F345194

General Info

Members Datasets Scaffolds Average Seq Length
232 144 464 90

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10096323|Ga0265325_100963233
Length 94
Sequence MKTTPISVTEAARNFADCVNRVHYQNVTFVLLKNGSPVARLVPNEAPVDVKACTGRELAEALGKVELSPENAKAWRKDLERARKKLKPPVDRWR

Samples

Sample ID Description Type Environment
1 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
56 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
89 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
90 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 2.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.84
Stem 0
Stem Tuber 0
Unclassified 35.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265325_10096323 3300031241 Bacteria 1453
2 Ga0065707_10404925 3300005295 Bacteria 841
3 Ga0070683_100045832 3300005329 Bacteria 4036
4 Ga0070683_100221858 3300005329 Bacteria 1797
5 Ga0070690_100043444 3300005330 Unclassified 2850
6 Ga0070666_10733695 3300005335 Unclassified 725
7 Ga0070691_10567699 3300005341 Unclassified 665
8 Ga0070671_101721937 3300005355 Unclassified 556
9 Ga0070709_10346767 3300005434 Bacteria 1096
10 Ga0070714_100001146 3300005435 Bacteria 19047
11 Ga0070714_100994342 3300005435 Unclassified 816
12 Ga0070714_101070950 3300005435 Unclassified 785
13 Ga0070713_100947148 3300005436 Bacteria 829
14 Ga0070713_101085818 3300005436 Unclassified 773
15 Ga0070711_100025008 3300005439 Unclassified 3903
16 Ga0070711_100159298 3300005439 Unclassified 1710
17 Ga0070711_102026037 3300005439 Unclassified 506
18 Ga0070708_100049442 3300005445 Bacteria 3720
19 Ga0070708_100068466 3300005445 Bacteria 3191
20 Ga0070708_100179212 3300005445 Bacteria 1980
21 Ga0070708_101327317 3300005445 Bacteria 672
22 Ga0070708_101867087 3300005445 Bacteria 557
23 Ga0070681_11654102 3300005458 Unclassified 566
24 Ga0070685_11543853 3300005466 Unclassified 512
25 Ga0070706_100008395 3300005467 Bacteria 9624
26 Ga0070706_100260910 3300005467 Bacteria 1617
27 Ga0070706_100381478 3300005467 Unclassified 1313
28 Ga0070706_100625954 3300005467 Bacteria 999
29 Ga0070706_100855794 3300005467 Unclassified 841
30 Ga0070707_100064416 3300005468 Unclassified 3519
31 Ga0070707_100091343 3300005468 Bacteria 2947
32 Ga0070707_100115590 3300005468 Unclassified 2604
33 Ga0070707_100633726 3300005468 Bacteria 1032
34 Ga0070698_100058065 3300005471 Bacteria 3913
35 Ga0070698_101432309 3300005471 Bacteria 642
36 Ga0070699_100081525 3300005518 Bacteria 2820
37 Ga0070679_101261582 3300005530 Bacteria 684
38 Ga0070684_100257790 3300005535 Bacteria 1595
39 Ga0070697_100021516 3300005536 Bacteria 5110
40 Ga0070686_100179623 3300005544 Unclassified 1503
41 Ga0070665_101312287 3300005548 Unclassified 733
42 Ga0068855_100154805 3300005563 Bacteria 2605
43 Ga0068864_101858946 3300005618 Bacteria 608
44 Ga0068863_100166484 3300005841 Bacteria 2114
45 Ga0068863_100992515 3300005841 Unclassified 842
46 Ga0068860_100129924 3300005843 Bacteria 2416
47 Ga0070717_10043883 3300006028 Bacteria 3650
48 Ga0070717_10236383 3300006028 Unclassified 1610
49 Ga0070716_100106504 3300006173 Bacteria 1729
50 Ga0070716_100460826 3300006173 Bacteria 929
51 Ga0070716_100521061 3300006173 Unclassified 881
52 Ga0070716_100638412 3300006173 Unclassified 806
53 Ga0070716_100748505 3300006173 Bacteria 752
54 Ga0070716_100834806 3300006173 Bacteria 716
55 Ga0068871_100169205 3300006358 Bacteria 1872
56 Ga0075428_100000593 3300006844 Bacteria 36978
57 Ga0075433_11292192 3300006852 Unclassified 632
58 Ga0075434_100998434 3300006871 Unclassified 851
59 Ga0068865_101478087 3300006881 Bacteria 608
60 Ga0075436_100409725 3300006914 Bacteria 983
61 Ga0075435_100195897 3300007076 Unclassified 1711
62 Ga0099794_10098288 3300007265 Bacteria 1459
63 Ga0099794_10114345 3300007265 Unclassified 1354
64 Ga0099794_10132622 3300007265 Unclassified 1259
65 Ga0099794_10157858 3300007265 Bacteria 1153
66 Ga0099794_10177338 3300007265 Bacteria 1087
67 Ga0099794_10346789 3300007265 Unclassified 772
68 Ga0099795_10107304 3300007788 Bacteria 1103
69 Ga0105240_10003574 3300009093 Bacteria 24119
70 Ga0105240_10566889 3300009093 Bacteria 1254
71 Ga0105240_10668087 3300009093 Unclassified 1137
72 Ga0105240_10937389 3300009093 Bacteria 929
73 Ga0111539_10005185 3300009094 Bacteria 16886
74 Ga0105237_10457374 3300009545 Bacteria 1282
75 Ga0105249_10700125 3300009553 Bacteria 1073
76 Ga0099796_10046337 3300010159 Bacteria 1492
77 Ga0099796_10056780 3300010159 Unclassified 1375
78 Ga0157370_10516988 3300013104 Bacteria 1096
79 Ga0157370_10798451 3300013104 Unclassified 859
80 Ga0157369_11370962 3300013105 Unclassified 720
81 Ga0157378_10553207 3300013297 Bacteria 1156
82 Ga0157378_12344140 3300013297 Bacteria 585
83 Ga0163162_10234763 3300013306 Unclassified 1965
84 Ga0157372_11186109 3300013307 Unclassified 882
85 Ga0157372_11711357 3300013307 Unclassified 723
86 Ga0157375_10014551 3300013308 Bacteria 7022
87 Ga0157375_10799325 3300013308 Unclassified 1092
88 Ga0163163_10000010 3300014325 Bacteria 264773
89 Ga0157376_12425755 3300014969 Unclassified 564
90 Ga0213873_10061452 3300021358 Bacteria 1018
91 Ga0213872_10010278 3300021361 Bacteria 4458
92 Ga0213872_10052745 3300021361 Unclassified 1845
93 Ga0213874_10089686 3300021377 Bacteria 1008
94 Ga0224572_1000518 3300024225 Bacteria 4648
95 Ga0228598_1001089 3300024227 Bacteria 5977
96 Ga0228598_1025696 3300024227 Bacteria 1159
97 Ga0207680_10650238 3300025903 Unclassified 755
98 Ga0207684_10009193 3300025910 Bacteria 8741
99 Ga0207684_10544427 3300025910 Unclassified 993
100 Ga0207695_10007520 3300025913 Bacteria 13818
101 Ga0207695_10305586 3300025913 Bacteria 1481
102 Ga0207693_11284720 3300025915 Unclassified 548
103 Ga0207693_11408014 3300025915 Unclassified 517
104 Ga0207663_10072600 3300025916 Bacteria 2225
105 Ga0207663_10103220 3300025916 Unclassified 1920
106 Ga0207652_11444476 3300025921 Bacteria 591
107 Ga0207646_10003637 3300025922 Bacteria 17242
108 Ga0207646_10370632 3300025922 Bacteria 1294
109 Ga0207646_10449734 3300025922 Unclassified 1162
110 Ga0207646_10810944 3300025922 Bacteria 833
111 Ga0207700_11085841 3300025928 Bacteria 715
112 Ga0207664_10000301 3300025929 Bacteria 36802
113 Ga0207664_11906121 3300025929 Unclassified 517
114 Ga0207704_10838214 3300025938 Bacteria 770
115 Ga0207665_10318326 3300025939 Unclassified 1167
116 Ga0207665_10552954 3300025939 Unclassified 894
117 Ga0207665_10597200 3300025939 Bacteria 862
118 Ga0207665_10822338 3300025939 Bacteria 735
119 Ga0207661_10465796 3300025944 Unclassified 1152
120 Ga0207661_11638471 3300025944 Unclassified 588
121 Ga0207667_10099389 3300025949 Bacteria 3002
122 Ga0207641_10644884 3300026088 Unclassified 1040
123 Ga0207676_11494592 3300026095 Bacteria 672
124 Ga0209179_1066678 3300027512 Bacteria 785
125 Ga0209588_1071057 3300027671 Bacteria 1124
126 Ga0209588_1103294 3300027671 Bacteria 917
127 Ga0207428_11262987 3300027907 Unclassified 512
128 Ga0265356_1000998 3300028017 Bacteria 4493
129 Ga0268266_10375684 3300028379 Bacteria 1339
130 Ga0268264_10193227 3300028381 Bacteria 1857
131 Ga0265338_10034746 3300028800 Bacteria 4864
132 Ga0265338_10073322 3300028800 Bacteria 2918
133 Ga0265338_10078148 3300028800 Bacteria 2793
134 Ga0265338_10104426 3300028800 Bacteria 2299
135 Ga0265338_10813129 3300028800 Unclassified 640
136 Ga0265762_1005341 3300030760 Bacteria 2302
137 Ga0265762_1006284 3300030760 Bacteria 2127
138 Ga0265762_1127920 3300030760 Unclassified 587
139 Ga0265760_10000209 3300031090 Bacteria 15740
140 Ga0265760_10046931 3300031090 Bacteria 1296
141 Ga0265760_10070386 3300031090 Bacteria 1072
142 Ga0265330_10008871 3300031235 Bacteria 4809
143 Ga0265330_10392495 3300031235 Unclassified 587
144 Ga0265332_10293642 3300031238 Bacteria 671
145 Ga0265320_10364953 3300031240 Bacteria 638
146 Ga0265340_10170752 3300031247 Unclassified 985
147 Ga0265331_10345204 3300031250 Unclassified 667
148 Ga0265316_10460373 3300031344 Bacteria 911
149 Ga0307416_101989314 3300032002 Unclassified 684
150 Ga0373934_0007226 3300035086 Bacteria 4118
151 Ga0373934_0471193 3300035086 Unclassified 527
152 Ga0373944_0022236 3300035089 Bacteria 1842
153 Ga0373923_0004183 3300035111 Unclassified 4761
154 Ga0373936_0005331 3300035113 Bacteria 4842
155 Ga0373953_0076490 3300035117 Bacteria 1387
156 Ga0373957_0325233 3300035120 Unclassified 654
157 Ga0373957_0436104 3300035120 Unclassified 566
158 Ga0373943_0050139 3300035170 Bacteria 2050
159 Ga0373943_0729104 3300035170 Unclassified 588
160 Ga0373946_0085017 3300035171 Unclassified 1392
161 Ga0373955_0005637 3300035172 Bacteria 5633
162 Ga0373955_0932039 3300035172 Unclassified 534
163 Ga0373924_0051174 3300035410 Bacteria 1712
164 Ga0373931_1175629 3300035691 Unclassified 524
165 Ga0373935_0227194 3300035692 Bacteria 1298
166 Ga0373927_0099141 3300035695 Bacteria 1894
167 Ga0373927_0443821 3300035695 Bacteria 857
168 Ga0373933_0017997 3300035724 Bacteria 3968
169 Ga0373933_0029662 3300035724 Unclassified 3165
170 Ga0373947_0058920 3300035725 Bacteria 2327
171 Ga0373937_0008195 3300036401 Bacteria 9077
172 Ga0373937_0012114 3300036401 Bacteria 7570
173 Ga0316582_0552991 3300036647 Bacteria 793
174 Ga0373925_1783328 3300037068 Bacteria 502
175 Ga0436360_0112744 3300039438 Unclassified 2622
176 Ga0436360_0517902 3300039438 Unclassified 1410
177 Ga0436360_0595488 3300039438 Unclassified 592
178 Ga0436361_0993286 3300039447 Bacteria 4450
179 Ga0436361_1002817 3300039447 Bacteria 626
180 Ga0436361_1044542 3300039447 Bacteria 3926
181 Ga0436361_1118311 3300039447 Bacteria 6875
182 Ga0436363_0709326 3300039450 Bacteria 703
183 Ga0436363_1061136 3300039450 Bacteria 2448
184 Ga0436363_1283894 3300039450 Unclassified 535
185 Ga0436363_1438702 3300039450 Unclassified 1420
186 Ga0436362_0215011 3300039453 Bacteria 1765
187 Ga0436362_0477500 3300039453 Bacteria 1310
188 Ga0436362_0841292 3300039453 Unclassified 521
189 Ga0451577_0519783 3300042876 Bacteria 1081
190 Ga0453684_0003046 3300044712 Bacteria 38943
191 Ga0466959_0229596 3300045049 Bacteria 1285
192 Ga0495629_0307778 3300046459 Bacteria 1084
193 Ga0495653_0181748 3300046463 Bacteria 1442
194 Ga0495580_0003340 3300046472 Bacteria 13721
195 Ga0495580_0220723 3300046472 Bacteria 1303
196 Ga0495580_0483708 3300046472 Bacteria 828
197 Ga0495582_0145161 3300046473 Unclassified 1346
198 Ga0495582_0687365 3300046473 Unclassified 592
199 Ga0495664_0049447 3300046477 Bacteria 2496
200 Ga0495594_0135684 3300046499 Bacteria 1394
201 Ga0495628_0000091 3300046516 Bacteria 71204
202 Ga0495628_0247221 3300046516 Bacteria 1333
203 Ga0495630_0032965 3300046517 Bacteria 3863
204 Ga0495630_0072293 3300046517 Bacteria 2596
205 Ga0495640_0022980 3300046533 Bacteria 4553
206 Ga0495586_0179725 3300046535 Bacteria 1196
207 Ga0495586_0244171 3300046535 Bacteria 1024
208 Ga0495645_0000721 3300046543 Bacteria 22692
209 Ga0495667_0183061 3300046559 Unclassified 1344
210 Ga0495659_0468004 3300046664 Unclassified 550
211 Ga0495599_0585468 3300046678 Unclassified 651
212 Ga0495623_0087061 3300046679 Bacteria 1925
213 Ga0495646_0330210 3300046680 Bacteria 802
214 Ga0495646_0349679 3300046680 Unclassified 775
215 Ga0495658_0070990 3300046683 Bacteria 2022
216 Ga0495613_0006933 3300046689 Bacteria 8450
217 Ga0495581_0010415 3300047315 Bacteria 5377
218 Ga0495674_0075484 3300047319 Bacteria 2901
219 Ga0495674_0238209 3300047319 Bacteria 1500
220 Ga0495680_0704339 3300047322 Unclassified 667
221 Ga0495684_0376426 3300047471 Bacteria 1002
222 Ga0495602_0130012 3300048088 Bacteria 2010
223 Ga0495614_0072387 3300048089 Bacteria 1487
224 nmdc:mga08y16_10116_c1 3300050511 Bacteria 9903
225 nmdc:mga0n895_625421_c1 3300050512 Unclassified 1077
226 nmdc:mga08x19_801801_c1 3300050514 Bacteria 669
227 Ga0495601_0963460 3300053077 Unclassified 537
228 Ga0495612_0131146 3300053078 Unclassified 1083
229 Ga0495595_0665353 3300053084 Bacteria 533
230 Ga0495619_0179233 3300053085 Bacteria 1466
231 Ga0495619_0510992 3300053085 Bacteria 826
232 Ga0466962_0093912 3300061719 Bacteria 1438
233 Ga0265325_10096323
234 Ga0065707_10404925
235 Ga0070683_100045832
236 Ga0070683_100221858
237 Ga0070690_100043444
238 Ga0070666_10733695
239 Ga0070691_10567699
240 Ga0070671_101721937
241 Ga0070709_10346767
242 Ga0070714_100001146
243 Ga0070714_100994342
244 Ga0070714_101070950
245 Ga0070713_100947148
246 Ga0070713_101085818
247 Ga0070711_100025008
248 Ga0070711_100159298
249 Ga0070711_102026037
250 Ga0070708_100049442
251 Ga0070708_100068466
252 Ga0070708_100179212
253 Ga0070708_101327317
254 Ga0070708_101867087
255 Ga0070681_11654102
256 Ga0070685_11543853
257 Ga0070706_100008395
258 Ga0070706_100260910
259 Ga0070706_100381478
260 Ga0070706_100625954
261 Ga0070706_100855794
262 Ga0070707_100064416
263 Ga0070707_100091343
264 Ga0070707_100115590
265 Ga0070707_100633726
266 Ga0070698_100058065
267 Ga0070698_101432309
268 Ga0070699_100081525
269 Ga0070679_101261582
270 Ga0070684_100257790
271 Ga0070697_100021516
272 Ga0070686_100179623
273 Ga0070665_101312287
274 Ga0068855_100154805
275 Ga0068864_101858946
276 Ga0068863_100166484
277 Ga0068863_100992515
278 Ga0068860_100129924
279 Ga0070717_10043883
280 Ga0070717_10236383
281 Ga0070716_100106504
282 Ga0070716_100460826
283 Ga0070716_100521061
284 Ga0070716_100638412
285 Ga0070716_100748505
286 Ga0070716_100834806
287 Ga0068871_100169205
288 Ga0075428_100000593
289 Ga0075433_11292192
290 Ga0075434_100998434
291 Ga0068865_101478087
292 Ga0075436_100409725
293 Ga0075435_100195897
294 Ga0099794_10098288
295 Ga0099794_10114345
296 Ga0099794_10132622
297 Ga0099794_10157858
298 Ga0099794_10177338
299 Ga0099794_10346789
300 Ga0099795_10107304
301 Ga0105240_10003574
302 Ga0105240_10566889
303 Ga0105240_10668087
304 Ga0105240_10937389
305 Ga0111539_10005185
306 Ga0105237_10457374
307 Ga0105249_10700125
308 Ga0099796_10046337
309 Ga0099796_10056780
310 Ga0157370_10516988
311 Ga0157370_10798451
312 Ga0157369_11370962
313 Ga0157378_10553207
314 Ga0157378_12344140
315 Ga0163162_10234763
316 Ga0157372_11186109
317 Ga0157372_11711357
318 Ga0157375_10014551
319 Ga0157375_10799325
320 Ga0163163_10000010
321 Ga0157376_12425755
322 Ga0213873_10061452
323 Ga0213872_10010278
324 Ga0213872_10052745
325 Ga0213874_10089686
326 Ga0224572_1000518
327 Ga0228598_1001089
328 Ga0228598_1025696
329 Ga0207680_10650238
330 Ga0207684_10009193
331 Ga0207684_10544427
332 Ga0207695_10007520
333 Ga0207695_10305586
334 Ga0207693_11284720
335 Ga0207693_11408014
336 Ga0207663_10072600
337 Ga0207663_10103220
338 Ga0207652_11444476
339 Ga0207646_10003637
340 Ga0207646_10370632
341 Ga0207646_10449734
342 Ga0207646_10810944
343 Ga0207700_11085841
344 Ga0207664_10000301
345 Ga0207664_11906121
346 Ga0207704_10838214
347 Ga0207665_10318326
348 Ga0207665_10552954
349 Ga0207665_10597200
350 Ga0207665_10822338
351 Ga0207661_10465796
352 Ga0207661_11638471
353 Ga0207667_10099389
354 Ga0207641_10644884
355 Ga0207676_11494592
356 Ga0209179_1066678
357 Ga0209588_1071057
358 Ga0209588_1103294
359 Ga0207428_11262987
360 Ga0265356_1000998
361 Ga0268266_10375684
362 Ga0268264_10193227
363 Ga0265338_10034746
364 Ga0265338_10073322
365 Ga0265338_10078148
366 Ga0265338_10104426
367 Ga0265338_10813129
368 Ga0265762_1005341
369 Ga0265762_1006284
370 Ga0265762_1127920
371 Ga0265760_10000209
372 Ga0265760_10046931
373 Ga0265760_10070386
374 Ga0265330_10008871
375 Ga0265330_10392495
376 Ga0265332_10293642
377 Ga0265320_10364953
378 Ga0265340_10170752
379 Ga0265331_10345204
380 Ga0265316_10460373
381 Ga0307416_101989314
382 Ga0373934_0007226
383 Ga0373934_0471193
384 Ga0373944_0022236
385 Ga0373923_0004183
386 Ga0373936_0005331
387 Ga0373953_0076490
388 Ga0373957_0325233
389 Ga0373957_0436104
390 Ga0373943_0050139
391 Ga0373943_0729104
392 Ga0373946_0085017
393 Ga0373955_0005637
394 Ga0373955_0932039
395 Ga0373924_0051174
396 Ga0373931_1175629
397 Ga0373935_0227194
398 Ga0373927_0099141
399 Ga0373927_0443821
400 Ga0373933_0017997
401 Ga0373933_0029662
402 Ga0373947_0058920
403 Ga0373937_0008195
404 Ga0373937_0012114
405 Ga0316582_0552991
406 Ga0373925_1783328
407 Ga0436360_0112744
408 Ga0436360_0517902
409 Ga0436360_0595488
410 Ga0436361_0993286
411 Ga0436361_1002817
412 Ga0436361_1044542
413 Ga0436361_1118311
414 Ga0436363_0709326
415 Ga0436363_1061136
416 Ga0436363_1283894
417 Ga0436363_1438702
418 Ga0436362_0215011
419 Ga0436362_0477500
420 Ga0436362_0841292
421 Ga0451577_0519783
422 Ga0453684_0003046
423 Ga0466959_0229596
424 Ga0495629_0307778
425 Ga0495653_0181748
426 Ga0495580_0003340
427 Ga0495580_0220723
428 Ga0495580_0483708
429 Ga0495582_0145161
430 Ga0495582_0687365
431 Ga0495664_0049447
432 Ga0495594_0135684
433 Ga0495628_0000091
434 Ga0495628_0247221
435 Ga0495630_0032965
436 Ga0495630_0072293
437 Ga0495640_0022980
438 Ga0495586_0179725
439 Ga0495586_0244171
440 Ga0495645_0000721
441 Ga0495667_0183061
442 Ga0495659_0468004
443 Ga0495599_0585468
444 Ga0495623_0087061
445 Ga0495646_0330210
446 Ga0495646_0349679
447 Ga0495658_0070990
448 Ga0495613_0006933
449 Ga0495581_0010415
450 Ga0495674_0075484
451 Ga0495674_0238209
452 Ga0495680_0704339
453 Ga0495684_0376426
454 Ga0495602_0130012
455 Ga0495614_0072387
456 nmdc:mga08y16_10116_c1
457 nmdc:mga0n895_625421_c1
458 nmdc:mga08x19_801801_c1
459 Ga0495601_0963460
460 Ga0495612_0131146
461 Ga0495595_0665353
462 Ga0495619_0179233
463 Ga0495619_0510992
464 Ga0466962_0093912

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jqy-assembly1.cif.gz_A crystal structure of n-terminal domain of vapb46 antitoxin from mycobacterium tuberculosis 0.8393 2 43
3k6q-assembly2.cif.gz_D crystal structure of an antitoxin part of a putative toxin/antitoxin system (swol_0700) from syntrophomonas wolfei subsp. wolfei at 1.80 a resolution 0.8319 4 42
4zlx-assembly1.cif.gz_B n-terminal dna binding domain of the antitoxin phd from phage p1 0.8296 1 42
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.8254 28 42
6jqy-assembly1.cif.gz_A crystal structure of n-terminal domain of vapb46 antitoxin from mycobacterium tuberculosis 0.7775 2 43
ID Description Score Start End Superfamily
af_P9WF13_12_52_3.40.1620.10 Alpha Beta;3-Layer(aba) Sandwich;YefM-like fold;YefM-like domain 0.9292 4 43 3.40.1620.10
af_P9WF17_1_43_3.40.1620.10 Alpha Beta;3-Layer(aba) Sandwich;YefM-like fold;YefM-like domain 0.8913 5 45 3.40.1620.10
3g5oA01 Alpha Beta;3-Layer(aba) Sandwich;YefM-like fold;YefM-like domain 0.8726 1 42 3.40.1620.10
af_P9WF13_12_52_3.40.1620.10 Alpha Beta;3-Layer(aba) Sandwich;YefM-like fold;YefM-like domain 0.869 4 43 3.40.1620.10
3d55D01 Alpha Beta;3-Layer(aba) Sandwich;YefM-like fold;YefM-like domain 0.8654 4 42 3.40.1620.10
ID Description Score Start End GO Terms
AF-A0A2M7U635-F1-model_v4 Antitoxin 0.9984 3 42
AF-A0A1J4ZTC3-F1-model_v4 Antitoxin 0.9434 1 44
AF-I0CEK6-F1-model_v4 Antitoxin 0.9269 3 46
AF-A0A6B0XQM1-F1-model_v4 Uncharacterized protein 0.9259 1 45
AF-A0A2H0UAW8-F1-model_v4 Antitoxin 0.924 2 48

Map