F344873

General Info

Members Datasets Scaffolds Average Seq Length
232 127 228 285

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100173408|Ga0068864_1001734082
Length 311
Sequence LTEAVVRTEVHGPRWQALAVLVFGACVIGLSPILVRLAEAGPAAAGFWRLAFAMPILAIMTRRTDGPLRKPSKIALIAGLMFTLDLGFWHYGIKFTSVTNATVLSNLTPVVVTVFAWIFLKQRPRALFLLAVAVAVGGAWMMAIGKGGGDHLVNPPLGNLLSATTALWYALYFLAIAEGRKRESASRLMFWSTVVGMPLLLIAAMASGEQVIPTGLGGWGACLGLGLMHVAGQGSIAWAMGRLPTATASVVVLVQPVVAAWLGWVLFAESIGPLQAAGAGVALFGVVLAQWASRPPKDSRSTFGGAVSEAD

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
105 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
106 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
123 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
124 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
125 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
126 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
127 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.6
Nodule 0.43
Rhizoplane 6.03
Rhizosphere 83.62
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10035676 3300003794 Bacteria 1551
2 Ga0065165_1000331 3300005262 Bacteria 77276
3 Ga0065165_1020870 3300005262 Bacteria 2291
4 Ga0070658_10032108 3300005327 Bacteria 4221
5 Ga0070670_100000035 3300005331 Bacteria 157570
6 Ga0070670_100100068 3300005331 Bacteria 2495
7 Ga0070680_100267751 3300005336 Bacteria 1446
8 Ga0070680_100294561 3300005336 Unclassified 1375
9 Ga0070660_100012196 3300005339 Bacteria 6136
10 Ga0070660_100024813 3300005339 Bacteria 4452
11 Ga0070668_100001477 3300005347 Bacteria 16977
12 Ga0070668_100002182 3300005347 Bacteria 14344
13 Ga0070668_100003111 3300005347 Bacteria 12253
14 Ga0070668_100004551 3300005347 Bacteria 10281
15 Ga0070668_100111038 3300005347 Bacteria 2182
16 Ga0070671_100054644 3300005355 Bacteria 3320
17 Ga0070671_100066073 3300005355 Bacteria 3014
18 Ga0070673_100079164 3300005364 Bacteria 2660
19 Ga0070659_100000553 3300005366 Bacteria 27361
20 Ga0070659_100029633 3300005366 Bacteria 4230
21 Ga0070659_100032264 3300005366 Bacteria 4061
22 Ga0070667_100000711 3300005367 Bacteria 32094
23 Ga0070667_100006239 3300005367 Bacteria 9916
24 Ga0070667_100012708 3300005367 Bacteria 6961
25 Ga0070681_10001467 3300005458 Bacteria 20801
26 Ga0070681_10344453 3300005458 Bacteria 1400
27 Ga0070681_10506440 3300005458 Bacteria 1120
28 Ga0070698_100406468 3300005471 Bacteria 1295
29 Ga0070679_100083333 3300005530 Bacteria 3186
30 Ga0068853_100020174 3300005539 Bacteria 5540
31 Ga0070665_100000433 3300005548 Bacteria 60988
32 Ga0070665_100001010 3300005548 Bacteria 35486
33 Ga0070665_100006544 3300005548 Bacteria 11837
34 Ga0068855_100060548 3300005563 Bacteria 4427
35 Ga0068855_100061653 3300005563 Bacteria 4381
36 Ga0068855_100064732 3300005563 Bacteria 4264
37 Ga0068855_100066076 3300005563 Bacteria 4216
38 Ga0068855_100353851 3300005563 Bacteria 1617
39 Ga0068854_100105982 3300005578 Bacteria 2114
40 Ga0068854_100259502 3300005578 Bacteria 1391
41 Ga0068856_100196707 3300005614 Bacteria 2030
42 Ga0068856_100228124 3300005614 Bacteria 1878
43 Ga0068859_100003513 3300005617 Bacteria 15963
44 Ga0068859_100023142 3300005617 Bacteria 6233
45 Ga0068864_100000102 3300005618 Bacteria 82743
46 Ga0068864_100000165 3300005618 Bacteria 60874
47 Ga0068864_100003190 3300005618 Bacteria 13563
48 Ga0068864_100111701 3300005618 Bacteria 2435
49 Ga0068864_100173408 3300005618 Bacteria 1968
50 Ga0068861_100137951 3300005719 Bacteria 1987
51 Ga0068863_100000128 3300005841 Bacteria 79841
52 Ga0068863_100002006 3300005841 Bacteria 20201
53 Ga0068858_100004655 3300005842 Bacteria 13446
54 Ga0068860_100000100 3300005843 Bacteria 144580
55 Ga0068860_100000157 3300005843 Bacteria 110717
56 Ga0068860_100054514 3300005843 Bacteria 3800
57 Ga0068860_100300622 3300005843 Bacteria 1572
58 Ga0068862_100000368 3300005844 Bacteria 48907
59 Ga0068862_100002848 3300005844 Bacteria 15165
60 Ga0068862_100033565 3300005844 Bacteria 4339
61 Ga0068862_100106884 3300005844 Bacteria 2454
62 Ga0068862_100224766 3300005844 Bacteria 1701
63 Ga0075362_10043428 3300006177 Bacteria 1990
64 Ga0097621_100046200 3300006237 Bacteria 3522
65 Ga0068865_100003733 3300006881 Bacteria 9146
66 Ga0068865_100088614 3300006881 Bacteria 2239
67 Ga0097620_100003513 3300006931 Bacteria 15963
68 Ga0097620_100023142 3300006931 Bacteria 6233
69 Ga0079104_1028134 3300006946 Bacteria 1432
70 Ga0105250_10009810 3300009092 Bacteria 4021
71 Ga0105240_10002462 3300009093 Bacteria 29759
72 Ga0105240_10033911 3300009093 Bacteria 6591
73 Ga0105240_10037044 3300009093 Bacteria 6270
74 Ga0105241_10080878 3300009174 Bacteria 2544
75 Ga0105248_10000106 3300009177 Bacteria 93898
76 Ga0105248_10028850 3300009177 Bacteria 6185
77 Ga0105248_10037520 3300009177 Bacteria 5422
78 Ga0105248_10102694 3300009177 Bacteria 3222
79 Ga0105238_10036921 3300009551 Bacteria 4969
80 Ga0105238_10215398 3300009551 Bacteria 1897
81 Ga0105238_10226019 3300009551 Bacteria 1848
82 Ga0105238_10357192 3300009551 Bacteria 1450
83 Ga0105249_10000525 3300009553 Bacteria 35250
84 Ga0105249_10374177 3300009553 Bacteria 1449
85 Ga0105239_10138980 3300010375 Bacteria 2706
86 Ga0157373_10014255 3300013100 Bacteria 5830
87 Ga0157373_10014307 3300013100 Bacteria 5817
88 Ga0157370_10233108 3300013104 Bacteria 1703
89 Ga0163162_10280979 3300013306 Bacteria 1797
90 Ga0163163_10008143 3300014325 Bacteria 9295
91 Ga0163163_10164307 3300014325 Bacteria 2266
92 Ga0163163_10182609 3300014325 Bacteria 2145
93 Ga0163163_10759796 3300014325 Bacteria 1033
94 Ga0157379_10277254 3300014968 Bacteria 1525
95 Ga0213872_10090268 3300021361 Bacteria 1372
96 Ga0209026_1001873 3300025250 Bacteria 8574
97 Ga0209758_1000334 3300025297 Bacteria 88149
98 Ga0209050_1000130 3300025298 Bacteria 186070
99 Ga0209257_1000059 3300025304 Bacteria 378097
100 Ga0207680_10252019 3300025903 Bacteria 1220
101 Ga0207707_10227714 3300025912 Bacteria 1622
102 Ga0207707_10370479 3300025912 Bacteria 1232
103 Ga0207695_10000237 3300025913 Bacteria 145476
104 Ga0207695_10001222 3300025913 Bacteria 44042
105 Ga0207695_10026883 3300025913 Bacteria 6416
106 Ga0207695_10051583 3300025913 Bacteria 4317
107 Ga0207695_10140156 3300025913 Bacteria 2367
108 Ga0207660_10043685 3300025917 Bacteria 3149
109 Ga0207660_10076016 3300025917 Bacteria 2455
110 Ga0207657_10000314 3300025919 Bacteria 51222
111 Ga0207657_10013900 3300025919 Bacteria 7877
112 Ga0207657_10054813 3300025919 Bacteria 3446
113 Ga0207694_10095760 3300025924 Bacteria 2347
114 Ga0207694_10238875 3300025924 Bacteria 1485
115 Ga0207650_10000350 3300025925 Bacteria 44409
116 Ga0207650_10030183 3300025925 Bacteria 3903
117 Ga0207650_10134220 3300025925 Bacteria 1940
118 Ga0207687_10061108 3300025927 Bacteria 2660
119 Ga0207644_10015356 3300025931 Bacteria 5138
120 Ga0207644_10127070 3300025931 Bacteria 1947
121 Ga0207690_10000159 3300025932 Bacteria 52852
122 Ga0207690_10005002 3300025932 Bacteria 7829
123 Ga0207704_10011758 3300025938 Bacteria 4323
124 Ga0207711_10000098 3300025941 Bacteria 92296
125 Ga0207711_10004912 3300025941 Bacteria 11352
126 Ga0207711_10228802 3300025941 Bacteria 1702
127 Ga0207711_10320814 3300025941 Bacteria 1431
128 Ga0207689_10079457 3300025942 Bacteria 2696
129 Ga0207667_10010250 3300025949 Bacteria 10971
130 Ga0207667_10112400 3300025949 Bacteria 2809
131 Ga0207712_10368636 3300025961 Bacteria 1198
132 Ga0207668_10000025 3300025972 Bacteria 131733
133 Ga0207668_10000035 3300025972 Bacteria 119182
134 Ga0207668_10003496 3300025972 Bacteria 9226
135 Ga0207668_10016710 3300025972 Bacteria 4585
136 Ga0207640_10155916 3300025981 Bacteria 1683
137 Ga0207640_10223627 3300025981 Bacteria 1443
138 Ga0207658_10000300 3300025986 Bacteria 51413
139 Ga0207658_10001621 3300025986 Bacteria 17264
140 Ga0207658_10436200 3300025986 Bacteria 1157
141 Ga0207703_10000726 3300026035 Bacteria 32431
142 Ga0207639_10272055 3300026041 Bacteria 1486
143 Ga0207702_10124596 3300026078 Bacteria 2311
144 Ga0207641_10000005 3300026088 Bacteria 470841
145 Ga0207641_10016442 3300026088 Bacteria 6058
146 Ga0207676_10000066 3300026095 Bacteria 105425
147 Ga0207676_10001155 3300026095 Bacteria 19868
148 Ga0207676_10007091 3300026095 Bacteria 7944
149 Ga0207675_100240513 3300026118 Bacteria 1749
150 Ga0207698_10106964 3300026142 Bacteria 2334
151 Ga0268266_10000003 3300028379 Bacteria 1701703
152 Ga0268266_10002311 3300028379 Bacteria 20672
153 Ga0268266_10004865 3300028379 Bacteria 12740
154 Ga0268266_10012482 3300028379 Bacteria 7342
155 Ga0268265_10002131 3300028380 Bacteria 15346
156 Ga0268265_10007958 3300028380 Bacteria 7156
157 Ga0268265_10014709 3300028380 Bacteria 5338
158 Ga0268265_10055047 3300028380 Bacteria 3021
159 Ga0268265_10093039 3300028380 Bacteria 2414
160 Ga0268264_10000002 3300028381 Bacteria 1153045
161 Ga0268264_10000211 3300028381 Bacteria 117108
162 Ga0268264_10020569 3300028381 Bacteria 5392
163 Ga0265326_10018995 3300028558 Bacteria 1977
164 Ga0307517_10003359 3300028786 Bacteria 24912
165 Ga0265338_10036862 3300028800 Bacteria 4669
166 Ga0265327_10114553 3300031251 Bacteria 1284
167 Ga0307513_10005351 3300031456 Bacteria 16974
168 Ga0307513_10010060 3300031456 Bacteria 11913
169 Ga0265314_10029775 3300031711 Bacteria 4053
170 Ga0307516_10000019 3300031730 Bacteria 196679
171 Ga0307413_10089034 3300031824 Bacteria 2004
172 Ga0307411_10385336 3300032005 Bacteria 1154
173 Ga0307510_10053330 3300033180 Bacteria 4252
174 Ga0373936_0046992 3300035113 Bacteria 1740
175 Ga0373927_0001359 3300035695 Bacteria 18441
176 Ga0373925_0000032 3300037068 Bacteria 145357
177 Ga0395899_0000018 3300037312 Bacteria 423194
178 Ga0395899_0000680 3300037312 Bacteria 34408
179 Ga0395899_0281899 3300037312 Bacteria 1130
180 Ga0395900_0000111 3300037418 Bacteria 145390
181 Ga0395900_0235213 3300037418 Bacteria 1840
182 Ga0395900_0303086 3300037418 Bacteria 1583
183 Ga0395898_0155802 3300037466 Bacteria 2185
184 Ga0395898_0235871 3300037466 Bacteria 1744
185 Ga0395905_0018478 3300037471 Bacteria 6616
186 Ga0395905_0039591 3300037471 Bacteria 4422
187 Ga0395901_0000032 3300038443 Bacteria 235172
188 Ga0395901_0246523 3300038443 Bacteria 1862
189 Ga0436361_0992833 3300039447 Bacteria 3516
190 Ga0453684_0274985 3300044712 Bacteria 1923
191 Ga0495642_0005332 3300046528 Bacteria 4931
192 Ga0495642_0127080 3300046528 Bacteria 1096
193 Ga0495645_0130086 3300046543 Bacteria 1765
194 Ga0495668_0023247 3300046616 Bacteria 3538
195 Ga0495668_0036907 3300046616 Bacteria 2737
196 Ga0495669_0000012 3300046684 Bacteria 157373
197 Ga0495669_0000250 3300046684 Bacteria 31432
198 Ga0495669_0021117 3300046684 Bacteria 2823
199 Ga0495672_0060679 3300047320 Bacteria 2183
200 Ga0495677_0041365 3300047445 Bacteria 1686
201 Ga0495677_0070610 3300047445 Bacteria 1301
202 Ga0495686_0007283 3300047472 Bacteria 8318
203 Ga0496101_0043111 3300048904 Bacteria 3223
204 Ga0496102_0018777 3300048905 Bacteria 6081
205 Ga0496102_0147187 3300048905 Bacteria 2211
206 Ga0496103_0078448 3300048906 Bacteria 2074
207 Ga0496106_0085205 3300048909 Bacteria 2433
208 Ga0496106_0243708 3300048909 Bacteria 1436
209 Ga0496108_0053899 3300048911 Bacteria 3374
210 Ga0496109_0006327 3300048912 Bacteria 9973
211 Ga0496110_0117697 3300048913 Bacteria 2393
212 Ga0496112_0082470 3300048915 Bacteria 3180
213 Ga0496112_0373517 3300048915 Bacteria 1367
214 Ga0496113_0079183 3300048916 Bacteria 2515
215 Ga0496115_0000465 3300048918 Bacteria 32318
216 Ga0496115_0231780 3300048918 Bacteria 1522
217 Ga0501037_0189882 3300049573 Bacteria 1455
218 Ga0501047_0000771 3300049581 Bacteria 33529
219 Ga0501047_0214411 3300049581 Bacteria 1783
220 Ga0501047_0260036 3300049581 Bacteria 1584
221 Ga0501035_0172425 3300049822 Bacteria 1868
222 Ga0501044_0116331 3300049823 Bacteria 2679
223 Ga0500635_0000048 3300053080 Bacteria 80957
224 Ga0500555_000530 3300053103 Bacteria 15216
225 Ga0500595_046565 3300053119 Bacteria 1363
226 Ga0500636_0013347 3300053177 Bacteria 4824
227 Ga0500637_0071750 3300053178 Bacteria 1991
228 Ga0500645_020663 3300053730 Bacteria 2038

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005367 Ga0070667_100000711 Ga0070667_10000071129 236
2 3300005844 Ga0068862_100000368 Ga0068862_10000036823 236
3 3300025903 Ga0207680_10252019 Ga0207680_102520192 236
4 3300025986 Ga0207658_10000300 Ga0207658_1000030037 236
5 3300028380 Ga0268265_10002131 Ga0268265_1000213115 236
6 3300005331 Ga0070670_100000035 Ga0070670_100000035129 250
7 3300005347 Ga0070668_100002182 Ga0070668_1000021824 250
8 3300005548 Ga0070665_100006544 Ga0070665_1000065446 250
9 3300005618 Ga0068864_100000102 Ga0068864_10000010276 250
10 3300005841 Ga0068863_100002006 Ga0068863_10000200612 250
11 3300009553 Ga0105249_10000525 Ga0105249_1000052522 250
12 3300014325 Ga0163163_10759796 Ga0163163_107597962 250
13 3300014968 Ga0157379_10277254 Ga0157379_102772542 250
14 3300025925 Ga0207650_10000350 Ga0207650_1000035040 250
15 3300025972 Ga0207668_10000035 Ga0207668_10000035123 250
16 3300026095 Ga0207676_10000066 Ga0207676_10000066104 250
17 3300028379 Ga0268266_10004865 Ga0268266_1000486512 250
18 3300048905 Ga0496102_0018777 Ga0496102_0018777_851_1678 250
19 3300048906 Ga0496103_0078448 Ga0496103_0078448_1127_1954 250
20 3300048909 Ga0496106_0243708 Ga0496106_0243708_502_1329 250
21 3300037418 Ga0395900_0235213 Ga0395900_0235213_733_1617 256
22 3300005842 Ga0068858_100004655 Ga0068858_1000046559 258
23 3300009177 Ga0105248_10102694 Ga0105248_101026943 258
24 3300025941 Ga0207711_10004912 Ga0207711_1000491216 258
25 3300026035 Ga0207703_10000726 Ga0207703_1000072626 258
26 3300005331 Ga0070670_100100068 Ga0070670_1001000682 259
27 3300005618 Ga0068864_100000165 Ga0068864_10000016540 259
28 3300005841 Ga0068863_100000128 Ga0068863_10000012835 259
29 3300009092 Ga0105250_10009810 Ga0105250_100098103 259
30 3300025925 Ga0207650_10134220 Ga0207650_101342202 259
31 3300026088 Ga0207641_10000005 Ga0207641_10000005417 259
32 3300026095 Ga0207676_10001155 Ga0207676_100011558 259
33 3300037466 Ga0395898_0235871 Ga0395898_0235871_408_1292 259
34 3300048918 Ga0496115_0000465 Ga0496115_0000465_14981_15910 259
35 3300049573 Ga0501037_0189882 Ga0501037_0189882_15_878 259
36 3300005339 Ga0070660_100012196 Ga0070660_1000121962 262
37 3300005366 Ga0070659_100000553 Ga0070659_10000055315 262
38 3300025919 Ga0207657_10013900 Ga0207657_100139007 262
39 3300025932 Ga0207690_10000159 Ga0207690_1000015921 262
40 3300046528 Ga0495642_0005332 Ga0495642_0005332_2000_2884 263
41 3300047445 Ga0495677_0041365 Ga0495677_0041365_646_1530 263
42 3300005617 Ga0068859_100023142 Ga0068859_1000231428 264
43 3300006931 Ga0097620_100023142 Ga0097620_1000231428 264
44 3300025961 Ga0207712_10368636 Ga0207712_103686361 264
45 3300031730 Ga0307516_10000019 Ga0307516_10000019133 265
46 3300035695 Ga0373927_0001359 Ga0373927_0001359_3623_4495 265
47 3300037068 Ga0373925_0000032 Ga0373925_0000032_129126_129998 265
48 3300005843 Ga0068860_100000157 Ga0068860_100000157116 266
49 3300009177 Ga0105248_10028850 Ga0105248_100288502 266
50 3300028381 Ga0268264_10000211 Ga0268264_1000021137 266
51 3300046543 Ga0495645_0130086 Ga0495645_0130086_47_895 268
52 3300035113 Ga0373936_0046992 Ga0373936_0046992_420_1316 269
53 3300046684 Ga0495669_0000250 Ga0495669_0000250_19486_20376 269
54 3300047445 Ga0495677_0070610 Ga0495677_0070610_357_1247 269
55 3300009177 Ga0105248_10000106 Ga0105248_1000010667 270
56 3300025941 Ga0207711_10000098 Ga0207711_1000009825 270
57 3300053119 Ga0500595_046565 Ga0500595_046565_111_1013 270
58 3300005347 Ga0070668_100111038 Ga0070668_1001110382 271
59 3300006946 Ga0079104_1028134 Ga0079104_10281342 271
60 3300009551 Ga0105238_10357192 Ga0105238_103571922 271
61 3300021361 Ga0213872_10090268 Ga0213872_100902682 271
62 3300005614 Ga0068856_100228124 Ga0068856_1002281242 272
63 3300053080 Ga0500635_0000048 Ga0500635_0000048_1980_2858 272
64 3300053177 Ga0500636_0013347 Ga0500636_0013347_106_984 272
65 3300053178 Ga0500637_0071750 Ga0500637_0071750_139_1017 272
66 3300005366 Ga0070659_100032264 Ga0070659_1000322645 273
67 3300005458 Ga0070681_10001467 Ga0070681_1000146715 273
68 3300005539 Ga0068853_100020174 Ga0068853_1000201743 273
69 3300005563 Ga0068855_100066076 Ga0068855_1000660762 273
70 3300025912 Ga0207707_10227714 Ga0207707_102277142 273
71 3300025917 Ga0207660_10076016 Ga0207660_100760162 273
72 3300025919 Ga0207657_10000314 Ga0207657_100003146 273
73 3300049581 Ga0501047_0214411 Ga0501047_0214411_802_1716 274
74 3300049822 Ga0501035_0172425 Ga0501035_0172425_523_1437 274
75 3300049823 Ga0501044_0116331 Ga0501044_0116331_988_1902 274
76 3300005339 Ga0070660_100024813 Ga0070660_1000248134 275
77 3300009093 Ga0105240_10002462 Ga0105240_1000246228 275
78 3300025913 Ga0207695_10001222 Ga0207695_1000122216 275
79 3300025919 Ga0207657_10054813 Ga0207657_100548132 275
80 3300005347 Ga0070668_100003111 Ga0070668_10000311112 276
81 3300005367 Ga0070667_100012708 Ga0070667_1000127085 276
82 3300005548 Ga0070665_100001010 Ga0070665_10000101029 276
83 3300005843 Ga0068860_100300622 Ga0068860_1003006222 276
84 3300005844 Ga0068862_100106884 Ga0068862_1001068842 276
85 3300006881 Ga0068865_100003733 Ga0068865_1000037332 276
86 3300010375 Ga0105239_10138980 Ga0105239_101389802 276
87 3300013306 Ga0163162_10280979 Ga0163162_102809792 276
88 3300025938 Ga0207704_10011758 Ga0207704_100117584 276
89 3300025972 Ga0207668_10000025 Ga0207668_1000002528 276
90 3300025986 Ga0207658_10001621 Ga0207658_1000162111 276
91 3300028379 Ga0268266_10002311 Ga0268266_1000231117 276
92 3300028380 Ga0268265_10055047 Ga0268265_100550472 276
93 3300028786 Ga0307517_10003359 Ga0307517_1000335922 276
94 3300031456 Ga0307513_10010060 Ga0307513_100100609 276
95 3300005327 Ga0070658_10032108 Ga0070658_100321082 277
96 3300049581 Ga0501047_0000771 Ga0501047_0000771_18736_19629 277
97 3300025924 Ga0207694_10238875 Ga0207694_102388752 278
98 3300028558 Ga0265326_10018995 Ga0265326_100189952 278
99 3300031251 Ga0265327_10114553 Ga0265327_101145531 278
100 3300031711 Ga0265314_10029775 Ga0265314_100297752 278
101 3300048918 Ga0496115_0231780 Ga0496115_0231780_424_1329 278
102 3300005347 Ga0070668_100001477 Ga0070668_1000014779 279
103 3300005844 Ga0068862_100002848 Ga0068862_1000028485 279
104 3300025972 Ga0207668_10003496 Ga0207668_1000349610 279
105 3300028380 Ga0268265_10093039 Ga0268265_100930392 279
106 3300046684 Ga0495669_0000012 Ga0495669_0000012_43025_43882 279
107 3300025941 Ga0207711_10228802 Ga0207711_102288021 280
108 3300005262 Ga0065165_1020870 Ga0065165_10208702 282
109 3300005548 Ga0070665_100000433 Ga0070665_10000043362 282
110 3300028379 Ga0268266_10000003 Ga0268266_10000003545 282
111 3300049581 Ga0501047_0260036 Ga0501047_0260036_20_889 282
112 3300009093 Ga0105240_10037044 Ga0105240_100370442 283
113 3300025913 Ga0207695_10140156 Ga0207695_101401563 283
114 3300053103 Ga0500555_000530 Ga0500555_000530_7063_7941 283
115 3300046616 Ga0495668_0023247 Ga0495668_0023247_755_1648 284
116 3300005563 Ga0068855_100060548 Ga0068855_1000605488 285
117 3300009093 Ga0105240_10033911 Ga0105240_100339114 285
118 3300013100 Ga0157373_10014255 Ga0157373_100142555 285
119 3300013100 Ga0157373_10014307 Ga0157373_100143075 285
120 3300025913 Ga0207695_10051583 Ga0207695_100515832 285
121 3300025949 Ga0207667_10112400 Ga0207667_101124003 285
122 3300037312 Ga0395899_0000680 Ga0395899_0000680_2175_3053 285
123 3300037418 Ga0395900_0000111 Ga0395900_0000111_22545_23423 285
124 3300037471 Ga0395905_0039591 Ga0395905_0039591_2750_3628 285
125 3300038443 Ga0395901_0000032 Ga0395901_0000032_200455_201333 285
126 iso_pu_bacteria 2643221614 2644086691 285
127 iso_pu_bacteria 2643221661 2644341645 285
128 iso_pu_bacteria 2643221666 2644367932 285
129 3300005366 Ga0070659_100029633 Ga0070659_1000296336 286
130 3300025932 Ga0207690_10005002 Ga0207690_1000500213 286
131 3300005578 Ga0068854_100105982 Ga0068854_1001059822 287
132 3300009551 Ga0105238_10226019 Ga0105238_102260192 287
133 3300037312 Ga0395899_0000018 Ga0395899_0000018_252710_253729 287
134 3300005347 Ga0070668_100004551 Ga0070668_1000045516 288
135 3300005355 Ga0070671_100066073 Ga0070671_1000660733 288
136 3300005367 Ga0070667_100006239 Ga0070667_10000623910 288
137 3300005617 Ga0068859_100003513 Ga0068859_1000035137 288
138 3300005618 Ga0068864_100111701 Ga0068864_1001117012 288
139 3300005719 Ga0068861_100137951 Ga0068861_1001379512 288
140 3300005843 Ga0068860_100000100 Ga0068860_10000010074 288
141 3300005843 Ga0068860_100054514 Ga0068860_1000545142 288
142 3300005844 Ga0068862_100033565 Ga0068862_1000335652 288
143 3300005844 Ga0068862_100224766 Ga0068862_1002247662 288
144 3300006931 Ga0097620_100003513 Ga0097620_1000035137 288
145 3300025925 Ga0207650_10030183 Ga0207650_100301835 288
146 3300025931 Ga0207644_10127070 Ga0207644_101270702 288
147 3300025972 Ga0207668_10016710 Ga0207668_100167105 288
148 3300025986 Ga0207658_10436200 Ga0207658_104362002 288
149 3300026088 Ga0207641_10016442 Ga0207641_100164422 288
150 3300026118 Ga0207675_100240513 Ga0207675_1002405132 288
151 3300028380 Ga0268265_10007958 Ga0268265_100079582 288
152 3300028380 Ga0268265_10014709 Ga0268265_100147098 288
153 3300028381 Ga0268264_10000002 Ga0268264_10000002764 288
154 3300028381 Ga0268264_10020569 Ga0268264_100205694 288
155 3300033180 Ga0307510_10053330 Ga0307510_100533303 288
156 iso_pu_bacteria 2643221598 2643998441 288
157 3300005563 Ga0068855_100064732 Ga0068855_1000647323 289
158 3300005614 Ga0068856_100196707 Ga0068856_1001967072 289
159 3300025942 Ga0207689_10079457 Ga0207689_100794573 289
160 3300026078 Ga0207702_10124596 Ga0207702_101245962 289
161 3300031456 Ga0307513_10005351 Ga0307513_100053514 289
162 3300039447 Ga0436361_0992833 Ga0436361_0992833_2356_3327 289
163 3300009553 Ga0105249_10374177 Ga0105249_103741772 290
164 3300005336 Ga0070680_100267751 Ga0070680_1002677512 291
165 3300005458 Ga0070681_10506440 Ga0070681_105064401 291
166 3300005563 Ga0068855_100353851 Ga0068855_1003538512 291
167 3300005578 Ga0068854_100259502 Ga0068854_1002595022 291
168 3300005618 Ga0068864_100173408 Ga0068864_1001734082 291
169 3300014325 Ga0163163_10008143 Ga0163163_100081438 291
170 3300025912 Ga0207707_10370479 Ga0207707_103704791 291
171 3300025913 Ga0207695_10026883 Ga0207695_100268837 291
172 3300025917 Ga0207660_10043685 Ga0207660_100436854 291
173 3300025949 Ga0207667_10010250 Ga0207667_100102505 291
174 3300025981 Ga0207640_10223627 Ga0207640_102236272 291
175 3300026142 Ga0207698_10106964 Ga0207698_101069642 291
176 3300006881 Ga0068865_100088614 Ga0068865_1000886143 292
177 3300009551 Ga0105238_10215398 Ga0105238_102153982 292
178 3300013104 Ga0157370_10233108 Ga0157370_102331082 292
179 3300025913 Ga0207695_10000237 Ga0207695_10000237143 292
180 3300025981 Ga0207640_10155916 Ga0207640_101559162 292
181 3300028800 Ga0265338_10036862 Ga0265338_100368624 292
182 3300005336 Ga0070680_100294561 Ga0070680_1002945611 293
183 3300005458 Ga0070681_10344453 Ga0070681_103444531 293
184 3300005530 Ga0070679_100083333 Ga0070679_1000833333 293
185 3300005563 Ga0068855_100061653 Ga0068855_1000616533 293
186 3300005355 Ga0070671_100054644 Ga0070671_1000546442 294
187 3300005364 Ga0070673_100079164 Ga0070673_1000791642 294
188 3300005471 Ga0070698_100406468 Ga0070698_1004064681 294
189 3300005618 Ga0068864_100003190 Ga0068864_1000031903 294
190 3300006237 Ga0097621_100046200 Ga0097621_1000462002 294
191 3300009174 Ga0105241_10080878 Ga0105241_100808782 294
192 3300009177 Ga0105248_10037520 Ga0105248_100375203 294
193 3300014325 Ga0163163_10182609 Ga0163163_101826092 294
194 3300025250 Ga0209026_1001873 Ga0209026_10018732 294
195 3300025924 Ga0207694_10095760 Ga0207694_100957602 294
196 3300025927 Ga0207687_10061108 Ga0207687_100611084 294
197 3300025931 Ga0207644_10015356 Ga0207644_100153565 294
198 3300025941 Ga0207711_10320814 Ga0207711_103208142 294
199 3300026041 Ga0207639_10272055 Ga0207639_102720552 294
200 3300026095 Ga0207676_10007091 Ga0207676_100070916 294
201 3300028379 Ga0268266_10012482 Ga0268266_100124825 294
202 3300037312 Ga0395899_0281899 Ga0395899_0281899_138_1043 294
203 3300037418 Ga0395900_0303086 Ga0395900_0303086_27_941 294
204 3300037466 Ga0395898_0155802 Ga0395898_0155802_516_1430 294
205 3300037471 Ga0395905_0018478 Ga0395905_0018478_3134_4039 294
206 3300038443 Ga0395901_0246523 Ga0395901_0246523_442_1356 294
207 3300044712 Ga0453684_0274985 Ga0453684_0274985_189_1082 294
208 3300046528 Ga0495642_0127080 Ga0495642_0127080_106_1017 294
209 3300046616 Ga0495668_0036907 Ga0495668_0036907_1335_2243 294
210 3300046684 Ga0495669_0021117 Ga0495669_0021117_177_1088 294
211 3300047472 Ga0495686_0007283 Ga0495686_0007283_3173_4066 294
212 3300048904 Ga0496101_0043111 Ga0496101_0043111_1110_2021 294
213 3300048905 Ga0496102_0147187 Ga0496102_0147187_1066_1977 294
214 3300048909 Ga0496106_0085205 Ga0496106_0085205_1154_2065 294
215 3300048911 Ga0496108_0053899 Ga0496108_0053899_933_1844 294
216 3300048912 Ga0496109_0006327 Ga0496109_0006327_371_1282 294
217 3300048913 Ga0496110_0117697 Ga0496110_0117697_1020_1931 294
218 3300048915 Ga0496112_0082470 Ga0496112_0082470_1106_2017 294
219 3300048915 Ga0496112_0373517 Ga0496112_0373517_193_1104 294
220 3300048916 Ga0496113_0079183 Ga0496113_0079183_1557_2468 294
221 3300053730 Ga0500645_020663 Ga0500645_020663_545_1438 294
222 3300003794 Ga0055531_10035676 Ga0055531_100356762 295
223 3300005262 Ga0065165_1000331 Ga0065165_100033114 295
224 3300006177 Ga0075362_10043428 Ga0075362_100434281 295
225 3300009551 Ga0105238_10036921 Ga0105238_100369212 295
226 3300014325 Ga0163163_10164307 Ga0163163_101643072 295
227 3300025297 Ga0209758_1000334 Ga0209758_100033434 295
228 3300025298 Ga0209050_1000130 Ga0209050_1000130103 295
229 3300025304 Ga0209257_1000059 Ga0209257_1000059298 295
230 3300031824 Ga0307413_10089034 Ga0307413_100890342 295
231 3300032005 Ga0307411_10385336 Ga0307411_103853361 295
232 3300047320 Ga0495672_0060679 Ga0495672_0060679_925_1836 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

156

291

0.94

PF00892

EamA

EamA-like transporter family

15

144

0.89

PF06027

SLC35F

Solute carrier family 35

89

204

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7835 12 293
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.7818 212 287
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7512 12 293
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7418 17 287
7b0k-assembly1.cif.gz_A membrane protein structure 0.7386 17 287
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8768 21 289 1.20.1740.10
af_G4S7C7_57_179_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8387 203 288 1.10.3730.20
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8016 21 289 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7941 13 294 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7882 16 290 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A0Q7S587-F1-model_v4 EamA domain-containing protein 0.9466 9 294 GO:0016020
AF-U2EEG3-F1-model_v4 Transporter Drug-Metabolite Exporter family protein 0.9266 15 294 GO:0016020
AF-A0A2U1F0Y7-F1-model_v4 Threonine/homoserine efflux transporter RhtA 0.9213 12 292 GO:0016020
AF-A0A7Z8GNK2-F1-model_v4 deleted 0.921 15 294
AF-A0A7C6YT11-F1-model_v4 DMT family transporter 0.9208 13 294 GO:0016020

Feature Viewer

pLDDT pTM Quality
84.91 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map