F344556

General Info

Members Datasets Scaffolds Average Seq Length
231 159 221 446

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2671180531|2673167463
Length 510
Sequence SICLVAGIASLVGGLVTFSYGGESWLGWTLTIFGAAASILGFVPDQLLTIFKIPELRKKIFITLIFLAVYRIGYYVPLPMIDQAKMAEKMADAQRGALGQVLGFVSLFSGGNLSNACIFSLGIMPYISASIIVQLLSSGVVPSLEKLRKEGESGRKKLNEITRYLTVPICIIQAIMVVQTVMKPDTGDGGGMGLAPTGYNDGFELWWFGFTAVITLTAGTVLLMWLGEQIDEYGIGNGISLIIMAGIVARIPDATNSLLIDSATGKLKDSVFTLGGGSGADISLEKLIVLAFLFVTVVVGVIAMTKAQRRIPTQSAKHVRGRRVYGGTRQFLPMKVNAAGVMPVIFASTLLILPWFFFNAIYNLSDSSLGWAGTLSTMFQNHRGWLYNFMYVIMIYVFTYFWVAITFNPKEIADNLKDHGSFIPGYRPGKKTADYLERVLMRVTFVGAAFLAIIAIIPNVISSELEIPVQVASFYGGTGLLIVISVALDLVQKINSHLVMRNYPSLTDET

Samples

Sample ID Description Type Environment
1 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
2 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
3 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
4 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
5 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
6 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
7 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
8 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
9 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
129 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
130 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
157 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.67
Metatranscriptomes 0
Isolates 4.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.3
Nodule 0
Rhizoplane 3.46
Rhizosphere 89.61
Stem 0
Stem Tuber 0
Unclassified 5.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1005404 3300003781 Bacteria 6259
2 Ga0065707_10102079 3300005295 Bacteria 2827
3 Ga0070658_10000605 3300005327 Bacteria 31083
4 Ga0070670_100021899 3300005331 Bacteria 5499
5 Ga0070682_100000039 3300005337 Bacteria 144400
6 Ga0070691_10032400 3300005341 Bacteria 2456
7 Ga0070668_100078745 3300005347 Bacteria 2578
8 Ga0070669_100037385 3300005353 Bacteria 3521
9 Ga0070675_100061769 3300005354 Bacteria 3095
10 Ga0070671_100006755 3300005355 Bacteria 9181
11 Ga0070671_100039118 3300005355 Bacteria 3937
12 Ga0070667_100013914 3300005367 Bacteria 6652
13 Ga0070667_100024993 3300005367 Bacteria 4963
14 Ga0070713_100068079 3300005436 Bacteria 3000
15 Ga0070681_10104337 3300005458 Bacteria 2777
16 Ga0070698_100062007 3300005471 Bacteria 3773
17 Ga0068853_100064199 3300005539 Bacteria 3183
18 Ga0070665_100000121 3300005548 Bacteria 147683
19 Ga0070665_100000298 3300005548 Bacteria 77675
20 Ga0070665_100027308 3300005548 Bacteria 5749
21 Ga0070665_100048252 3300005548 Bacteria 4275
22 Ga0068855_100204008 3300005563 Bacteria 2225
23 Ga0068857_100005931 3300005577 Bacteria 10431
24 Ga0068859_100000536 3300005617 Bacteria 37574
25 Ga0068859_100001281 3300005617 Bacteria 25688
26 Ga0068859_100065105 3300005617 Bacteria 3679
27 Ga0068863_100004023 3300005841 Bacteria 14519
28 Ga0068863_100064279 3300005841 Bacteria 3471
29 Ga0068858_100007271 3300005842 Bacteria 10730
30 Ga0068860_100010284 3300005843 Bacteria 9258
31 Ga0068860_100080942 3300005843 Bacteria 3088
32 Ga0068862_100296228 3300005844 Bacteria 1487
33 Ga0081539_10003625 3300005985 Bacteria 18613
34 Ga0075428_100005581 3300006844 Bacteria 13974
35 Ga0075428_100064544 3300006844 Bacteria 4010
36 Ga0075428_100384115 3300006844 Bacteria 1505
37 Ga0075431_100033542 3300006847 Bacteria 5291
38 Ga0075431_100394247 3300006847 Bacteria 1386
39 Ga0075433_10000067 3300006852 Bacteria 45943
40 Ga0097620_100000536 3300006931 Bacteria 37574
41 Ga0097620_100001281 3300006931 Bacteria 25688
42 Ga0097620_100065102 3300006931 Bacteria 3679
43 Ga0105240_10067893 3300009093 Bacteria 4418
44 Ga0105240_10093376 3300009093 Bacteria 3672
45 Ga0111539_10039646 3300009094 Bacteria 5675
46 Ga0111539_10149618 3300009094 Bacteria 2733
47 Ga0111539_10245718 3300009094 Bacteria 2083
48 Ga0111539_10340648 3300009094 Bacteria 1745
49 Ga0105245_10014698 3300009098 Bacteria 6816
50 Ga0105247_10114019 3300009101 Bacteria 1743
51 Ga0105241_10071000 3300009174 Bacteria 2703
52 Ga0105248_10090189 3300009177 Bacteria 3452
53 Ga0105248_10220838 3300009177 Bacteria 2134
54 Ga0105238_10048857 3300009551 Bacteria 4262
55 Ga0105249_10176203 3300009553 Bacteria 2077
56 Ga0105239_10005562 3300010375 Bacteria 14736
57 Ga0157371_10064475 3300013102 Bacteria 2596
58 Ga0157370_10148051 3300013104 Bacteria 2186
59 Ga0157369_10032567 3300013105 Bacteria 5731
60 Ga0157369_10281447 3300013105 Bacteria 1732
61 Ga0157374_10158724 3300013296 Bacteria 2202
62 Ga0157372_10051779 3300013307 Bacteria 4570
63 Ga0157372_10297332 3300013307 Bacteria 1878
64 Ga0157372_10315957 3300013307 Bacteria 1819
65 Ga0163163_10018256 3300014325 Bacteria 6562
66 Ga0157379_10009954 3300014968 Bacteria 8282
67 Ga0213872_10009926 3300021361 Bacteria 4547
68 Ga0207680_10072372 3300025903 Bacteria 2140
69 Ga0207705_10003885 3300025909 Bacteria 11366
70 Ga0207654_10037541 3300025911 Bacteria 2713
71 Ga0207707_10065663 3300025912 Bacteria 3160
72 Ga0207695_10000534 3300025913 Bacteria 79293
73 Ga0207695_10000575 3300025913 Bacteria 74997
74 Ga0207695_10005806 3300025913 Bacteria 16245
75 Ga0207695_10105675 3300025913 Bacteria 2802
76 Ga0207671_10145975 3300025914 Bacteria 1825
77 Ga0207660_10076178 3300025917 Bacteria 2452
78 Ga0207694_10013350 3300025924 Bacteria 6186
79 Ga0207659_10063738 3300025926 Bacteria 2666
80 Ga0207700_10057749 3300025928 Bacteria 2928
81 Ga0207644_10006669 3300025931 Bacteria 7523
82 Ga0207670_10151774 3300025936 Bacteria 1720
83 Ga0207667_10074363 3300025949 Bacteria 3530
84 Ga0207667_10145213 3300025949 Bacteria 2442
85 Ga0207712_10133661 3300025961 Bacteria 1894
86 Ga0207668_10080061 3300025972 Bacteria 2365
87 Ga0207658_10028220 3300025986 Bacteria 3951
88 Ga0207639_10054590 3300026041 Bacteria 3054
89 Ga0207641_10007468 3300026088 Bacteria 9094
90 Ga0207641_10018730 3300026088 Bacteria 5677
91 Ga0207641_10031526 3300026088 Bacteria 4397
92 Ga0207674_10004220 3300026116 Bacteria 17343
93 Ga0207675_100095840 3300026118 Bacteria 2793
94 Ga0209981_1000043 3300027378 Bacteria 12361
95 Ga0209999_1004449 3300027543 Bacteria 2522
96 Ga0268266_10000106 3300028379 Bacteria 175109
97 Ga0268266_10007671 3300028379 Bacteria 9693
98 Ga0268266_10271941 3300028379 Bacteria 1573
99 Ga0268265_10232539 3300028380 Bacteria 1621
100 Ga0268264_10002325 3300028381 Bacteria 16817
101 Ga0307517_10012557 3300028786 Bacteria 11610
102 Ga0307515_10000001 3300028794 Bacteria 4259510
103 Ga0265338_10001162 3300028800 Bacteria 43495
104 Ga0265325_10003872 3300031241 Bacteria 9604
105 Ga0265339_10003333 3300031249 Bacteria 11244
106 Ga0265331_10005570 3300031250 Bacteria 7583
107 Ga0265327_10000159 3300031251 Bacteria 145537
108 Ga0265327_10005226 3300031251 Bacteria 10946
109 Ga0307513_10000162 3300031456 Bacteria 96000
110 Ga0307513_10002446 3300031456 Bacteria 25748
111 Ga0265313_10000050 3300031595 Bacteria 111425
112 Ga0265314_10000306 3300031711 Bacteria 70032
113 Ga0265342_10011241 3300031712 Bacteria 6141
114 Ga0307516_10001565 3300031730 Bacteria 31484
115 Ga0307410_10095083 3300031852 Bacteria 2124
116 Ga0307409_100073044 3300031995 Bacteria 2734
117 Ga0307411_10001861 3300032005 Bacteria 8973
118 Ga0307411_10042528 3300032005 Bacteria 2900
119 Ga0373945_0016240 3300035116 Bacteria 2508
120 Ga0373947_0036894 3300035725 Bacteria 2899
121 Ga0395899_0001195 3300037312 Bacteria 22830
122 Ga0395900_0003408 3300037418 Bacteria 17178
123 Ga0395900_0065728 3300037418 Bacteria 3726
124 Ga0395898_0004322 3300037466 Bacteria 15569
125 Ga0395905_0002819 3300037471 Bacteria 19050
126 Ga0395901_0000342 3300038443 Bacteria 56754
127 Ga0395901_0204468 3300038443 Bacteria 2069
128 Ga0436360_0561605 3300039438 Bacteria 14597
129 Ga0436360_0683763 3300039438 Bacteria 1798
130 Ga0436361_0887939 3300039447 Bacteria 2147
131 Ga0436362_0094217 3300039453 Bacteria 9983
132 Ga0451577_0091473 3300042876 Bacteria 2715
133 Ga0453684_0001061 3300044712 Bacteria 87486
134 Ga0453684_0009769 3300044712 Bacteria 16659
135 Ga0451576_0000298 3300045051 Bacteria 120202
136 Ga0495651_0160248 3300046462 Bacteria 1613
137 Ga0495653_0041661 3300046463 Bacteria 3583
138 Ga0495662_0014703 3300046476 Bacteria 3805
139 Ga0495608_0121914 3300046511 Bacteria 1671
140 Ga0495618_0083867 3300046514 Bacteria 2036
141 Ga0495630_0008235 3300046517 Bacteria 7486
142 Ga0495630_0038028 3300046517 Bacteria 3598
143 Ga0495640_0028934 3300046533 Bacteria 3984
144 Ga0495586_0017815 3300046535 Bacteria 3780
145 Ga0495633_0000510 3300046558 Bacteria 39075
146 Ga0495667_0006866 3300046559 Bacteria 7730
147 Ga0495613_0000576 3300046689 Bacteria 29823
148 Ga0495613_0011010 3300046689 Bacteria 6717
149 Ga0495649_0000981 3300046694 Bacteria 22495
150 Ga0495674_0008030 3300047319 Bacteria 10076
151 Ga0495672_0000511 3300047320 Bacteria 44639
152 Ga0495672_0036820 3300047320 Bacteria 3001
153 Ga0495684_0013498 3300047471 Bacteria 6286
154 Ga0496105_0120570 3300048908 Bacteria 2163
155 Ga0496109_0145062 3300048912 Bacteria 2221
156 Ga0496110_0152607 3300048913 Bacteria 2092
157 Ga0496112_0056397 3300048915 Bacteria 3866
158 Ga0496112_0060193 3300048915 Bacteria 3742
159 Ga0496115_0001049 3300048918 Bacteria 20043
160 Ga0496116_0023211 3300048919 Bacteria 4626
161 Ga0496122_0011257 3300048925 Bacteria 9089
162 Ga0496123_0000699 3300048926 Bacteria 55169
163 Ga0501032_0001915 3300049569 Bacteria 16407
164 Ga0501032_0002071 3300049569 Bacteria 15830
165 Ga0501032_0053318 3300049569 Bacteria 2724
166 Ga0501034_0008844 3300049571 Bacteria 10590
167 Ga0501034_0009576 3300049571 Bacteria 10139
168 Ga0501034_0024133 3300049571 Bacteria 6186
169 Ga0501034_0056418 3300049571 Bacteria 3952
170 Ga0501034_0212549 3300049571 Bacteria 1889
171 Ga0501036_0016999 3300049572 Bacteria 6078
172 Ga0501037_0017093 3300049573 Bacteria 5338
173 Ga0501038_0012817 3300049574 Bacteria 7656
174 Ga0501038_0013604 3300049574 Bacteria 7414
175 Ga0501039_0039757 3300049575 Bacteria 3632
176 Ga0501041_0062448 3300049577 Bacteria 2281
177 Ga0501043_0001446 3300049579 Bacteria 20739
178 Ga0501043_0005548 3300049579 Bacteria 10173
179 Ga0501043_0008633 3300049579 Bacteria 8030
180 Ga0501046_0002539 3300049580 Bacteria 17062
181 Ga0501046_0003325 3300049580 Bacteria 14782
182 Ga0501046_0026523 3300049580 Bacteria 4732
183 Ga0501047_0008706 3300049581 Bacteria 9578
184 Ga0501047_0031616 3300049581 Bacteria 5106
185 Ga0501047_0036320 3300049581 Bacteria 4762
186 Ga0501047_0042192 3300049581 Bacteria 4409
187 Ga0501048_0010340 3300049582 Bacteria 6974
188 Ga0501067_0012398 3300049583 Bacteria 4729
189 Ga0501067_0035163 3300049583 Bacteria 2782
190 Ga0501068_0002132 3300049584 Bacteria 10536
191 Ga0501068_0093701 3300049584 Bacteria 1856
192 Ga0501070_0006209 3300049586 Bacteria 10181
193 Ga0501070_0009038 3300049586 Bacteria 8429
194 Ga0501070_0036924 3300049586 Bacteria 4080
195 Ga0501072_0062921 3300049588 Bacteria 2927
196 Ga0501072_0243651 3300049588 Bacteria 1432
197 Ga0501073_0000083 3300049589 Bacteria 59733
198 Ga0501073_0002480 3300049589 Bacteria 13772
199 Ga0501074_0001790 3300049590 Bacteria 14696
200 Ga0501077_0000088 3300049593 Bacteria 46551
201 Ga0501080_0003162 3300049742 Bacteria 14508
202 Ga0501080_0004733 3300049742 Bacteria 12134
203 Ga0501080_0252840 3300049742 Bacteria 1607
204 Ga0501035_0006382 3300049822 Bacteria 11088
205 Ga0501035_0012769 3300049822 Bacteria 7759
206 Ga0501044_0002166 3300049823 Bacteria 22521
207 Ga0501044_0024324 3300049823 Bacteria 6433
208 Ga0501044_0027270 3300049823 Bacteria 6039
209 Ga0501044_0119038 3300049823 Bacteria 2643
210 nmdc:mga06r32_29262_c1 3300050510 Bacteria 5161
211 nmdc:mga08y16_129670_c1 3300050511 Bacteria 2623
212 nmdc:mga08y16_82312_c1 3300050511 Bacteria 3355
213 nmdc:mga0a205_134441_c1 3300050515 Bacteria 2373
214 nmdc:mga0a205_74642_c1 3300050515 Bacteria 3276
215 nmdc:mga0a205_81_c1 3300050515 Bacteria 53005
216 Ga0495601_0018745 3300053077 Bacteria 4213
217 Ga0500566_0018488 3300053094 Bacteria 4092
218 Ga0500572_000706 3300053111 Bacteria 10831
219 Ga0501084_0035133 3300054114 Bacteria 4190
220 Ga0501082_0021081 3300060353 Bacteria 5620
221 Ga0501082_0146331 3300060353 Bacteria 2051

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2857357740 2857361829 323
2 3300049588 Ga0501072_0243651 Ga0501072_0243651_330_1394 341
3 3300049822 Ga0501035_0012769 Ga0501035_0012769_6641_7732 350
4 3300049584 Ga0501068_0093701 Ga0501068_0093701_712_1842 363
5 3300035116 Ga0373945_0016240 Ga0373945_0016240_10_1179 371
6 3300049580 Ga0501046_0003325 Ga0501046_0003325_7323_8663 378
7 3300049581 Ga0501047_0036320 Ga0501047_0036320_1351_2691 378
8 3300049823 Ga0501044_0024324 Ga0501044_0024324_932_2272 389
9 3300048908 Ga0496105_0120570 Ga0496105_0120570_14_1324 390
10 3300039438 Ga0436360_0683763 Ga0436360_0683763_89_1492 391
11 3300044712 Ga0453684_0009769 Ga0453684_0009769_12163_13506 392
12 3300032005 Ga0307411_10001861 Ga0307411_100018617 394
13 3300049571 Ga0501034_0024133 Ga0501034_0024133_4595_5935 395
14 3300049579 Ga0501043_0008633 Ga0501043_0008633_5600_6940 395
15 3300049580 Ga0501046_0002539 Ga0501046_0002539_7638_8978 395
16 3300049586 Ga0501070_0006209 Ga0501070_0006209_247_1587 395
17 3300053077 Ga0495601_0018745 Ga0495601_0018745_2231_3580 398
18 3300049571 Ga0501034_0212549 Ga0501034_0212549_521_1876 399
19 3300025949 Ga0207667_10145213 Ga0207667_101452132 402
20 3300028800 Ga0265338_10001162 Ga0265338_1000116238 402
21 3300006844 Ga0075428_100064544 Ga0075428_1000645443 403
22 3300046511 Ga0495608_0121914 Ga0495608_0121914_69_1457 403
23 3300048915 Ga0496112_0056397 Ga0496112_0056397_1194_2555 405
24 iso_pu_bacteria 2599185353 2600199432 405
25 iso_pu_bacteria 2600254943 2600401664 405
26 3300009101 Ga0105247_10114019 Ga0105247_101140192 406
27 3300005471 Ga0070698_100062007 Ga0070698_1000620074 407
28 3300026088 Ga0207641_10018730 Ga0207641_100187309 407
29 3300031241 Ga0265325_10003872 Ga0265325_100038727 408
30 3300031249 Ga0265339_10003333 Ga0265339_1000333312 408
31 3300031250 Ga0265331_10005570 Ga0265331_100055703 408
32 3300031595 Ga0265313_10000050 Ga0265313_1000005046 408
33 3300031711 Ga0265314_10000306 Ga0265314_1000030646 408
34 3300031712 Ga0265342_10011241 Ga0265342_100112418 408
35 3300009098 Ga0105245_10014698 Ga0105245_100146988 409
36 3300009177 Ga0105248_10090189 Ga0105248_100901892 409
37 3300009553 Ga0105249_10176203 Ga0105249_101762032 409
38 3300025961 Ga0207712_10133661 Ga0207712_101336612 409
39 3300048913 Ga0496110_0152607 Ga0496110_0152607_556_1932 409
40 3300049577 Ga0501041_0062448 Ga0501041_0062448_872_2233 409
41 3300049586 Ga0501070_0036924 Ga0501070_0036924_1203_2558 409
42 3300049588 Ga0501072_0062921 Ga0501072_0062921_942_2303 409
43 3300049742 Ga0501080_0252840 Ga0501080_0252840_24_1385 409
44 3300050515 nmdc:mga0a205_134441_c1 nmdc:mga0a205_134441_c1_110_1450 409
45 3300054114 Ga0501084_0035133 Ga0501084_0035133_1581_2942 409
46 3300060353 Ga0501082_0146331 Ga0501082_0146331_56_1417 409
47 iso_pu_bacteria 2687453257 2688065827 410
48 iso_pu_bacteria 2889415604 2889421825 410
49 iso_pu_bacteria 2920107658 2920113199 410
50 3300006844 Ga0075428_100384115 Ga0075428_1003841152 411
51 3300006847 Ga0075431_100394247 Ga0075431_1003942471 411
52 3300049571 Ga0501034_0008844 Ga0501034_0008844_1182_2558 411
53 3300013307 Ga0157372_10297332 Ga0157372_102973322 412
54 3300021361 Ga0213872_10009926 Ga0213872_100099265 412
55 3300037418 Ga0395900_0065728 Ga0395900_0065728_1702_3087 412
56 3300039438 Ga0436360_0561605 Ga0436360_0561605_6458_7834 412
57 3300039447 Ga0436361_0887939 Ga0436361_0887939_141_1514 412
58 3300039453 Ga0436362_0094217 Ga0436362_0094217_5078_6454 412
59 3300006844 Ga0075428_100005581 Ga0075428_1000055819 413
60 3300009094 Ga0111539_10149618 Ga0111539_101496182 413
61 3300049571 Ga0501034_0009576 Ga0501034_0009576_1225_2613 414
62 3300025914 Ga0207671_10145975 Ga0207671_101459752 415
63 3300031251 Ga0265327_10000159 Ga0265327_1000015918 415
64 3300005617 Ga0068859_100000536 Ga0068859_10000053634 416
65 3300006931 Ga0097620_100000536 Ga0097620_10000053634 416
66 3300009094 Ga0111539_10340648 Ga0111539_103406482 416
67 3300047320 Ga0495672_0000511 Ga0495672_0000511_24778_26142 416
68 3300005295 Ga0065707_10102079 Ga0065707_101020793 417
69 3300025936 Ga0207670_10151774 Ga0207670_101517742 417
70 3300032005 Ga0307411_10042528 Ga0307411_100425282 417
71 3300005563 Ga0068855_100204008 Ga0068855_1002040082 418
72 3300038443 Ga0395901_0204468 Ga0395901_0204468_116_1504 418
73 3300005354 Ga0070675_100061769 Ga0070675_1000617692 419
74 3300005436 Ga0070713_100068079 Ga0070713_1000680792 419
75 3300005548 Ga0070665_100000298 Ga0070665_10000029825 419
76 3300005577 Ga0068857_100005931 Ga0068857_1000059317 419
77 3300006852 Ga0075433_10000067 Ga0075433_1000006711 419
78 3300009094 Ga0111539_10039646 Ga0111539_100396469 419
79 3300009174 Ga0105241_10071000 Ga0105241_100710002 419
80 3300009177 Ga0105248_10220838 Ga0105248_102208382 419
81 3300010375 Ga0105239_10005562 Ga0105239_1000556211 419
82 3300013307 Ga0157372_10051779 Ga0157372_100517795 419
83 3300013307 Ga0157372_10315957 Ga0157372_103159571 419
84 3300025911 Ga0207654_10037541 Ga0207654_100375412 419
85 3300025913 Ga0207695_10000534 Ga0207695_1000053437 419
86 3300025926 Ga0207659_10063738 Ga0207659_100637383 419
87 3300025949 Ga0207667_10074363 Ga0207667_100743635 419
88 3300026116 Ga0207674_10004220 Ga0207674_1000422022 419
89 3300028379 Ga0268266_10007671 Ga0268266_100076716 419
90 3300035725 Ga0373947_0036894 Ga0373947_0036894_579_1991 419
91 3300046463 Ga0495653_0041661 Ga0495653_0041661_981_2393 419
92 3300046476 Ga0495662_0014703 Ga0495662_0014703_1783_3108 419
93 3300046514 Ga0495618_0083867 Ga0495618_0083867_627_1952 419
94 3300046517 Ga0495630_0008235 Ga0495630_0008235_3880_5292 419
95 3300046517 Ga0495630_0038028 Ga0495630_0038028_1150_2475 419
96 3300046533 Ga0495640_0028934 Ga0495640_0028934_1199_2524 419
97 3300046535 Ga0495586_0017815 Ga0495586_0017815_2251_3576 419
98 3300047319 Ga0495674_0008030 Ga0495674_0008030_8393_9805 419
99 3300047471 Ga0495684_0013498 Ga0495684_0013498_2351_3763 419
100 3300050511 nmdc:mga08y16_82312_c1 nmdc:mga08y16_82312_c1_307_1629 419
101 3300050515 nmdc:mga0a205_74642_c1 nmdc:mga0a205_74642_c1_732_2054 419
102 3300050515 nmdc:mga0a205_81_c1 nmdc:mga0a205_81_c1_5102_6427 419
103 3300005367 Ga0070667_100024993 Ga0070667_1000249933 420
104 3300005548 Ga0070665_100027308 Ga0070665_1000273087 420
105 3300025928 Ga0207700_10057749 Ga0207700_100577492 420
106 3300025986 Ga0207658_10028220 Ga0207658_100282203 420
107 3300047320 Ga0495672_0036820 Ga0495672_0036820_1028_2365 420
108 3300049569 Ga0501032_0002071 Ga0501032_0002071_7081_8406 420
109 3300049572 Ga0501036_0016999 Ga0501036_0016999_1463_2788 420
110 3300049573 Ga0501037_0017093 Ga0501037_0017093_723_2048 420
111 3300049574 Ga0501038_0012817 Ga0501038_0012817_5838_7163 420
112 3300049579 Ga0501043_0001446 Ga0501043_0001446_17444_18769 420
113 3300049580 Ga0501046_0026523 Ga0501046_0026523_2657_3982 420
114 3300049581 Ga0501047_0031616 Ga0501047_0031616_1323_2648 420
115 3300049582 Ga0501048_0010340 Ga0501048_0010340_4154_5479 420
116 3300049583 Ga0501067_0035163 Ga0501067_0035163_945_2270 420
117 3300049586 Ga0501070_0009038 Ga0501070_0009038_2418_3743 420
118 3300049589 Ga0501073_0002480 Ga0501073_0002480_7014_8339 420
119 3300049590 Ga0501074_0001790 Ga0501074_0001790_549_1874 420
120 3300049823 Ga0501044_0027270 Ga0501044_0027270_2271_3596 420
121 3300005327 Ga0070658_10000605 Ga0070658_100006053 421
122 3300005337 Ga0070682_100000039 Ga0070682_100000039112 421
123 3300009093 Ga0105240_10067893 Ga0105240_100678934 421
124 3300013105 Ga0157369_10281447 Ga0157369_102814472 421
125 3300025909 Ga0207705_10003885 Ga0207705_100038852 421
126 3300025913 Ga0207695_10005806 Ga0207695_1000580616 421
127 3300005844 Ga0068862_100296228 Ga0068862_1002962281 422
128 3300028380 Ga0268265_10232539 Ga0268265_102325391 422
129 iso_pu_bacteria 2671180531 2673167463 422
130 3300031852 Ga0307410_10095083 Ga0307410_100950832 423
131 3300045051 Ga0451576_0000298 Ga0451576_0000298_63062_64462 423
132 3300048912 Ga0496109_0145062 Ga0496109_0145062_592_1983 423
133 3300049569 Ga0501032_0001915 Ga0501032_0001915_662_2044 423
134 3300049584 Ga0501068_0002132 Ga0501068_0002132_3099_4481 423
135 3300049589 Ga0501073_0000083 Ga0501073_0000083_37712_39094 423
136 3300049593 Ga0501077_0000088 Ga0501077_0000088_19908_21290 423
137 3300049742 Ga0501080_0003162 Ga0501080_0003162_12896_14278 423
138 3300049823 Ga0501044_0002166 Ga0501044_0002166_2677_4059 423
139 iso_pu_bacteria 2643221699 2644548383 423
140 3300005353 Ga0070669_100037385 Ga0070669_1000373852 424
141 3300005355 Ga0070671_100006755 Ga0070671_1000067554 424
142 3300005367 Ga0070667_100013914 Ga0070667_1000139147 424
143 3300005548 Ga0070665_100000121 Ga0070665_100000121149 424
144 3300005548 Ga0070665_100048252 Ga0070665_1000482524 424
145 3300005617 Ga0068859_100001281 Ga0068859_10000128122 424
146 3300005841 Ga0068863_100004023 Ga0068863_10000402316 424
147 3300005842 Ga0068858_100007271 Ga0068858_10000727116 424
148 3300005843 Ga0068860_100010284 Ga0068860_10001028411 424
149 3300006931 Ga0097620_100001281 Ga0097620_10000128122 424
150 3300009094 Ga0111539_10245718 Ga0111539_102457182 424
151 3300013296 Ga0157374_10158724 Ga0157374_101587241 424
152 3300014325 Ga0163163_10018256 Ga0163163_100182568 424
153 3300014968 Ga0157379_10009954 Ga0157379_100099545 424
154 3300025903 Ga0207680_10072372 Ga0207680_100723722 424
155 3300025931 Ga0207644_10006669 Ga0207644_1000666915 424
156 3300026088 Ga0207641_10007468 Ga0207641_100074687 424
157 3300028379 Ga0268266_10000106 Ga0268266_1000010615 424
158 3300028379 Ga0268266_10271941 Ga0268266_102719412 424
159 3300028786 Ga0307517_10012557 Ga0307517_1001255711 424
160 3300031456 Ga0307513_10002446 Ga0307513_1000244623 424
161 3300031995 Ga0307409_100073044 Ga0307409_1000730443 424
162 3300046462 Ga0495651_0160248 Ga0495651_0160248_34_1389 424
163 3300048918 Ga0496115_0001049 Ga0496115_0001049_595_1944 424
164 3300050511 nmdc:mga08y16_129670_c1 nmdc:mga08y16_129670_c1_1198_2607 424
165 3300005331 Ga0070670_100021899 Ga0070670_1000218992 425
166 3300005355 Ga0070671_100039118 Ga0070671_1000391183 425
167 3300005617 Ga0068859_100065105 Ga0068859_1000651054 425
168 3300005841 Ga0068863_100064279 Ga0068863_1000642795 425
169 3300005985 Ga0081539_10003625 Ga0081539_1000362514 425
170 3300006931 Ga0097620_100065102 Ga0097620_1000651024 425
171 3300009551 Ga0105238_10048857 Ga0105238_100488574 425
172 3300025917 Ga0207660_10076178 Ga0207660_100761783 425
173 3300025924 Ga0207694_10013350 Ga0207694_100133506 425
174 3300026088 Ga0207641_10031526 Ga0207641_100315265 425
175 3300026118 Ga0207675_100095840 Ga0207675_1000958404 425
176 3300031730 Ga0307516_10001565 Ga0307516_1000156523 425
177 3300037312 Ga0395899_0001195 Ga0395899_0001195_11952_13301 425
178 3300037418 Ga0395900_0003408 Ga0395900_0003408_15433_16782 425
179 3300037466 Ga0395898_0004322 Ga0395898_0004322_11953_13302 425
180 3300037471 Ga0395905_0002819 Ga0395905_0002819_16865_18214 425
181 3300038443 Ga0395901_0000342 Ga0395901_0000342_43454_44803 425
182 3300046559 Ga0495667_0006866 Ga0495667_0006866_2519_3931 425
183 3300046689 Ga0495613_0011010 Ga0495613_0011010_3952_5364 425
184 3300005347 Ga0070668_100078745 Ga0070668_1000787452 426
185 3300005539 Ga0068853_100064199 Ga0068853_1000641992 426
186 3300005843 Ga0068860_100080942 Ga0068860_1000809424 426
187 3300025972 Ga0207668_10080061 Ga0207668_100800612 426
188 3300026041 Ga0207639_10054590 Ga0207639_100545901 426
189 3300028381 Ga0268264_10002325 Ga0268264_1000232525 426
190 3300028794 Ga0307515_10000001 Ga0307515_100000011729 426
191 3300031456 Ga0307513_10000162 Ga0307513_1000016224 426
192 3300053111 Ga0500572_000706 Ga0500572_000706_2547_3893 426
193 3300042876 Ga0451577_0091473 Ga0451577_0091473_1283_2689 427
194 3300044712 Ga0453684_0001061 Ga0453684_0001061_81582_82988 427
195 3300048915 Ga0496112_0060193 Ga0496112_0060193_1627_2973 427
196 3300053094 Ga0500566_0018488 Ga0500566_0018488_1882_3258 427
197 3300046694 Ga0495649_0000981 Ga0495649_0000981_17560_18939 428
198 3300046689 Ga0495613_0000576 Ga0495613_0000576_18590_19933 430
199 3300049569 Ga0501032_0053318 Ga0501032_0053318_718_2082 430
200 3300049571 Ga0501034_0056418 Ga0501034_0056418_1233_2597 430
201 3300049574 Ga0501038_0013604 Ga0501038_0013604_500_1864 430
202 3300049575 Ga0501039_0039757 Ga0501039_0039757_1284_2648 430
203 3300049579 Ga0501043_0005548 Ga0501043_0005548_2962_4326 430
204 3300049581 Ga0501047_0008706 Ga0501047_0008706_7511_8875 430
205 3300049583 Ga0501067_0012398 Ga0501067_0012398_2173_3537 430
206 3300049742 Ga0501080_0004733 Ga0501080_0004733_5767_7131 430
207 3300049822 Ga0501035_0006382 Ga0501035_0006382_3179_4543 430
208 3300049823 Ga0501044_0119038 Ga0501044_0119038_310_1674 430
209 3300060353 Ga0501082_0021081 Ga0501082_0021081_1216_2580 430
210 3300027378 Ga0209981_1000043 Ga0209981_10000439 431
211 3300027543 Ga0209999_1004449 Ga0209999_10044492 431
212 3300046558 Ga0495633_0000510 Ga0495633_0000510_37591_38970 431
213 3300048925 Ga0496122_0011257 Ga0496122_0011257_7517_8896 431
214 3300048926 Ga0496123_0000699 Ga0496123_0000699_1410_2789 431
215 3300013102 Ga0157371_10064475 Ga0157371_100644751 432
216 3300013105 Ga0157369_10032567 Ga0157369_100325674 432
217 3300006847 Ga0075431_100033542 Ga0075431_1000335426 433
218 3300050510 nmdc:mga06r32_29262_c1 nmdc:mga06r32_29262_c1_2233_3633 433
219 3300031251 Ga0265327_10005226 Ga0265327_1000522619 434
220 3300005341 Ga0070691_10032400 Ga0070691_100324002 436
221 3300005458 Ga0070681_10104337 Ga0070681_101043374 436
222 3300009093 Ga0105240_10093376 Ga0105240_100933762 436
223 3300013104 Ga0157370_10148051 Ga0157370_101480512 436
224 3300025912 Ga0207707_10065663 Ga0207707_100656634 436
225 3300025913 Ga0207695_10000575 Ga0207695_1000057525 436
226 3300025913 Ga0207695_10105675 Ga0207695_101056753 436
227 3300049581 Ga0501047_0042192 Ga0501047_0042192_1857_3221 436
228 iso_pu_bacteria 2643221663 2644352432 446
229 3300003781 Ga0055536_1005404 Ga0055536_10054048 447
230 3300048919 Ga0496116_0023211 Ga0496116_0023211_1949_3328 447
231 iso_pu_bacteria 2643221699 2644553151 447

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00344

SecY

SecY

117

491

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gae-assembly1.cif.gz_g rnc in complex with a translocating secyeg 0.894 10 422
5ch4-assembly1.cif.gz_Y peptide-bound state of thermus thermophilus secyeg 0.8889 1 425
5nco-assembly1.cif.gz_g quaternary complex between srp, sr, and secyeg bound to the translating ribosome 0.8884 8 425
2zjs-assembly1.cif.gz_Y crystal structure of secye translocon from thermus thermophilus with a fab fragment 0.8851 5 422
5nco-assembly1.cif.gz_g quaternary complex between srp, sr, and secyeg bound to the translating ribosome 0.8844 8 425
ID Description Score Start End Superfamily
af_P0AGA2_15_429_1.10.3370.10 Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain 0.9601 10 425 1.10.3370.10
af_P0AGA2_15_429_1.10.3370.10 Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain 0.9533 10 425 1.10.3370.10
af_Q6ZG25_138_543_1.10.3370.10 Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain 0.9369 17 425 1.10.3370.10
af_O08387_1_424_1.10.3370.10 Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain 0.9254 6 425 1.10.3370.10
af_P9WGN3_1_436_1.10.3370.10 Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain 0.9235 3 425 1.10.3370.10
ID Description Score Start End GO Terms
AF-A0A1F0FCS0-F1-model_v4 Protein translocase subunit SecY 0.9679 10 433 GO:0005886
GO:0006605
GO:0043952
GO:0065002
AF-A0A7W2B8I5-F1-model_v4 Protein translocase subunit SecY 0.965 1 433 GO:0005886
GO:0006605
GO:0043952
GO:0065002
AF-A0A2E6IZX3-F1-model_v4 Protein translocase subunit SecY 0.9631 3 436 GO:0005886
GO:0006605
GO:0043952
GO:0065002
AF-A0A7Y0D2H5-F1-model_v4 Protein translocase subunit SecY 0.962 15 436 GO:0005886
GO:0006605
GO:0043952
GO:0065002
AF-A0A529TKS3-F1-model_v4 Preprotein translocase subunit SecY 0.9617 1 396 GO:0015031
GO:0016020

Feature Viewer

pLDDT pTM Quality
66.11 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map