F345409

General Info

Members Datasets Scaffolds Average Seq Length
232 148 464 280

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0000059|Ga0495645_0000059_18591_19517
Length 308
Sequence MPELPEVETIRRQLAPLVEGRRLKRVEILDSRWSRPLAPDELADAIVGRRVEALGRRGKYLVWHLSDDVHLAQHLRMTGSVLCDPDXXXXHTRVRIELGPLRPRRNPGAGGSPSERNGREGRRLAIVDPRRFGTGELLLGTDALETFFAARLGYEPFDERFTAEHLRALAHGRTTPIKALLLDQRRIAGIGNIYADEALFRAGVHPLRPAGRLTREQYAALRETIIEALNEGIDAQGATIDDFRHVDGVRGSFQDRFLVHRREGEPCPRCGRTIIKMFVAGRGTYVCETCQPRPRIRRPAARPSGRSR

Samples

Sample ID Description Type Environment
1 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
80 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
81 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
82 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
83 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
84 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.07
Rhizosphere 86.64
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495645_0000059 3300046543 Bacteria 79488
2 Ga0070683_100008536 3300005329 Bacteria 8706
3 Ga0070683_100262813 3300005329 Bacteria 1642
4 Ga0070682_100124526 3300005337 Bacteria 1735
5 Ga0070682_100125140 3300005337 Bacteria 1731
6 Ga0068868_100247718 3300005338 Bacteria 1499
7 Ga0070691_10001603 3300005341 Bacteria 9791
8 Ga0070691_10013387 3300005341 Bacteria 3757
9 Ga0070714_100087235 3300005435 Bacteria 2729
10 Ga0070714_100494221 3300005435 Bacteria 1166
11 Ga0070713_100007663 3300005436 Bacteria 7599
12 Ga0070711_100000717 3300005439 Bacteria 17343
13 Ga0070711_100028434 3300005439 Bacteria 3680
14 Ga0070700_100004372 3300005441 Bacteria 7375
15 Ga0070700_100023245 3300005441 Bacteria 3624
16 Ga0070700_100030809 3300005441 Bacteria 3209
17 Ga0070678_100015994 3300005456 Bacteria 4783
18 Ga0070681_10363422 3300005458 Bacteria 1358
19 Ga0070665_100004553 3300005548 Bacteria 14527
20 Ga0070665_100124195 3300005548 Bacteria 2583
21 Ga0070664_100082704 3300005564 Bacteria 2769
22 Ga0068854_100054085 3300005578 Bacteria 2886
23 Ga0068854_100138243 3300005578 Bacteria 1867
24 Ga0068856_100018239 3300005614 Bacteria 6803
25 Ga0068856_100085215 3300005614 Bacteria 3139
26 Ga0070702_100009841 3300005615 Bacteria 4692
27 Ga0068852_100074206 3300005616 Bacteria 2995
28 Ga0068852_100286682 3300005616 Bacteria 1589
29 Ga0068859_100368483 3300005617 Bacteria 1532
30 Ga0068864_100010899 3300005618 Bacteria 7514
31 Ga0068860_100131055 3300005843 Bacteria 2406
32 Ga0081455_10030494 3300005937 Bacteria 4896
33 Ga0081455_10063164 3300005937 Bacteria 3108
34 Ga0081538_10007169 3300005981 Bacteria 9679
35 Ga0081538_10073121 3300005981 Bacteria 1876
36 Ga0081538_10119032 3300005981 Bacteria 1274
37 Ga0081539_10002332 3300005985 Bacteria 27332
38 Ga0081539_10010765 3300005985 Bacteria 7365
39 Ga0081539_10019901 3300005985 Bacteria 4570
40 Ga0070712_100133104 3300006175 Bacteria 1887
41 Ga0070712_100207937 3300006175 Bacteria 1542
42 Ga0097621_100223589 3300006237 Bacteria 1641
43 Ga0075428_100073680 3300006844 Bacteria 3730
44 Ga0075430_100119431 3300006846 Bacteria 2197
45 Ga0075433_10029708 3300006852 Bacteria 4659
46 Ga0075434_100155602 3300006871 Bacteria 2305
47 Ga0075434_100258256 3300006871 Bacteria 1761
48 Ga0075429_100234337 3300006880 Bacteria 1608
49 Ga0068865_100256622 3300006881 Bacteria 1382
50 Ga0075436_100047539 3300006914 Bacteria 2959
51 Ga0097620_100368503 3300006931 Bacteria 1532
52 Ga0105240_10018008 3300009093 Bacteria 9501
53 Ga0105240_10104385 3300009093 Bacteria 3442
54 Ga0111539_10225682 3300009094 Bacteria 2182
55 Ga0111539_10320091 3300009094 Bacteria 1805
56 Ga0105245_10023343 3300009098 Bacteria 5428
57 Ga0114129_10442173 3300009147 Bacteria 1707
58 Ga0105243_10265401 3300009148 Bacteria 1539
59 Ga0105243_10406519 3300009148 Bacteria 1266
60 Ga0105241_10179370 3300009174 Bacteria 1756
61 Ga0105248_10393338 3300009177 Bacteria 1561
62 Ga0105249_10510356 3300009553 Bacteria 1248
63 Ga0105239_10114748 3300010375 Bacteria 2987
64 Ga0105239_10648701 3300010375 Bacteria 1206
65 Ga0157369_10354360 3300013105 Bacteria 1524
66 Ga0157369_10603916 3300013105 Bacteria 1132
67 Ga0157374_10235775 3300013296 Bacteria 1798
68 Ga0157378_10654867 3300013297 Bacteria 1066
69 Ga0157372_10199967 3300013307 Bacteria 2315
70 Ga0157375_10088782 3300013308 Bacteria 3147
71 Ga0157380_10416103 3300014326 Bacteria 1280
72 Ga0157380_10568717 3300014326 Bacteria 1115
73 Ga0157377_10001097 3300014745 Bacteria 11436
74 Ga0157379_10010453 3300014968 Bacteria 8090
75 Ga0213873_10002229 3300021358 Bacteria 3333
76 Ga0213873_10003271 3300021358 Bacteria 2902
77 Ga0213873_10018942 3300021358 Unclassified 1590
78 Ga0213872_10015943 3300021361 Bacteria 3490
79 Ga0213872_10071599 3300021361 Bacteria 1562
80 Ga0213872_10101797 3300021361 Bacteria 1280
81 Ga0213876_10006430 3300021384 Bacteria 6407
82 Ga0213871_10019543 3300021441 Bacteria 1669
83 Ga0207688_10002247 3300025901 Bacteria 10407
84 Ga0207699_10032773 3300025906 Bacteria 2930
85 Ga0207699_10075637 3300025906 Bacteria 2072
86 Ga0207699_10090451 3300025906 Bacteria 1920
87 Ga0207695_10070995 3300025913 Bacteria 3557
88 Ga0207693_10015511 3300025915 Bacteria 6113
89 Ga0207693_10075142 3300025915 Bacteria 2646
90 Ga0207693_10215496 3300025915 Bacteria 1509
91 Ga0207663_10002367 3300025916 Bacteria 9054
92 Ga0207663_10003909 3300025916 Bacteria 7366
93 Ga0207662_10273400 3300025918 Bacteria 1116
94 Ga0207657_10181928 3300025919 Bacteria 1699
95 Ga0207700_10002702 3300025928 Bacteria 10223
96 Ga0207664_10037169 3300025929 Bacteria 3766
97 Ga0207664_10179915 3300025929 Bacteria 1815
98 Ga0207644_10085606 3300025931 Bacteria 2339
99 Ga0207690_10034655 3300025932 Bacteria 3254
100 Ga0207706_10023114 3300025933 Bacteria 5583
101 Ga0207706_10036102 3300025933 Bacteria 4391
102 Ga0207706_10275519 3300025933 Bacteria 1468
103 Ga0207709_10203329 3300025935 Bacteria 1416
104 Ga0207704_10124355 3300025938 Bacteria 1772
105 Ga0207704_10125080 3300025938 Bacteria 1768
106 Ga0207661_10071992 3300025944 Bacteria 2827
107 Ga0207679_10048076 3300025945 Bacteria 3104
108 Ga0207679_10062571 3300025945 Bacteria 2774
109 Ga0207703_10314329 3300026035 Bacteria 1433
110 Ga0207678_10523548 3300026067 Bacteria 1035
111 Ga0207708_10000215 3300026075 Bacteria 46029
112 Ga0207708_10045841 3300026075 Bacteria 3332
113 Ga0207708_10080466 3300026075 Bacteria 2503
114 Ga0207648_10505736 3300026089 Bacteria 1106
115 Ga0207683_10094584 3300026121 Bacteria 2663
116 Ga0207683_10318047 3300026121 Bacteria 1425
117 Ga0207698_10429940 3300026142 Bacteria 1269
118 Ga0207428_10049600 3300027907 Bacteria 3363
119 Ga0268266_10006030 3300028379 Bacteria 11176
120 Ga0265337_1017213 3300028556 Bacteria 2321
121 Ga0265326_10002347 3300028558 Bacteria 6397
122 Ga0265319_1003159 3300028563 Bacteria 8678
123 Ga0265318_10018866 3300028577 Bacteria 2806
124 Ga0265322_10020328 3300028654 Bacteria 1903
125 Ga0265336_10000005 3300028666 Bacteria 399349
126 Ga0265338_10000001 3300028800 Bacteria 1177449
127 Ga0265338_10000356 3300028800 Bacteria 82744
128 Ga0265332_10004081 3300031238 Bacteria 6926
129 Ga0265325_10001914 3300031241 Bacteria 14374
130 Ga0265325_10012367 3300031241 Bacteria 4883
131 Ga0265329_10038995 3300031242 Unclassified 1528
132 Ga0265340_10000001 3300031247 Bacteria 1647668
133 Ga0265339_10008868 3300031249 Bacteria 6369
134 Ga0265339_10135663 3300031249 Bacteria 1255
135 Ga0265316_10031461 3300031344 Bacteria 4338
136 Ga0265313_10000759 3300031595 Bacteria 32866
137 Ga0265342_10001327 3300031712 Bacteria 23209
138 Ga0265342_10008859 3300031712 Bacteria 7168
139 Ga0307405_10134744 3300031731 Bacteria 1713
140 Ga0307409_100087998 3300031995 Bacteria 2534
141 Ga0307416_100007348 3300032002 Bacteria 6997
142 Ga0307415_100001881 3300032126 Bacteria 10303
143 Ga0307415_100046397 3300032126 Bacteria 2919
144 Ga0373943_0124783 3300035170 Bacteria 1372
145 Ga0316574_0306791 3300035398 Bacteria 1009
146 Ga0373937_0398427 3300036401 Unclassified 1306
147 Ga0395899_0010812 3300037312 Bacteria 6996
148 Ga0395900_0097683 3300037418 Bacteria 3017
149 Ga0395898_0039667 3300037466 Bacteria 4659
150 Ga0395898_0058727 3300037466 Bacteria 3744
151 Ga0395901_0066064 3300038443 Bacteria 3767
152 Ga0395901_0544182 3300038443 Bacteria 1177
153 Ga0436365_0103253 3300039437 Bacteria 12051
154 Ga0436360_0789993 3300039438 Bacteria 3469
155 Ga0436360_0853491 3300039438 Bacteria 3520
156 Ga0436360_0886436 3300039438 Bacteria 4190
157 Ga0436360_1155231 3300039438 Unclassified 1428
158 Ga0436360_1324010 3300039438 Bacteria 2126
159 Ga0436361_0214987 3300039447 Bacteria 9406
160 Ga0436361_0258550 3300039447 Bacteria 1466
161 Ga0436361_0466308 3300039447 Bacteria 2936
162 Ga0436361_0862420 3300039447 Bacteria 13298
163 Ga0436361_0880801 3300039447 Bacteria 3245
164 Ga0436361_1028235 3300039447 Bacteria 2853
165 Ga0436361_1123130 3300039447 Bacteria 6331
166 Ga0436362_0130984 3300039453 Bacteria 3342
167 Ga0436362_0804695 3300039453 Bacteria 2884
168 Ga0436362_0968179 3300039453 Unclassified 2400
169 Ga0436362_0971687 3300039453 Bacteria 5696
170 Ga0466961_0197064 3300044693 Bacteria 1247
171 Ga0466963_0019399 3300044694 Bacteria 4264
172 Ga0466963_0077786 3300044694 Bacteria 2242
173 Ga0466971_0216351 3300044719 Bacteria 907
174 Ga0466957_0398588 3300044842 Bacteria 941
175 Ga0466960_0000027 3300044901 Bacteria 51555
176 Ga0466960_0159966 3300044901 Bacteria 1209
177 Ga0466960_0194672 3300044901 Bacteria 1105
178 Ga0466958_0023767 3300045836 Bacteria 3601
179 Ga0466958_0043971 3300045836 Bacteria 2691
180 Ga0466967_0003499 3300045976 Bacteria 10262
181 Ga0466967_0065758 3300045976 Bacteria 3229
182 Ga0495653_0001698 3300046463 Bacteria 17318
183 Ga0495650_0000054 3300046471 Bacteria 313631
184 Ga0495630_0001323 3300046517 Bacteria 17027
185 Ga0495645_0000286 3300046543 Bacteria 37134
186 Ga0495656_0154198 3300046615 Bacteria 1112
187 Ga0495657_0000069 3300046675 Bacteria 92455
188 Ga0495676_0024232 3300047321 Bacteria 5257
189 Ga0495684_0053572 3300047471 Bacteria 3078
190 Ga0496100_0003231 3300048903 Bacteria 8463
191 Ga0496100_0294698 3300048903 Bacteria 1213
192 Ga0496101_0061317 3300048904 Bacteria 2731
193 Ga0496102_0048093 3300048905 Bacteria 3878
194 Ga0496102_0540347 3300048905 Bacteria 1088
195 Ga0496103_0059664 3300048906 Bacteria 2370
196 Ga0496104_0004290 3300048907 Bacteria 12394
197 Ga0496104_0269715 3300048907 Bacteria 1614
198 Ga0496106_0003178 3300048909 Bacteria 12280
199 Ga0496106_0061161 3300048909 Bacteria 2856
200 Ga0496107_0062101 3300048910 Bacteria 2706
201 Ga0496108_0004922 3300048911 Bacteria 10791
202 Ga0496108_0059970 3300048911 Bacteria 3201
203 Ga0496108_0094995 3300048911 Bacteria 2538
204 Ga0496108_0140155 3300048911 Bacteria 2083
205 Ga0496109_0001941 3300048912 Bacteria 17184
206 Ga0496109_0015683 3300048912 Bacteria 6610
207 Ga0496110_0014363 3300048913 Bacteria 6573
208 Ga0496110_0049369 3300048913 Bacteria 3691
209 Ga0496110_0053078 3300048913 Bacteria 3562
210 Ga0496111_0011099 3300048914 Bacteria 6063
211 Ga0496111_0043953 3300048914 Bacteria 3211
212 Ga0496111_0122751 3300048914 Bacteria 1919
213 Ga0496112_0007132 3300048915 Bacteria 9891
214 Ga0496112_0369679 3300048915 Bacteria 1375
215 Ga0496113_0015394 3300048916 Bacteria 5255
216 Ga0496115_0000081 3300048918 Bacteria 88048
217 Ga0496115_0000090 3300048918 Bacteria 85349
218 Ga0496119_0068098 3300048922 Bacteria 2097
219 Ga0501043_0170245 3300049579 Bacteria 1699
220 Ga0501047_0119629 3300049581 Bacteria 2516
221 nmdc:mga09592_131904_c1 3300050508 Bacteria 2150
222 nmdc:mga0qj67_253859_c1 3300050509 Bacteria 1426
223 nmdc:mga06r32_523961_c1 3300050510 Bacteria 1161
224 nmdc:mga08y16_449393_c1 3300050511 Bacteria 1314
225 nmdc:mga08y16_50925_c1 3300050511 Bacteria 4333
226 nmdc:mga08y16_524861_c1 3300050511 Bacteria 1200
227 nmdc:mga0n895_200110_c1 3300050512 Bacteria 2029
228 nmdc:mga0a205_20541_c1 3300050515 Bacteria 6233
229 Ga0495601_0024034 3300053077 Bacteria 3750
230 Ga0495601_0091756 3300053077 Bacteria 1956
231 Ga0495612_0000058 3300053078 Bacteria 49549
232 Ga0495619_0011883 3300053085 Bacteria 5483
233 Ga0495645_0000059
234 Ga0070683_100008536
235 Ga0070683_100262813
236 Ga0070682_100124526
237 Ga0070682_100125140
238 Ga0068868_100247718
239 Ga0070691_10001603
240 Ga0070691_10013387
241 Ga0070714_100087235
242 Ga0070714_100494221
243 Ga0070713_100007663
244 Ga0070711_100000717
245 Ga0070711_100028434
246 Ga0070700_100004372
247 Ga0070700_100023245
248 Ga0070700_100030809
249 Ga0070678_100015994
250 Ga0070681_10363422
251 Ga0070665_100004553
252 Ga0070665_100124195
253 Ga0070664_100082704
254 Ga0068854_100054085
255 Ga0068854_100138243
256 Ga0068856_100018239
257 Ga0068856_100085215
258 Ga0070702_100009841
259 Ga0068852_100074206
260 Ga0068852_100286682
261 Ga0068859_100368483
262 Ga0068864_100010899
263 Ga0068860_100131055
264 Ga0081455_10030494
265 Ga0081455_10063164
266 Ga0081538_10007169
267 Ga0081538_10073121
268 Ga0081538_10119032
269 Ga0081539_10002332
270 Ga0081539_10010765
271 Ga0081539_10019901
272 Ga0070712_100133104
273 Ga0070712_100207937
274 Ga0097621_100223589
275 Ga0075428_100073680
276 Ga0075430_100119431
277 Ga0075433_10029708
278 Ga0075434_100155602
279 Ga0075434_100258256
280 Ga0075429_100234337
281 Ga0068865_100256622
282 Ga0075436_100047539
283 Ga0097620_100368503
284 Ga0105240_10018008
285 Ga0105240_10104385
286 Ga0111539_10225682
287 Ga0111539_10320091
288 Ga0105245_10023343
289 Ga0114129_10442173
290 Ga0105243_10265401
291 Ga0105243_10406519
292 Ga0105241_10179370
293 Ga0105248_10393338
294 Ga0105249_10510356
295 Ga0105239_10114748
296 Ga0105239_10648701
297 Ga0157369_10354360
298 Ga0157369_10603916
299 Ga0157374_10235775
300 Ga0157378_10654867
301 Ga0157372_10199967
302 Ga0157375_10088782
303 Ga0157380_10416103
304 Ga0157380_10568717
305 Ga0157377_10001097
306 Ga0157379_10010453
307 Ga0213873_10002229
308 Ga0213873_10003271
309 Ga0213873_10018942
310 Ga0213872_10015943
311 Ga0213872_10071599
312 Ga0213872_10101797
313 Ga0213876_10006430
314 Ga0213871_10019543
315 Ga0207688_10002247
316 Ga0207699_10032773
317 Ga0207699_10075637
318 Ga0207699_10090451
319 Ga0207695_10070995
320 Ga0207693_10015511
321 Ga0207693_10075142
322 Ga0207693_10215496
323 Ga0207663_10002367
324 Ga0207663_10003909
325 Ga0207662_10273400
326 Ga0207657_10181928
327 Ga0207700_10002702
328 Ga0207664_10037169
329 Ga0207664_10179915
330 Ga0207644_10085606
331 Ga0207690_10034655
332 Ga0207706_10023114
333 Ga0207706_10036102
334 Ga0207706_10275519
335 Ga0207709_10203329
336 Ga0207704_10124355
337 Ga0207704_10125080
338 Ga0207661_10071992
339 Ga0207679_10048076
340 Ga0207679_10062571
341 Ga0207703_10314329
342 Ga0207678_10523548
343 Ga0207708_10000215
344 Ga0207708_10045841
345 Ga0207708_10080466
346 Ga0207648_10505736
347 Ga0207683_10094584
348 Ga0207683_10318047
349 Ga0207698_10429940
350 Ga0207428_10049600
351 Ga0268266_10006030
352 Ga0265337_1017213
353 Ga0265326_10002347
354 Ga0265319_1003159
355 Ga0265318_10018866
356 Ga0265322_10020328
357 Ga0265336_10000005
358 Ga0265338_10000001
359 Ga0265338_10000356
360 Ga0265332_10004081
361 Ga0265325_10001914
362 Ga0265325_10012367
363 Ga0265329_10038995
364 Ga0265340_10000001
365 Ga0265339_10008868
366 Ga0265339_10135663
367 Ga0265316_10031461
368 Ga0265313_10000759
369 Ga0265342_10001327
370 Ga0265342_10008859
371 Ga0307405_10134744
372 Ga0307409_100087998
373 Ga0307416_100007348
374 Ga0307415_100001881
375 Ga0307415_100046397
376 Ga0373943_0124783
377 Ga0316574_0306791
378 Ga0373937_0398427
379 Ga0395899_0010812
380 Ga0395900_0097683
381 Ga0395898_0039667
382 Ga0395898_0058727
383 Ga0395901_0066064
384 Ga0395901_0544182
385 Ga0436365_0103253
386 Ga0436360_0789993
387 Ga0436360_0853491
388 Ga0436360_0886436
389 Ga0436360_1155231
390 Ga0436360_1324010
391 Ga0436361_0214987
392 Ga0436361_0258550
393 Ga0436361_0466308
394 Ga0436361_0862420
395 Ga0436361_0880801
396 Ga0436361_1028235
397 Ga0436361_1123130
398 Ga0436362_0130984
399 Ga0436362_0804695
400 Ga0436362_0968179
401 Ga0436362_0971687
402 Ga0466961_0197064
403 Ga0466963_0019399
404 Ga0466963_0077786
405 Ga0466971_0216351
406 Ga0466957_0398588
407 Ga0466960_0000027
408 Ga0466960_0159966
409 Ga0466960_0194672
410 Ga0466958_0023767
411 Ga0466958_0043971
412 Ga0466967_0003499
413 Ga0466967_0065758
414 Ga0495653_0001698
415 Ga0495650_0000054
416 Ga0495630_0001323
417 Ga0495645_0000286
418 Ga0495656_0154198
419 Ga0495657_0000069
420 Ga0495676_0024232
421 Ga0495684_0053572
422 Ga0496100_0003231
423 Ga0496100_0294698
424 Ga0496101_0061317
425 Ga0496102_0048093
426 Ga0496102_0540347
427 Ga0496103_0059664
428 Ga0496104_0004290
429 Ga0496104_0269715
430 Ga0496106_0003178
431 Ga0496106_0061161
432 Ga0496107_0062101
433 Ga0496108_0004922
434 Ga0496108_0059970
435 Ga0496108_0094995
436 Ga0496108_0140155
437 Ga0496109_0001941
438 Ga0496109_0015683
439 Ga0496110_0014363
440 Ga0496110_0049369
441 Ga0496110_0053078
442 Ga0496111_0011099
443 Ga0496111_0043953
444 Ga0496111_0122751
445 Ga0496112_0007132
446 Ga0496112_0369679
447 Ga0496113_0015394
448 Ga0496115_0000081
449 Ga0496115_0000090
450 Ga0496119_0068098
451 Ga0501043_0170245
452 Ga0501047_0119629
453 nmdc:mga09592_131904_c1
454 nmdc:mga0qj67_253859_c1
455 nmdc:mga06r32_523961_c1
456 nmdc:mga08y16_449393_c1
457 nmdc:mga08y16_50925_c1
458 nmdc:mga08y16_524861_c1
459 nmdc:mga0n895_200110_c1
460 nmdc:mga0a205_20541_c1
461 Ga0495601_0024034
462 Ga0495601_0091756
463 Ga0495612_0000058
464 Ga0495619_0011883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

264

293

0.97

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

152

244

0.97

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

1

135

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kfv-assembly1.cif.gz_A crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. 0.9392 2 273
6rno-assembly1.cif.gz_A crystal structure of a complex between the llfpg protein, a thf-dna and an inhibitor 0.9388 2 273
1kfv-assembly2.cif.gz_B crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. 0.9378 2 273
2xzu-assembly1.cif.gz_A crystal structure of a complex between the wild-type lactococcus lactis fpg (mutm) and an oxidized pyrimidine containing dna at 310k 0.9372 2 273
4cis-assembly1.cif.gz_A structure of mutm in complex with carbocyclic 8-oxo-g containing dna 0.9371 2 273
ID Description Score Start End Superfamily
1k82C02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9593 132 271 1.10.8.50
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9573 132 271 1.10.8.50
1kfvB02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9518 134 267 1.10.8.50
1ee8B02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9513 132 267 1.10.8.50
af_P9WNC3_146_285_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.949 134 272 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A7V8W9W2-F1-model_v4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) 0.9886 1 280 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7W0MVR8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9882 1 174 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039
AF-A0A7C5DQJ5-F1-model_v4 FPG-type domain-containing protein 0.9872 132 271 GO:0000703
GO:0003684
GO:0003906
GO:0006284
GO:0008270
AF-A0A7W0ZFL7-F1-model_v4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) 0.9842 1 274 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7V8W9W2-F1-model_v4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) 0.9816 1 280 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078

Map