F345479

General Info

Members Datasets Scaffolds Average Seq Length
232 165 464 276

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0002743|Ga0496125_0002743_2709_3599
Length 296
Sequence MCRWLAYTGSPVVLDELLYKPANSLVMQSRHSRLGVEAVNGDGFGVGWYDEHSPIPGVFRSIEPAWSDRNLRELSAHVRSGLVLAHVRATTGTAVQQTNCHPFRHGQWLFVHNGALNGFSTLKRDLQLAIDPTLFPLIEGSTDSETLFYLALSCGLADDPPAAVAAAVGLVEDVAARHGVPYPVQGTFATTDGTRLWTFRYSSEGRSRSLFRNRDVAVLRAQYPDNPTLHGLSDDTRIVVSEPLGDLKGAWIEVPEGSCLVVEGGAEEIVPFSPAVPAVENGPGGRGARVLREGRS

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
68 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
74 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
75 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
80 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
81 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
82 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
83 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
84 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
85 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
86 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
87 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
90 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
91 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
92 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
109 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
141 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
146 2643221647 Streptomyces sp. Root369 Isolate Unclassified
147 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
148 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
149 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
150 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
151 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
152 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
153 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
154 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
155 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
156 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
157 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
158 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
159 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
160 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
161 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
162 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
163 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
164 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
165 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.95
Metatranscriptomes 0.43
Isolates 8.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0.43
Rhizoplane 19.4
Rhizosphere 68.53
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0002743 3300048928 Bacteria 22288
2 JGI25407J50210_10020604 3300003373 Bacteria 1713
3 JGI25407J50210_10028545 3300003373 Bacteria 1447
4 Ga0007429J51699_1069885 3300003579 Bacteria 1340
5 JGI25405J52794_10011635 3300003911 Bacteria 1685
6 Ga0065714_10003876 3300005288 Bacteria 5895
7 Ga0070676_10007697 3300005328 Bacteria 5784
8 Ga0070683_100519247 3300005329 Bacteria 1138
9 Ga0070677_10023859 3300005333 Bacteria 2269
10 Ga0070666_10110619 3300005335 Bacteria 1900
11 Ga0070675_100091894 3300005354 Bacteria 2543
12 Ga0070674_100353253 3300005356 Bacteria 1188
13 Ga0070673_100496130 3300005364 Bacteria 1104
14 Ga0070667_100023662 3300005367 Bacteria 5099
15 Ga0070713_100058805 3300005436 Bacteria 3207
16 Ga0070710_10025602 3300005437 Bacteria 3126
17 Ga0070678_100024192 3300005456 Bacteria 4061
18 Ga0070678_100455694 3300005456 Bacteria 1121
19 Ga0070672_100038214 3300005543 Bacteria 3666
20 Ga0081455_10001984 3300005937 Bacteria 24445
21 Ga0081455_10089271 3300005937 Bacteria 2502
22 Ga0075365_10023449 3300006038 Bacteria 3882
23 Ga0075365_10028355 3300006038 Bacteria 3571
24 Ga0075428_100463246 3300006844 Bacteria 1357
25 Ga0075430_100036997 3300006846 Bacteria 4138
26 Ga0075431_100095972 3300006847 Bacteria 3061
27 Ga0099826_10083203 3300006948 Bacteria 1985
28 Ga0111539_10074801 3300009094 Bacteria 3992
29 Ga0114129_10004672 3300009147 Bacteria 19339
30 Ga0114129_10006430 3300009147 Bacteria 16662
31 Ga0114129_10111617 3300009147 Bacteria 3772
32 Ga0114129_10423338 3300009147 Bacteria 1751
33 Ga0114129_10675924 3300009147 Bacteria 1330
34 Ga0105243_10003732 3300009148 Bacteria 12214
35 Ga0105243_10022465 3300009148 Bacteria 4795
36 Ga0105243_10819183 3300009148 Bacteria 919
37 Ga0105242_10246685 3300009176 Bacteria 1607
38 Ga0105249_10050610 3300009553 Bacteria 3787
39 Ga0105246_10089153 3300011119 Bacteria 2218
40 Ga0157371_10034246 3300013102 Bacteria 3643
41 Ga0157369_10483510 3300013105 Bacteria 1281
42 Ga0163162_10019489 3300013306 Bacteria 6655
43 Ga0163162_10058647 3300013306 Bacteria 3879
44 Ga0157375_10436491 3300013308 Bacteria 1475
45 Ga0157375_11011029 3300013308 Bacteria 971
46 Ga0157380_10165680 3300014326 Bacteria 1925
47 Ga0163161_10112279 3300017792 Bacteria 2039
48 Ga0213876_10035915 3300021384 Bacteria 2614
49 Ga0207655_1006847 3300025728 Bacteria 7486
50 Ga0207682_10006118 3300025893 Bacteria 4862
51 Ga0207692_10023648 3300025898 Bacteria 2844
52 Ga0207680_10059320 3300025903 Bacteria 2324
53 Ga0207645_10009714 3300025907 Bacteria 6645
54 Ga0207681_10028594 3300025923 Bacteria 3612
55 Ga0207659_10054082 3300025926 Bacteria 2866
56 Ga0207644_10061262 3300025931 Bacteria 2725
57 Ga0207709_10023246 3300025935 Bacteria 3526
58 Ga0207709_10037667 3300025935 Bacteria 2875
59 Ga0207669_10191014 3300025937 Bacteria 1477
60 Ga0207691_10000490 3300025940 Bacteria 39324
61 Ga0207658_10086720 3300025986 Bacteria 2415
62 Ga0207683_10005571 3300026121 Bacteria 10791
63 Ga0265327_10053511 3300031251 Bacteria 2094
64 Ga0307513_10005814 3300031456 Bacteria 16199
65 Ga0316575_10055862 3300031665 Bacteria 1573
66 Ga0316578_10051946 3300031728 Bacteria 2401
67 Ga0307516_10361563 3300031730 Bacteria 1116
68 Ga0307405_10362671 3300031731 Bacteria 1122
69 Ga0316577_10020372 3300031733 Bacteria 3676
70 Ga0316577_10043396 3300031733 Unclassified 2516
71 Ga0307407_10256325 3300031903 Bacteria 1201
72 Ga0307409_100026849 3300031995 Bacteria 4069
73 Ga0307416_100364164 3300032002 Bacteria 1469
74 Ga0307416_100831402 3300032002 Bacteria 1021
75 Ga0316580_10010357 3300032139 Bacteria 2816
76 Ga0316582_0016388 3300036647 Bacteria 4261
77 Ga0316584_0165445 3300036712 Bacteria 1642
78 Ga0395900_0660134 3300037418 Bacteria 982
79 Ga0395905_0065683 3300037471 Bacteria 3397
80 Ga0395901_0236680 3300038443 Bacteria 1905
81 Ga0395901_0480703 3300038443 Bacteria 1267
82 Ga0436365_1663215 3300039437 Bacteria 8114
83 Ga0451807_0991618 3300041486 Bacteria 1092
84 Ga0451853_3545145 3300041512 Bacteria 2768
85 Ga0466969_0006908 3300044656 Bacteria 6041
86 Ga0466966_0006819 3300044684 Bacteria 7567
87 Ga0466959_0020567 3300045049 Bacteria 4863
88 Ga0495653_0058729 3300046463 Bacteria 2923
89 Ga0495580_0376846 3300046472 Bacteria 959
90 Ga0495582_0029596 3300046473 Bacteria 3006
91 Ga0495639_0004391 3300046475 Bacteria 6043
92 Ga0495664_0004927 3300046477 Bacteria 7307
93 Ga0495631_0090441 3300046518 Bacteria 1318
94 Ga0495643_0092546 3300046522 Bacteria 1558
95 Ga0495665_0004974 3300046531 Bacteria 7159
96 Ga0495586_0006916 3300046535 Bacteria 6042
97 Ga0495645_0005377 3300046543 Bacteria 8782
98 Ga0495667_0006262 3300046559 Bacteria 8070
99 Ga0495668_0031855 3300046616 Bacteria 2970
100 Ga0495659_0091176 3300046664 Bacteria 1170
101 Ga0495588_0001067 3300046674 Bacteria 11876
102 Ga0495588_0003506 3300046674 Bacteria 6842
103 Ga0495588_0102256 3300046674 Bacteria 1506
104 Ga0495670_0002739 3300046691 Bacteria 8705
105 Ga0495670_0228412 3300046691 Bacteria 989
106 Ga0495600_0006312 3300046809 Bacteria 7205
107 Ga0495600_0166492 3300046809 Bacteria 1424
108 Ga0495581_0003170 3300047315 Bacteria 9413
109 Ga0495581_0007114 3300047315 Bacteria 6482
110 Ga0495581_0023389 3300047315 Bacteria 3580
111 Ga0495581_0069415 3300047315 Bacteria 2038
112 Ga0495680_0043569 3300047322 Bacteria 3552
113 Ga0495680_0336711 3300047322 Bacteria 1053
114 Ga0495675_0106241 3300047444 Bacteria 1754
115 Ga0495677_0012590 3300047445 Bacteria 3084
116 Ga0495593_0006588 3300047673 Bacteria 6797
117 Ga0496100_0006405 3300048903 Bacteria 6416
118 Ga0496100_0040208 3300048903 Bacteria 2973
119 Ga0496100_0084116 3300048903 Bacteria 2156
120 Ga0496101_0005578 3300048904 Bacteria 8032
121 Ga0496101_0022886 3300048904 Bacteria 4309
122 Ga0496102_0015091 3300048905 Bacteria 6725
123 Ga0496102_0034684 3300048905 Bacteria 4539
124 Ga0496102_0050734 3300048905 Bacteria 3779
125 Ga0496102_0317279 3300048905 Bacteria 1468
126 Ga0496103_0006216 3300048906 Bacteria 7135
127 Ga0496103_0015547 3300048906 Bacteria 4531
128 Ga0496104_0009504 3300048907 Bacteria 8654
129 Ga0496104_0161876 3300048907 Bacteria 2146
130 Ga0496106_0004217 3300048909 Bacteria 10705
131 Ga0496106_0032074 3300048909 Bacteria 3915
132 Ga0496106_0130743 3300048909 Bacteria 1968
133 Ga0496107_0002447 3300048910 Bacteria 12038
134 Ga0496107_0023695 3300048910 Bacteria 4338
135 Ga0496107_0429071 3300048910 Bacteria 983
136 Ga0496108_0077845 3300048911 Bacteria 2806
137 Ga0496108_0441659 3300048911 Bacteria 1136
138 Ga0496108_0855222 3300048911 Bacteria 783
139 Ga0496109_0095877 3300048912 Bacteria 2747
140 Ga0496109_0096143 3300048912 Bacteria 2744
141 Ga0496109_0111553 3300048912 Bacteria 2543
142 Ga0496109_0170882 3300048912 Bacteria 2039
143 Ga0496109_0569323 3300048912 Bacteria 1068
144 Ga0496110_0033332 3300048913 Bacteria 4454
145 Ga0496110_0059650 3300048913 Bacteria 3363
146 Ga0496111_0009990 3300048914 Bacteria 6349
147 Ga0496111_0053324 3300048914 Bacteria 2921
148 Ga0496111_0218290 3300048914 Bacteria 1416
149 Ga0496112_0014085 3300048915 Bacteria 7403
150 Ga0496112_0058664 3300048915 Bacteria 3791
151 Ga0496112_0087542 3300048915 Bacteria 3082
152 Ga0496112_0203782 3300048915 Bacteria 1937
153 Ga0496112_0573764 3300048915 Bacteria 1061
154 Ga0496113_0007444 3300048916 Bacteria 7045
155 Ga0496113_0149430 3300048916 Bacteria 1842
156 Ga0496114_0031635 3300048917 Bacteria 4353
157 Ga0496114_0045182 3300048917 Bacteria 3658
158 Ga0496114_0075031 3300048917 Bacteria 2848
159 Ga0496114_0242097 3300048917 Bacteria 1586
160 Ga0496115_0074621 3300048918 Bacteria 2754
161 Ga0496119_0112397 3300048922 Bacteria 1510
162 Ga0496124_0014787 3300048927 Bacteria 7527
163 Ga0496124_0149930 3300048927 Bacteria 1831
164 Ga0496124_0258287 3300048927 Bacteria 1284
165 Ga0496125_0117394 3300048928 Bacteria 1908
166 Ga0501031_0136006 3300049568 Bacteria 1606
167 Ga0501032_0260269 3300049569 Bacteria 1125
168 Ga0501036_0007572 3300049572 Bacteria 8862
169 Ga0501039_0034712 3300049575 Bacteria 3891
170 Ga0501040_0006508 3300049576 Bacteria 7587
171 Ga0501040_0186140 3300049576 Bacteria 1473
172 Ga0501040_0238701 3300049576 Bacteria 1295
173 Ga0501041_0020934 3300049577 Bacteria 3916
174 Ga0501042_0024319 3300049578 Bacteria 4248
175 Ga0501042_0347423 3300049578 Bacteria 1073
176 Ga0501043_0026019 3300049579 Bacteria 4591
177 Ga0501046_0024289 3300049580 Bacteria 4974
178 Ga0501048_0004847 3300049582 Bacteria 10255
179 Ga0501067_0062685 3300049583 Bacteria 2058
180 Ga0501068_0460412 3300049584 Bacteria 823
181 Ga0501069_0065918 3300049585 Bacteria 2025
182 Ga0501069_0155592 3300049585 Bacteria 1315
183 Ga0501070_0463757 3300049586 Bacteria 1020
184 Ga0501071_0033416 3300049587 Bacteria 3654
185 Ga0501072_0025137 3300049588 Bacteria 4637
186 Ga0501074_0061200 3300049590 Bacteria 2712
187 Ga0501075_0026457 3300049591 Bacteria 4271
188 Ga0501075_0158950 3300049591 Bacteria 1724
189 Ga0501076_0034475 3300049592 Bacteria 3956
190 Ga0501077_0022309 3300049593 Bacteria 4009
191 Ga0501079_0037741 3300049741 Bacteria 3724
192 Ga0501080_0226916 3300049742 Bacteria 1707
193 Ga0501035_0032680 3300049822 Bacteria 4733
194 Ga0501045_0001132 3300049824 Bacteria 17640
195 Ga0501045_0047089 3300049824 Bacteria 3141
196 Ga0501045_0101115 3300049824 Bacteria 2134
197 Ga0501045_0329370 3300049824 Bacteria 1136
198 nmdc:mga0yw44_196663_c1 3300050492 Bacteria 1331
199 nmdc:mga0yw44_28670_c1 3300050492 Bacteria 3205
200 nmdc:mga05p37_744_c1 3300050507 Bacteria 36096
201 nmdc:mga09592_103160_c1 3300050508 Bacteria 2443
202 nmdc:mga09592_80_c1 3300050508 Bacteria 56013
203 nmdc:mga0qj67_29_c3 3300050509 Bacteria 57362
204 nmdc:mga0qj67_68040_c1 3300050509 Bacteria 2838
205 nmdc:mga06r32_55_c1 3300050510 Bacteria 71298
206 nmdc:mga08y16_19495_c1 3300050511 Bacteria 7151
207 Ga0495655_0005858 3300053083 Bacteria 2197
208 Ga0500600_0092099 3300053149 Bacteria 1616
209 Ga0500616_0001326 3300053153 Bacteria 24350
210 Ga0500630_152926 3300053159 Bacteria 975
211 Ga0501082_0018013 3300060353 Bacteria 6083
212 Ga0530510_0029046 3300061734 Bacteria 3967
213 2644262608 2643221647 Bacteria 10741251
214 2644506227 2643221690 Bacteria 4654705
215 2644526217 2643221694 Bacteria 4392972
216 2644670892 2643221722 Bacteria 4247614
217 2738695135 2738541272 Bacteria 6848551
218 2739326503 2738543027 Bacteria 6409078
219 2739607316 2739367654 Bacteria 6049412
220 2808874601 2808606365 Bacteria 4301966
221 2812351258 2811994878 Bacteria 5992952
222 2819691273 2818991462 Bacteria 4320267
223 2819729163 2818991469 Bacteria 4644110
224 2884997852 2884994152 Bacteria 4492978
225 2918501520 2918501144 Bacteria 8668083
226 2935393726 2935390628 Bacteria 7043367
227 2939660864 2939660829 Bacteria 3784848
228 2946004789 2946003308 Bacteria 3857229
229 2954385507 2954380949 Bacteria 10050426
230 2954696137 2954691527 Bacteria 10720516
231 2954711312 2954701450 Bacteria 10834262
232 3006490403 3006486233 Bacteria 8157040
233 Ga0496125_0002743
234 JGI25407J50210_10020604
235 JGI25407J50210_10028545
236 Ga0007429J51699_1069885
237 JGI25405J52794_10011635
238 Ga0065714_10003876
239 Ga0070676_10007697
240 Ga0070683_100519247
241 Ga0070677_10023859
242 Ga0070666_10110619
243 Ga0070675_100091894
244 Ga0070674_100353253
245 Ga0070673_100496130
246 Ga0070667_100023662
247 Ga0070713_100058805
248 Ga0070710_10025602
249 Ga0070678_100024192
250 Ga0070678_100455694
251 Ga0070672_100038214
252 Ga0081455_10001984
253 Ga0081455_10089271
254 Ga0075365_10023449
255 Ga0075365_10028355
256 Ga0075428_100463246
257 Ga0075430_100036997
258 Ga0075431_100095972
259 Ga0099826_10083203
260 Ga0111539_10074801
261 Ga0114129_10004672
262 Ga0114129_10006430
263 Ga0114129_10111617
264 Ga0114129_10423338
265 Ga0114129_10675924
266 Ga0105243_10003732
267 Ga0105243_10022465
268 Ga0105243_10819183
269 Ga0105242_10246685
270 Ga0105249_10050610
271 Ga0105246_10089153
272 Ga0157371_10034246
273 Ga0157369_10483510
274 Ga0163162_10019489
275 Ga0163162_10058647
276 Ga0157375_10436491
277 Ga0157375_11011029
278 Ga0157380_10165680
279 Ga0163161_10112279
280 Ga0213876_10035915
281 Ga0207655_1006847
282 Ga0207682_10006118
283 Ga0207692_10023648
284 Ga0207680_10059320
285 Ga0207645_10009714
286 Ga0207681_10028594
287 Ga0207659_10054082
288 Ga0207644_10061262
289 Ga0207709_10023246
290 Ga0207709_10037667
291 Ga0207669_10191014
292 Ga0207691_10000490
293 Ga0207658_10086720
294 Ga0207683_10005571
295 Ga0265327_10053511
296 Ga0307513_10005814
297 Ga0316575_10055862
298 Ga0316578_10051946
299 Ga0307516_10361563
300 Ga0307405_10362671
301 Ga0316577_10020372
302 Ga0316577_10043396
303 Ga0307407_10256325
304 Ga0307409_100026849
305 Ga0307416_100364164
306 Ga0307416_100831402
307 Ga0316580_10010357
308 Ga0316582_0016388
309 Ga0316584_0165445
310 Ga0395900_0660134
311 Ga0395905_0065683
312 Ga0395901_0236680
313 Ga0395901_0480703
314 Ga0436365_1663215
315 Ga0451807_0991618
316 Ga0451853_3545145
317 Ga0466969_0006908
318 Ga0466966_0006819
319 Ga0466959_0020567
320 Ga0495653_0058729
321 Ga0495580_0376846
322 Ga0495582_0029596
323 Ga0495639_0004391
324 Ga0495664_0004927
325 Ga0495631_0090441
326 Ga0495643_0092546
327 Ga0495665_0004974
328 Ga0495586_0006916
329 Ga0495645_0005377
330 Ga0495667_0006262
331 Ga0495668_0031855
332 Ga0495659_0091176
333 Ga0495588_0001067
334 Ga0495588_0003506
335 Ga0495588_0102256
336 Ga0495670_0002739
337 Ga0495670_0228412
338 Ga0495600_0006312
339 Ga0495600_0166492
340 Ga0495581_0003170
341 Ga0495581_0007114
342 Ga0495581_0023389
343 Ga0495581_0069415
344 Ga0495680_0043569
345 Ga0495680_0336711
346 Ga0495675_0106241
347 Ga0495677_0012590
348 Ga0495593_0006588
349 Ga0496100_0006405
350 Ga0496100_0040208
351 Ga0496100_0084116
352 Ga0496101_0005578
353 Ga0496101_0022886
354 Ga0496102_0015091
355 Ga0496102_0034684
356 Ga0496102_0050734
357 Ga0496102_0317279
358 Ga0496103_0006216
359 Ga0496103_0015547
360 Ga0496104_0009504
361 Ga0496104_0161876
362 Ga0496106_0004217
363 Ga0496106_0032074
364 Ga0496106_0130743
365 Ga0496107_0002447
366 Ga0496107_0023695
367 Ga0496107_0429071
368 Ga0496108_0077845
369 Ga0496108_0441659
370 Ga0496108_0855222
371 Ga0496109_0095877
372 Ga0496109_0096143
373 Ga0496109_0111553
374 Ga0496109_0170882
375 Ga0496109_0569323
376 Ga0496110_0033332
377 Ga0496110_0059650
378 Ga0496111_0009990
379 Ga0496111_0053324
380 Ga0496111_0218290
381 Ga0496112_0014085
382 Ga0496112_0058664
383 Ga0496112_0087542
384 Ga0496112_0203782
385 Ga0496112_0573764
386 Ga0496113_0007444
387 Ga0496113_0149430
388 Ga0496114_0031635
389 Ga0496114_0045182
390 Ga0496114_0075031
391 Ga0496114_0242097
392 Ga0496115_0074621
393 Ga0496119_0112397
394 Ga0496124_0014787
395 Ga0496124_0149930
396 Ga0496124_0258287
397 Ga0496125_0117394
398 Ga0501031_0136006
399 Ga0501032_0260269
400 Ga0501036_0007572
401 Ga0501039_0034712
402 Ga0501040_0006508
403 Ga0501040_0186140
404 Ga0501040_0238701
405 Ga0501041_0020934
406 Ga0501042_0024319
407 Ga0501042_0347423
408 Ga0501043_0026019
409 Ga0501046_0024289
410 Ga0501048_0004847
411 Ga0501067_0062685
412 Ga0501068_0460412
413 Ga0501069_0065918
414 Ga0501069_0155592
415 Ga0501070_0463757
416 Ga0501071_0033416
417 Ga0501072_0025137
418 Ga0501074_0061200
419 Ga0501075_0026457
420 Ga0501075_0158950
421 Ga0501076_0034475
422 Ga0501077_0022309
423 Ga0501079_0037741
424 Ga0501080_0226916
425 Ga0501035_0032680
426 Ga0501045_0001132
427 Ga0501045_0047089
428 Ga0501045_0101115
429 Ga0501045_0329370
430 nmdc:mga0yw44_196663_c1
431 nmdc:mga0yw44_28670_c1
432 nmdc:mga05p37_744_c1
433 nmdc:mga09592_103160_c1
434 nmdc:mga09592_80_c1
435 nmdc:mga0qj67_29_c3
436 nmdc:mga0qj67_68040_c1
437 nmdc:mga06r32_55_c1
438 nmdc:mga08y16_19495_c1
439 Ga0495655_0005858
440 Ga0500600_0092099
441 Ga0500616_0001326
442 Ga0500630_152926
443 Ga0501082_0018013
444 Ga0530510_0029046
445 2644262608
446 2644506227
447 2644526217
448 2644670892
449 2738695135
450 2739326503
451 2739607316
452 2808874601
453 2812351258
454 2819691273
455 2819729163
456 2884997852
457 2918501520
458 2935393726
459 2939660864
460 2946004789
461 2954385507
462 2954696137
463 2954711312
464 3006490403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13522

GATase_6

Glutamine amidotransferase domain

67

179

0.84

PF13230

GATase_4

Glutamine amidotransferases class-II

20

279

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mdn-assembly1.cif.gz_C structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.9362 2 275
3mdn-assembly1.cif.gz_A structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.9341 2 275
3mdn-assembly1.cif.gz_D structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.9321 2 276
3mdn-assembly1.cif.gz_C structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.932 2 275
3mdn-assembly1.cif.gz_A structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.9299 2 275
ID Description Score Start End Superfamily
3mdnB00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9219 2 275 3.60.20.10
3mdnB00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9176 2 275 3.60.20.10
4zfjA00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8535 2 276 3.60.20.10
4zfjA00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8501 2 276 3.60.20.10
af_P53871_1_308_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8492 1 273 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A529L1G1-F1-model_v4 Class II glutamine amidotransferase 0.9686 104 208 GO:0016740
AF-D3D567-F1-model_v4 Glutamine amidotransferase type-2 domain-containing protein 0.9616 112 278
AF-A0A4R9WVM0-F1-model_v4 Class II glutamine amidotransferase 0.955 65 182 GO:0016740
AF-A0A5Q4GPF7-F1-model_v4 Class II glutamine amidotransferase 0.9542 65 276 GO:0016740
AF-D3D567-F1-model_v4 Glutamine amidotransferase type-2 domain-containing protein 0.9504 112 278

Map