706_100000102 3300005467 Bacteria 104490
47 Ga0070706_100000832 3300005467 Bacteria 34166
48 Ga0070706_100016230 3300005467 Bacteria 6879
49 Ga0070706_100043107 3300005467 Bacteria 4168
50 Ga0070706_100060157 3300005467 Bacteria 3506
51 Ga0070707_100000646 3300005468 Bacteria 34825
52 Ga0070707_100025442 3300005468 Bacteria 5615
53 Ga0070707_100031238 3300005468 Bacteria 5072
54 Ga0070707_100063187 3300005468 Bacteria 3553
55 Ga0070698_100000113 3300005471 Bacteria 68318
56 Ga0070698_100001687 3300005471 Bacteria 24646
57 Ga0070698_100003690 3300005471 Bacteria 16810
58 Ga0070698_100067630 3300005471 Bacteria 3592
59 Ga0070698_100194681 3300005471 Bacteria 1964
60 Ga0070698_100196564 3300005471 Bacteria 1953
61 Ga0070699_100000096 3300005518 Bacteria 83067
62 Ga0070699_100000320 3300005518 Bacteria 46461
63 Ga0070699_100000781 3300005518 Bacteria 29362
64 Ga0070699_100002350 3300005518 Archaea 16991
65 Ga0070699_100164357 3300005518 Bacteria 1966
66 Ga0070679_100134487 3300005530 Bacteria 2453
67 Ga0070697_100000009 3300005536 Bacteria 181121
68 Ga0070697_100000091 3300005536 Bacteria 75795
69 Ga0070697_100004992 3300005536 Bacteria 10187
70 Ga0070697_100022427 3300005536 Archaea 5011
71 Ga0070672_100029149 3300005543 Bacteria 4136
72 Ga0070686_100037661 3300005544 Bacteria 3001
73 Ga0070665_100008218 3300005548 Bacteria 10565
74 Ga0068851_10104219 3300005834 Bacteria 1508
75 Ga0068858_100280572 3300005842 Unclassified 1586
76 Ga0068860_100184907 3300005843 Bacteria 2015
77 Ga0075365_10004650 3300006038 Bacteria 7308
78 Ga0075362_10020842 3300006177 Bacteria 2743
79 Ga0075428_100002158 3300006844 Bacteria 21269
80 Ga0075430_100003087 3300006846 Bacteria 13917
81 Ga0075431_100002800 3300006847 Bacteria 16895
82 Ga0075429_100009894 3300006880 Bacteria 8267
83 Ga0075429_100189989 3300006880 Bacteria 1799
84 Ga0075436_100008534 3300006914 Bacteria 7003
85 Ga0075436_100029341 3300006914 Bacteria 3783
86 Ga0079104_1016431 3300006946 Bacteria 2164
87 Ga0105240_10097412 3300009093 Bacteria 3584
88 Ga0111539_10001829 3300009094 Bacteria 28311
89 Ga0114129_10003817 3300009147 Bacteria 21239
90 Ga0105238_10289272 3300009551 Bacteria 1621
91 Ga0157369_10390655 3300013105 Bacteria 1444
92 Ga0157378_10140639 3300013297 Bacteria 2241
93 Ga0157376_10002594 3300014969 Bacteria 12270
94 Ga0209435_100001 3300025206 Bacteria 1424171
95 Ga0207425_1000842 3300025245 Bacteria 15147
96 Ga0207425_1009489 3300025245 Bacteria 2415
97 Ga0209646_1000001 3300025246 Bacteria 3092932
98 Ga0209026_1000003 3300025250 Bacteria 1060571
99 Ga0209759_1000001 3300025256 Bacteria 2799452
100 Ga0209565_1000004 3300025263 Bacteria 983150
101 Ga0209565_1000318 3300025263 Bacteria 43946
102 Ga0209673_1000045 3300025273 Bacteria 290531
103 Ga0209130_1000155 3300025284 Bacteria 102476
104 Ga0209130_1000166 3300025284 Bacteria 96473
105 Ga0209675_1000613 3300025291 Bacteria 25586
106 Ga0209675_1000771 3300025291 Bacteria 21464
107 Ga0209675_1001862 3300025291 Bacteria 11424
108 Ga0209676_1000007 3300025292 Bacteria 1029371
109 Ga0209676_1005891 3300025292 Bacteria 6231
110 Ga0209025_1004623 3300025294 Bacteria 11772
111 Ga0209025_1006674 3300025294 Bacteria 8862
112 Ga0209025_1016037 3300025294 Bacteria 4460
113 Ga0209025_1019962 3300025294 Bacteria 3695
114 Ga0209564_1001002 3300025295 Bacteria 35185
115 Ga0209564_1002353 3300025295 Bacteria 15249
116 Ga0209758_1014365 3300025297 Bacteria 4217
117 Ga0209050_1000003 3300025298 Bacteria 1609245
118 Ga0209256_1000001 3300025299 Bacteria 2166974
119 Ga0209256_1018923 3300025299 Bacteria 2215
120 Ga0207426_1000025 3300025302 Bacteria 532921
121 Ga0207426_1002221 3300025302 Bacteria 13024
122 Ga0209051_1000003 3300025303 Bacteria 1609245
123 Ga0209051_1010354 3300025303 Bacteria 4721
124 Ga0209257_1000018 3300025304 Bacteria 836016
125 Ga0209257_1013688 3300025304 Bacteria 3574
126 Ga0207656_10049613 3300025321 Bacteria 1810
127 Ga0207684_10000003 3300025910 Bacteria 766933
128 Ga0207684_10000087 3300025910 Bacteria 173557
129 Ga0207684_10000165 3300025910 Bacteria 111682
130 Ga0207684_10005552 3300025910 Bacteria 11611
131 Ga0207684_10009384 3300025910 Bacteria 8643
132 Ga0207695_10218325 3300025913 Bacteria 1815
133 Ga0207657_10053560 3300025919 Bacteria 3495
134 Ga0207652_10321418 3300025921 Bacteria 1397
135 Ga0207646_10000498 3300025922 Bacteria 52649
136 Ga0207646_10000579 3300025922 Bacteria 48026
137 Ga0207646_10001747 3300025922 Bacteria 26384
138 Ga0207646_10013105 3300025922 Bacteria 7935
139 Ga0207646_10081436 3300025922 Bacteria 2894
140 Ga0207646_10084717 3300025922 Bacteria 2836
141 Ga0207646_10154258 3300025922 Bacteria 2071
142 Ga0207650_10169328 3300025925 Bacteria 1735
143 Ga0207664_10026433 3300025929 Bacteria 4387
144 Ga0207664_10172395 3300025929 Bacteria 1852
145 Ga0207691_10043527 3300025940 Bacteria 4137
146 Ga0207689_10115448 3300025942 Bacteria 2207
147 Ga0207679_10054292 3300025945 Bacteria 2949
148 Ga0207677_10066109 3300026023 Bacteria 2526
149 Ga0207674_10139065 3300026116 Bacteria 2389
150 Ga0207428_10055354 3300027907 Bacteria 3154
151 Ga0268266_10012134 3300028379 Bacteria 7458
152 Ga0268264_10138089 3300028381 Bacteria 2170
153 Ga0268264_10160939 3300028381 Bacteria 2022
154 Ga0307515_10020453 3300028794 Bacteria 11806
155 Ga0265332_10032861 3300031238 Bacteria 2260
156 Ga0265331_10040637 3300031250 Bacteria 2262
157 Ga0307513_10000010 3300031456 Bacteria 360812
158 Ga0307513_10000014 3300031456 Bacteria 303157
159 Ga0307513_10052563 3300031456 Bacteria 4386
160 Ga0265313_10007853 3300031595 Bacteria 7197
161 Ga0265314_10007625 3300031711 Bacteria 9366
162 Ga0307406_10158626 3300031901 Bacteria 1623
163 Ga0307416_100093342 3300032002 Bacteria 2592
164 Ga0307411_10019570 3300032005 Bacteria 3914
165 Ga0373925_0108515 3300037068 Bacteria 2142
166 Ga0395899_0004164 3300037312 Bacteria 11359
167 Ga0395899_0031188 3300037312 Bacteria 4007
168 Ga0395900_0014709 3300037418 Bacteria 7980
169 Ga0395900_0017262 3300037418 Bacteria 7366
170 Ga0395900_0129038 3300037418 Bacteria 2592
171 Ga0395900_0245578 3300037418 Bacteria 1794
172 Ga0395900_0348486 3300037418 Bacteria 1455
173 Ga0395898_0041064 3300037466 Bacteria 4571
174 Ga0395905_0000339 3300037471 Bacteria 66527
175 Ga0395905_0000395 3300037471 Bacteria 61787
176 Ga0395905_0010734 3300037471 Bacteria 8881
177 Ga0395905_0027763 3300037471 Bacteria 5337
178 Ga0395905_0169207 3300037471 Bacteria 2052
179 Ga0395901_0019333 3300038443 Bacteria 6963
180 Ga0395901_0126113 3300038443 Bacteria 2690
181 Ga0451577_0000088 3300042876 Bacteria 206788
182 Ga0451577_0011612 3300042876 Bacteria 8318
183 Ga0451577_0039108 3300042876 Bacteria 4263
184 Ga0451577_0043145 3300042876 Bacteria 4040
185 Ga0451577_0092261 3300042876 Bacteria 2703
186 Ga0466969_0010184 3300044656 Bacteria 4985
187 Ga0453683_0001527 3300044673 Bacteria 19739
188 Ga0453683_0003520 3300044673 Bacteria 11510
189 Ga0453683_0003613 3300044673 Bacteria 11342
190 Ga0453683_0010277 3300044673 Bacteria 6206
191 Ga0453683_0019213 3300044673 Bacteria 4377
192 Ga0466966_0005911 3300044684 Bacteria 8075
193 Ga0466966_0012215 3300044684 Bacteria 5690
194 Ga0466966_0086676 3300044684 Bacteria 1947
195 Ga0466961_0048355 3300044693 Bacteria 2718
196 Ga0453684_0000309 3300044712 Bacteria 207063
197 Ga0453684_0002126 3300044712 Bacteria 49860
198 Ga0453684_0038238 3300044712 Bacteria 6564
199 Ga0453684_0110655 3300044712 Bacteria 3338
200 Ga0466971_0010338 3300044719 Bacteria 4077
201 Ga0466957_0022560 3300044842 Bacteria 3716
202 Ga0466960_0057327 3300044901 Bacteria 1899
203 Ga0466959_0014611 3300045049 Bacteria 5712
204 Ga0466959_0015336 3300045049 Bacteria 5579
205 Ga0451576_0001347 3300045051 Bacteria 42437
206 Ga0451576_0002251 3300045051 Bacteria 29522
207 Ga0451576_0003929 3300045051 Bacteria 19834
208 Ga0451576_0012808 3300045051 Bacteria 9410
209 Ga0451576_0013843 3300045051 Bacteria 9011
210 Ga0451576_0201178 3300045051 Bacteria 2080
211 Ga0466958_0001760 3300045836 Bacteria 10487
212 Ga0495650_0008317 3300046471 Bacteria 6072
213 Ga0501034_0257959 3300049571 Unclassified 1686
214 Ga0501080_0215626 3300049742 Bacteria 1758
215 Ga0501081_0044782 3300049743 Bacteria 3038
216 nmdc:mga0yw44_878_c1 3300050492 Bacteria 11320
217 nmdc:mga0k408_76180_c1 3300050493 Unclassified 1960
218 nmdc:mga06z11_60182_c1 3300050494 Unclassified 1976
219 nmdc:mga05p37_1939_c1 3300050507 Bacteria 24101
220 nmdc:mga09592_922_c1 3300050508 Bacteria 23062
221 nmdc:mga0qj67_685_c1 3300050509 Bacteria 23062
222 nmdc:mga06r32_1228_c1 3300050510 Bacteria 23062
223 nmdc:mga08y16_2335_c1 3300050511 Bacteria 19452
224 Ga0500644_0001993 3300053088 Bacteria 5200
225 Ga0500562_007364 3300053108 Bacteria 2775
226 Ga0500645_000059 3300053730 Bacteria 91141
227 Ga0500661_001957 3300055283 Bacteria 3887
228 Ga0501082_0259018 3300060353 Bacteria 1513
229 Ga0466962_0005849 3300061719 Bacteria 5910
230 Ga0530510_0176837 3300061734 Bacteria 1582
231 2511243761 2511231002 Bacteria 5042903
232 2739251283 2738543013 Bacteria 5618633
233 2916181953 2916178963 Bacteria 5265078
234 Ga0070707_100060923
235 JGI24740J21852_10000583
236 JGI25155J39150_1000146
237 JGI25156J39149_1000194
238 JGI25154J39366_1000126
239 JGI25157J39369_1000138
240 JGI25150J39212_1002479
241 JGI25159J45721_1001410
242 JGI25159J45721_1001793
243 JGI25151J46595_10009976
244 JGI25151J46595_10022133
245 JGI25151J46595_10031848
246 JGI25160J50197_1000321
247 JGI25161J50226_1000070
248 Ga0055526_1005382
249 Ga0055526_1008456
250 Ga0055537_1000034
251 Ga0055537_1007181
252 Ga0055524_1000016
253 Ga0055536_1003256
254 Ga0055536_1029174
255 Ga0055534_1000839
256 Ga0055534_1012177
257 Ga0055528_1005116
258 Ga0055530_10000431
259 Ga0055540_1000031
260 Ga0055531_10000933
261 Ga0055531_10009488
262 Ga0065712_10097925
263 Ga0065715_10123062
264 Ga0070670_100009490
265 Ga0068868_100144886
266 Ga0070689_100100684
267 Ga0070671_100077725
268 Ga0070688_100025750
269 Ga0070709_10098305
270 Ga0070714_100053587
271 Ga0070714_100078190
272 Ga0070708_100021805
273 Ga0070708_100027363
274 Ga0070708_100030552
275 Ga0070708_100036212
276 Ga0070708_100036436
277 Ga0070708_100066596
278 Ga0070681_10199021
279 Ga0070706_100000102
280 Ga0070706_100000832
281 Ga0070706_100016230
282 Ga0070706_100043107
283 Ga0070706_100060157
284 Ga0070707_100000646
285 Ga0070707_100025442
286 Ga0070707_100031238
287 Ga0070707_100063187
288 Ga0070698_100000113
289 Ga0070698_100001687
290 Ga0070698_100003690
291 Ga0070698_100067630
292 Ga0070698_100194681
293 Ga0070698_100196564
294 Ga0070699_100000096
295 Ga0070699_100000320
296 Ga0070699_100000781
297 Ga0070699_100002350
298 Ga0070699_100164357
299 Ga0070679_100134487
300 Ga0070697_100000009
301 Ga0070697_100000091
302 Ga0070697_100004992
303 Ga0070697_100022427
304 Ga0070672_100029149
305 Ga0070686_100037661
306 Ga0070665_100008218
307 Ga0068851_10104219
308 Ga0068858_100280572
309 Ga0068860_100184907
310 Ga0075365_10004650
311 Ga0075362_10020842
312 Ga0075428_100002158
313 Ga0075430_100003087
314 Ga0075431_100002800
315 Ga0075429_100009894
316 Ga0075429_100189989
317 Ga0075436_100008534
318 Ga0075436_100029341
319 Ga0079104_1016431
320 Ga0105240_10097412
321 Ga0111539_10001829
322 Ga0114129_10003817
323 Ga0105238_10289272
324 Ga0157369_10390655
325 Ga0157378_10140639
326 Ga0157376_10002594
327 Ga0209435_100001
328 Ga0207425_1000842
329 Ga0207425_1009489
330 Ga0209646_1000001
331 Ga0209026_1000003
332 Ga0209759_1000001
333 Ga0209565_1000004
334 Ga0209565_1000318
335 Ga0209673_1000045
336 Ga0209130_1000155
337 Ga0209130_1000166
338 Ga0209675_1000613
339 Ga0209675_1000771
340 Ga0209675_1001862
341 Ga0209676_1000007
342 Ga0209676_1005891
343 Ga0209025_1004623
344 Ga0209025_1006674
345 Ga0209025_1016037
346 Ga0209025_1019962
347 Ga0209564_1001002
348 Ga0209564_1002353
349 Ga0209758_1014365
350 Ga0209050_1000003
351 Ga0209256_1000001
352 Ga0209256_1018923
353 Ga0207426_1000025
354 Ga0207426_1002221
355 Ga0209051_1000003
356 Ga0209051_1010354
357 Ga0209257_1000018
358 Ga0209257_1013688
359 Ga0207656_10049613
360 Ga0207684_10000003
361 Ga0207684_10000087
362 Ga0207684_10000165
363 Ga0207684_10005552
364 Ga0207684_10009384
365 Ga0207695_10218325
366 Ga0207657_10053560
367 Ga0207652_10321418
368 Ga0207646_10000498
369 Ga0207646_10000579
370 Ga0207646_10001747
371 Ga0207646_10013105
372 Ga0207646_10081436
373 Ga0207646_10084717
374 Ga0207646_10154258
375 Ga0207650_10169328
376 Ga0207664_10026433
377 Ga0207664_10172395
378 Ga0207691_10043527
379 Ga0207689_10115448
380 Ga0207679_10054292
381 Ga0207677_10066109
382 Ga0207674_10139065
383 Ga0207428_10055354
384 Ga0268266_10012134
385 Ga0268264_10138089
386 Ga0268264_10160939
387 Ga0307515_10020453
388 Ga0265332_10032861
389 Ga0265331_10040637
390 Ga0307513_10000010
391 Ga0307513_10000014
392 Ga0307513_10052563
393 Ga0265313_10007853
394 Ga0265314_10007625
395 Ga0307406_10158626
396 Ga0307416_100093342
397 Ga0307411_10019570
398 Ga0373925_0108515
399 Ga0395899_0004164
400 Ga0395899_0031188
401 Ga0395900_0014709
402 Ga0395900_0017262
403 Ga0395900_0129038
404 Ga0395900_0245578
405 Ga0395900_0348486
406 Ga0395898_0041064
407 Ga0395905_0000339
408 Ga0395905_0000395
409 Ga0395905_0010734
410 Ga0395905_0027763
411 Ga0395905_0169207
412 Ga0395901_0019333
413 Ga0395901_0126113
414 Ga0451577_0000088
415 Ga0451577_0011612
416 Ga0451577_0039108
417 Ga0451577_0043145
418 Ga0451577_0092261
419 Ga0466969_0010184
420 Ga0453683_0001527
421 Ga0453683_0003520
422 Ga0453683_0003613
423 Ga0453683_0010277
424 Ga0453683_0019213
425 Ga0466966_0005911
426 Ga0466966_0012215
427 Ga0466966_0086676
428 Ga0466961_0048355
429 Ga0453684_0000309
430 Ga0453684_0002126
431 Ga0453684_0038238
432 Ga0453684_0110655
433 Ga0466971_0010338
434 Ga0466957_0022560
435 Ga0466960_0057327
436 Ga0466959_0014611
437 Ga0466959_0015336
438 Ga0451576_0001347
439 Ga0451576_0002251
440 Ga0451576_0003929
441 Ga0451576_0012808
442 Ga0451576_0013843
443 Ga0451576_0201178
444 Ga0466958_0001760
445 Ga0495650_0008317
446 Ga0501034_0257959
447 Ga0501080_0215626
448 Ga0501081_0044782
449 nmdc:mga0yw44_878_c1
450 nmdc:mga0k408_76180_c1
451 nmdc:mga06z11_60182_c1
452 nmdc:mga05p37_1939_c1
453 nmdc:mga09592_922_c1
454 nmdc:mga0qj67_685_c1
455 nmdc:mga06r32_1228_c1
456 nmdc:mga08y16_2335_c1
457 Ga0500644_0001993
458 Ga0500562_007364
459 Ga0500645_000059
460 Ga0500661_001957
461 Ga0501082_0259018
462 Ga0466962_0005849
463 Ga0530510_0176837
464 2511243761
465 2739251283
466 2916181953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

52

405

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u08-assembly1.cif.gz_A crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.9877 14 394
1u08-assembly1.cif.gz_B crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.9857 14 394
1u08-assembly1.cif.gz_B crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.9831 14 394
1u08-assembly1.cif.gz_A crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.9825 14 394
2o0r-assembly1.cif.gz_B the three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis 0.9601 16 393
ID Description Score Start End Superfamily
af_P77806_47_284_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9931 57 291 3.40.640.10
af_A0A1D6I5Q5_168_402_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9881 56 287 3.40.640.10
af_P77806_47_284_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9765 57 291 3.40.640.10
af_Q7XDA3_47_275_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.976 60 289 3.40.640.10
af_P77806_286_386_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9747 296 394 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A257JDI9-F1-model_v4 Methionine aminotransferase 0.9954 123 338 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-N6XFG0-F1-model_v4 Methionine aminotransferase 0.9911 15 394 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-A0A7H9F5E6-F1-model_v4 deleted 0.9908 14 394
AF-A0A257JDI9-F1-model_v4 Methionine aminotransferase 0.9908 123 338 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-A0A5C6M309-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9899 16 394 GO:0005737
GO:0009058
GO:0016212
GO:0030170

Map