F344556
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 231 | 159 | 221 | 446 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2671180531|2673167463 |
| Length | 510 |
| Sequence | SICLVAGIASLVGGLVTFSYGGESWLGWTLTIFGAAASILGFVPDQLLTIFKIPELRKKIFITLIFLAVYRIGYYVPLPMIDQAKMAEKMADAQRGALGQVLGFVSLFSGGNLSNACIFSLGIMPYISASIIVQLLSSGVVPSLEKLRKEGESGRKKLNEITRYLTVPICIIQAIMVVQTVMKPDTGDGGGMGLAPTGYNDGFELWWFGFTAVITLTAGTVLLMWLGEQIDEYGIGNGISLIIMAGIVARIPDATNSLLIDSATGKLKDSVFTLGGGSGADISLEKLIVLAFLFVTVVVGVIAMTKAQRRIPTQSAKHVRGRRVYGGTRQFLPMKVNAAGVMPVIFASTLLILPWFFFNAIYNLSDSSLGWAGTLSTMFQNHRGWLYNFMYVIMIYVFTYFWVAITFNPKEIADNLKDHGSFIPGYRPGKKTADYLERVLMRVTFVGAAFLAIIAIIPNVISSELEIPVQVASFYGGTGLLIVISVALDLVQKINSHLVMRNYPSLTDET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185353 | Staphylococcus sp. NFPP34 | Isolate | Rhizoplane |
| 2 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 3 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 4 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 5 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
| 6 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 7 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 8 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 9 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 35 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 55 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 81 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 82 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 83 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 84 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 85 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 86 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 87 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 88 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 89 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 90 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 91 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 92 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 93 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 94 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 95 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 96 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 97 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 98 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 99 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 100 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 101 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 102 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 103 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 104 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 105 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 106 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 107 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 108 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 124 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 126 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 127 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 128 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 129 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 130 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 131 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 157 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 158 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.67 |
| Metatranscriptomes | 0 |
| Isolates | 4.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.3 |
| Nodule | 0 |
| Rhizoplane | 3.46 |
| Rhizosphere | 89.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055536_1005404 | 3300003781 | Bacteria | 6259 |
| 2 | Ga0065707_10102079 | 3300005295 | Bacteria | 2827 |
| 3 | Ga0070658_10000605 | 3300005327 | Bacteria | 31083 |
| 4 | Ga0070670_100021899 | 3300005331 | Bacteria | 5499 |
| 5 | Ga0070682_100000039 | 3300005337 | Bacteria | 144400 |
| 6 | Ga0070691_10032400 | 3300005341 | Bacteria | 2456 |
| 7 | Ga0070668_100078745 | 3300005347 | Bacteria | 2578 |
| 8 | Ga0070669_100037385 | 3300005353 | Bacteria | 3521 |
| 9 | Ga0070675_100061769 | 3300005354 | Bacteria | 3095 |
| 10 | Ga0070671_100006755 | 3300005355 | Bacteria | 9181 |
| 11 | Ga0070671_100039118 | 3300005355 | Bacteria | 3937 |
| 12 | Ga0070667_100013914 | 3300005367 | Bacteria | 6652 |
| 13 | Ga0070667_100024993 | 3300005367 | Bacteria | 4963 |
| 14 | Ga0070713_100068079 | 3300005436 | Bacteria | 3000 |
| 15 | Ga0070681_10104337 | 3300005458 | Bacteria | 2777 |
| 16 | Ga0070698_100062007 | 3300005471 | Bacteria | 3773 |
| 17 | Ga0068853_100064199 | 3300005539 | Bacteria | 3183 |
| 18 | Ga0070665_100000121 | 3300005548 | Bacteria | 147683 |
| 19 | Ga0070665_100000298 | 3300005548 | Bacteria | 77675 |
| 20 | Ga0070665_100027308 | 3300005548 | Bacteria | 5749 |
| 21 | Ga0070665_100048252 | 3300005548 | Bacteria | 4275 |
| 22 | Ga0068855_100204008 | 3300005563 | Bacteria | 2225 |
| 23 | Ga0068857_100005931 | 3300005577 | Bacteria | 10431 |
| 24 | Ga0068859_100000536 | 3300005617 | Bacteria | 37574 |
| 25 | Ga0068859_100001281 | 3300005617 | Bacteria | 25688 |
| 26 | Ga0068859_100065105 | 3300005617 | Bacteria | 3679 |
| 27 | Ga0068863_100004023 | 3300005841 | Bacteria | 14519 |
| 28 | Ga0068863_100064279 | 3300005841 | Bacteria | 3471 |
| 29 | Ga0068858_100007271 | 3300005842 | Bacteria | 10730 |
| 30 | Ga0068860_100010284 | 3300005843 | Bacteria | 9258 |
| 31 | Ga0068860_100080942 | 3300005843 | Bacteria | 3088 |
| 32 | Ga0068862_100296228 | 3300005844 | Bacteria | 1487 |
| 33 | Ga0081539_10003625 | 3300005985 | Bacteria | 18613 |
| 34 | Ga0075428_100005581 | 3300006844 | Bacteria | 13974 |
| 35 | Ga0075428_100064544 | 3300006844 | Bacteria | 4010 |
| 36 | Ga0075428_100384115 | 3300006844 | Bacteria | 1505 |
| 37 | Ga0075431_100033542 | 3300006847 | Bacteria | 5291 |
| 38 | Ga0075431_100394247 | 3300006847 | Bacteria | 1386 |
| 39 | Ga0075433_10000067 | 3300006852 | Bacteria | 45943 |
| 40 | Ga0097620_100000536 | 3300006931 | Bacteria | 37574 |
| 41 | Ga0097620_100001281 | 3300006931 | Bacteria | 25688 |
| 42 | Ga0097620_100065102 | 3300006931 | Bacteria | 3679 |
| 43 | Ga0105240_10067893 | 3300009093 | Bacteria | 4418 |
| 44 | Ga0105240_10093376 | 3300009093 | Bacteria | 3672 |
| 45 | Ga0111539_10039646 | 3300009094 | Bacteria | 5675 |
| 46 | Ga0111539_10149618 | 3300009094 | Bacteria | 2733 |
| 47 | Ga0111539_10245718 | 3300009094 | Bacteria | 2083 |
| 48 | Ga0111539_10340648 | 3300009094 | Bacteria | 1745 |
| 49 | Ga0105245_10014698 | 3300009098 | Bacteria | 6816 |
| 50 | Ga0105247_10114019 | 3300009101 | Bacteria | 1743 |
| 51 | Ga0105241_10071000 | 3300009174 | Bacteria | 2703 |
| 52 | Ga0105248_10090189 | 3300009177 | Bacteria | 3452 |
| 53 | Ga0105248_10220838 | 3300009177 | Bacteria | 2134 |
| 54 | Ga0105238_10048857 | 3300009551 | Bacteria | 4262 |
| 55 | Ga0105249_10176203 | 3300009553 | Bacteria | 2077 |
| 56 | Ga0105239_10005562 | 3300010375 | Bacteria | 14736 |
| 57 | Ga0157371_10064475 | 3300013102 | Bacteria | 2596 |
| 58 | Ga0157370_10148051 | 3300013104 | Bacteria | 2186 |
| 59 | Ga0157369_10032567 | 3300013105 | Bacteria | 5731 |
| 60 | Ga0157369_10281447 | 3300013105 | Bacteria | 1732 |
| 61 | Ga0157374_10158724 | 3300013296 | Bacteria | 2202 |
| 62 | Ga0157372_10051779 | 3300013307 | Bacteria | 4570 |
| 63 | Ga0157372_10297332 | 3300013307 | Bacteria | 1878 |
| 64 | Ga0157372_10315957 | 3300013307 | Bacteria | 1819 |
| 65 | Ga0163163_10018256 | 3300014325 | Bacteria | 6562 |
| 66 | Ga0157379_10009954 | 3300014968 | Bacteria | 8282 |
| 67 | Ga0213872_10009926 | 3300021361 | Bacteria | 4547 |
| 68 | Ga0207680_10072372 | 3300025903 | Bacteria | 2140 |
| 69 | Ga0207705_10003885 | 3300025909 | Bacteria | 11366 |
| 70 | Ga0207654_10037541 | 3300025911 | Bacteria | 2713 |
| 71 | Ga0207707_10065663 | 3300025912 | Bacteria | 3160 |
| 72 | Ga0207695_10000534 | 3300025913 | Bacteria | 79293 |
| 73 | Ga0207695_10000575 | 3300025913 | Bacteria | 74997 |
| 74 | Ga0207695_10005806 | 3300025913 | Bacteria | 16245 |
| 75 | Ga0207695_10105675 | 3300025913 | Bacteria | 2802 |
| 76 | Ga0207671_10145975 | 3300025914 | Bacteria | 1825 |
| 77 | Ga0207660_10076178 | 3300025917 | Bacteria | 2452 |
| 78 | Ga0207694_10013350 | 3300025924 | Bacteria | 6186 |
| 79 | Ga0207659_10063738 | 3300025926 | Bacteria | 2666 |
| 80 | Ga0207700_10057749 | 3300025928 | Bacteria | 2928 |
| 81 | Ga0207644_10006669 | 3300025931 | Bacteria | 7523 |
| 82 | Ga0207670_10151774 | 3300025936 | Bacteria | 1720 |
| 83 | Ga0207667_10074363 | 3300025949 | Bacteria | 3530 |
| 84 | Ga0207667_10145213 | 3300025949 | Bacteria | 2442 |
| 85 | Ga0207712_10133661 | 3300025961 | Bacteria | 1894 |
| 86 | Ga0207668_10080061 | 3300025972 | Bacteria | 2365 |
| 87 | Ga0207658_10028220 | 3300025986 | Bacteria | 3951 |
| 88 | Ga0207639_10054590 | 3300026041 | Bacteria | 3054 |
| 89 | Ga0207641_10007468 | 3300026088 | Bacteria | 9094 |
| 90 | Ga0207641_10018730 | 3300026088 | Bacteria | 5677 |
| 91 | Ga0207641_10031526 | 3300026088 | Bacteria | 4397 |
| 92 | Ga0207674_10004220 | 3300026116 | Bacteria | 17343 |
| 93 | Ga0207675_100095840 | 3300026118 | Bacteria | 2793 |
| 94 | Ga0209981_1000043 | 3300027378 | Bacteria | 12361 |
| 95 | Ga0209999_1004449 | 3300027543 | Bacteria | 2522 |
| 96 | Ga0268266_10000106 | 3300028379 | Bacteria | 175109 |
| 97 | Ga0268266_10007671 | 3300028379 | Bacteria | 9693 |
| 98 | Ga0268266_10271941 | 3300028379 | Bacteria | 1573 |
| 99 | Ga0268265_10232539 | 3300028380 | Bacteria | 1621 |
| 100 | Ga0268264_10002325 | 3300028381 | Bacteria | 16817 |
| 101 | Ga0307517_10012557 | 3300028786 | Bacteria | 11610 |
| 102 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 103 | Ga0265338_10001162 | 3300028800 | Bacteria | 43495 |
| 104 | Ga0265325_10003872 | 3300031241 | Bacteria | 9604 |
| 105 | Ga0265339_10003333 | 3300031249 | Bacteria | 11244 |
| 106 | Ga0265331_10005570 | 3300031250 | Bacteria | 7583 |
| 107 | Ga0265327_10000159 | 3300031251 | Bacteria | 145537 |
| 108 | Ga0265327_10005226 | 3300031251 | Bacteria | 10946 |
| 109 | Ga0307513_10000162 | 3300031456 | Bacteria | 96000 |
| 110 | Ga0307513_10002446 | 3300031456 | Bacteria | 25748 |
| 111 | Ga0265313_10000050 | 3300031595 | Bacteria | 111425 |
| 112 | Ga0265314_10000306 | 3300031711 | Bacteria | 70032 |
| 113 | Ga0265342_10011241 | 3300031712 | Bacteria | 6141 |
| 114 | Ga0307516_10001565 | 3300031730 | Bacteria | 31484 |
| 115 | Ga0307410_10095083 | 3300031852 | Bacteria | 2124 |
| 116 | Ga0307409_100073044 | 3300031995 | Bacteria | 2734 |
| 117 | Ga0307411_10001861 | 3300032005 | Bacteria | 8973 |
| 118 | Ga0307411_10042528 | 3300032005 | Bacteria | 2900 |
| 119 | Ga0373945_0016240 | 3300035116 | Bacteria | 2508 |
| 120 | Ga0373947_0036894 | 3300035725 | Bacteria | 2899 |
| 121 | Ga0395899_0001195 | 3300037312 | Bacteria | 22830 |
| 122 | Ga0395900_0003408 | 3300037418 | Bacteria | 17178 |
| 123 | Ga0395900_0065728 | 3300037418 | Bacteria | 3726 |
| 124 | Ga0395898_0004322 | 3300037466 | Bacteria | 15569 |
| 125 | Ga0395905_0002819 | 3300037471 | Bacteria | 19050 |
| 126 | Ga0395901_0000342 | 3300038443 | Bacteria | 56754 |
| 127 | Ga0395901_0204468 | 3300038443 | Bacteria | 2069 |
| 128 | Ga0436360_0561605 | 3300039438 | Bacteria | 14597 |
| 129 | Ga0436360_0683763 | 3300039438 | Bacteria | 1798 |
| 130 | Ga0436361_0887939 | 3300039447 | Bacteria | 2147 |
| 131 | Ga0436362_0094217 | 3300039453 | Bacteria | 9983 |
| 132 | Ga0451577_0091473 | 3300042876 | Bacteria | 2715 |
| 133 | Ga0453684_0001061 | 3300044712 | Bacteria | 87486 |
| 134 | Ga0453684_0009769 | 3300044712 | Bacteria | 16659 |
| 135 | Ga0451576_0000298 | 3300045051 | Bacteria | 120202 |
| 136 | Ga0495651_0160248 | 3300046462 | Bacteria | 1613 |
| 137 | Ga0495653_0041661 | 3300046463 | Bacteria | 3583 |
| 138 | Ga0495662_0014703 | 3300046476 | Bacteria | 3805 |
| 139 | Ga0495608_0121914 | 3300046511 | Bacteria | 1671 |
| 140 | Ga0495618_0083867 | 3300046514 | Bacteria | 2036 |
| 141 | Ga0495630_0008235 | 3300046517 | Bacteria | 7486 |
| 142 | Ga0495630_0038028 | 3300046517 | Bacteria | 3598 |
| 143 | Ga0495640_0028934 | 3300046533 | Bacteria | 3984 |
| 144 | Ga0495586_0017815 | 3300046535 | Bacteria | 3780 |
| 145 | Ga0495633_0000510 | 3300046558 | Bacteria | 39075 |
| 146 | Ga0495667_0006866 | 3300046559 | Bacteria | 7730 |
| 147 | Ga0495613_0000576 | 3300046689 | Bacteria | 29823 |
| 148 | Ga0495613_0011010 | 3300046689 | Bacteria | 6717 |
| 149 | Ga0495649_0000981 | 3300046694 | Bacteria | 22495 |
| 150 | Ga0495674_0008030 | 3300047319 | Bacteria | 10076 |
| 151 | Ga0495672_0000511 | 3300047320 | Bacteria | 44639 |
| 152 | Ga0495672_0036820 | 3300047320 | Bacteria | 3001 |
| 153 | Ga0495684_0013498 | 3300047471 | Bacteria | 6286 |
| 154 | Ga0496105_0120570 | 3300048908 | Bacteria | 2163 |
| 155 | Ga0496109_0145062 | 3300048912 | Bacteria | 2221 |
| 156 | Ga0496110_0152607 | 3300048913 | Bacteria | 2092 |
| 157 | Ga0496112_0056397 | 3300048915 | Bacteria | 3866 |
| 158 | Ga0496112_0060193 | 3300048915 | Bacteria | 3742 |
| 159 | Ga0496115_0001049 | 3300048918 | Bacteria | 20043 |
| 160 | Ga0496116_0023211 | 3300048919 | Bacteria | 4626 |
| 161 | Ga0496122_0011257 | 3300048925 | Bacteria | 9089 |
| 162 | Ga0496123_0000699 | 3300048926 | Bacteria | 55169 |
| 163 | Ga0501032_0001915 | 3300049569 | Bacteria | 16407 |
| 164 | Ga0501032_0002071 | 3300049569 | Bacteria | 15830 |
| 165 | Ga0501032_0053318 | 3300049569 | Bacteria | 2724 |
| 166 | Ga0501034_0008844 | 3300049571 | Bacteria | 10590 |
| 167 | Ga0501034_0009576 | 3300049571 | Bacteria | 10139 |
| 168 | Ga0501034_0024133 | 3300049571 | Bacteria | 6186 |
| 169 | Ga0501034_0056418 | 3300049571 | Bacteria | 3952 |
| 170 | Ga0501034_0212549 | 3300049571 | Bacteria | 1889 |
| 171 | Ga0501036_0016999 | 3300049572 | Bacteria | 6078 |
| 172 | Ga0501037_0017093 | 3300049573 | Bacteria | 5338 |
| 173 | Ga0501038_0012817 | 3300049574 | Bacteria | 7656 |
| 174 | Ga0501038_0013604 | 3300049574 | Bacteria | 7414 |
| 175 | Ga0501039_0039757 | 3300049575 | Bacteria | 3632 |
| 176 | Ga0501041_0062448 | 3300049577 | Bacteria | 2281 |
| 177 | Ga0501043_0001446 | 3300049579 | Bacteria | 20739 |
| 178 | Ga0501043_0005548 | 3300049579 | Bacteria | 10173 |
| 179 | Ga0501043_0008633 | 3300049579 | Bacteria | 8030 |
| 180 | Ga0501046_0002539 | 3300049580 | Bacteria | 17062 |
| 181 | Ga0501046_0003325 | 3300049580 | Bacteria | 14782 |
| 182 | Ga0501046_0026523 | 3300049580 | Bacteria | 4732 |
| 183 | Ga0501047_0008706 | 3300049581 | Bacteria | 9578 |
| 184 | Ga0501047_0031616 | 3300049581 | Bacteria | 5106 |
| 185 | Ga0501047_0036320 | 3300049581 | Bacteria | 4762 |
| 186 | Ga0501047_0042192 | 3300049581 | Bacteria | 4409 |
| 187 | Ga0501048_0010340 | 3300049582 | Bacteria | 6974 |
| 188 | Ga0501067_0012398 | 3300049583 | Bacteria | 4729 |
| 189 | Ga0501067_0035163 | 3300049583 | Bacteria | 2782 |
| 190 | Ga0501068_0002132 | 3300049584 | Bacteria | 10536 |
| 191 | Ga0501068_0093701 | 3300049584 | Bacteria | 1856 |
| 192 | Ga0501070_0006209 | 3300049586 | Bacteria | 10181 |
| 193 | Ga0501070_0009038 | 3300049586 | Bacteria | 8429 |
| 194 | Ga0501070_0036924 | 3300049586 | Bacteria | 4080 |
| 195 | Ga0501072_0062921 | 3300049588 | Bacteria | 2927 |
| 196 | Ga0501072_0243651 | 3300049588 | Bacteria | 1432 |
| 197 | Ga0501073_0000083 | 3300049589 | Bacteria | 59733 |
| 198 | Ga0501073_0002480 | 3300049589 | Bacteria | 13772 |
| 199 | Ga0501074_0001790 | 3300049590 | Bacteria | 14696 |
| 200 | Ga0501077_0000088 | 3300049593 | Bacteria | 46551 |
| 201 | Ga0501080_0003162 | 3300049742 | Bacteria | 14508 |
| 202 | Ga0501080_0004733 | 3300049742 | Bacteria | 12134 |
| 203 | Ga0501080_0252840 | 3300049742 | Bacteria | 1607 |
| 204 | Ga0501035_0006382 | 3300049822 | Bacteria | 11088 |
| 205 | Ga0501035_0012769 | 3300049822 | Bacteria | 7759 |
| 206 | Ga0501044_0002166 | 3300049823 | Bacteria | 22521 |
| 207 | Ga0501044_0024324 | 3300049823 | Bacteria | 6433 |
| 208 | Ga0501044_0027270 | 3300049823 | Bacteria | 6039 |
| 209 | Ga0501044_0119038 | 3300049823 | Bacteria | 2643 |
| 210 | nmdc:mga06r32_29262_c1 | 3300050510 | Bacteria | 5161 |
| 211 | nmdc:mga08y16_129670_c1 | 3300050511 | Bacteria | 2623 |
| 212 | nmdc:mga08y16_82312_c1 | 3300050511 | Bacteria | 3355 |
| 213 | nmdc:mga0a205_134441_c1 | 3300050515 | Bacteria | 2373 |
| 214 | nmdc:mga0a205_74642_c1 | 3300050515 | Bacteria | 3276 |
| 215 | nmdc:mga0a205_81_c1 | 3300050515 | Bacteria | 53005 |
| 216 | Ga0495601_0018745 | 3300053077 | Bacteria | 4213 |
| 217 | Ga0500566_0018488 | 3300053094 | Bacteria | 4092 |
| 218 | Ga0500572_000706 | 3300053111 | Bacteria | 10831 |
| 219 | Ga0501084_0035133 | 3300054114 | Bacteria | 4190 |
| 220 | Ga0501082_0021081 | 3300060353 | Bacteria | 5620 |
| 221 | Ga0501082_0146331 | 3300060353 | Bacteria | 2051 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2857357740 | 2857361829 | 323 |
| 2 | 3300049588 | Ga0501072_0243651 | Ga0501072_0243651_330_1394 | 341 |
| 3 | 3300049822 | Ga0501035_0012769 | Ga0501035_0012769_6641_7732 | 350 |
| 4 | 3300049584 | Ga0501068_0093701 | Ga0501068_0093701_712_1842 | 363 |
| 5 | 3300035116 | Ga0373945_0016240 | Ga0373945_0016240_10_1179 | 371 |
| 6 | 3300049580 | Ga0501046_0003325 | Ga0501046_0003325_7323_8663 | 378 |
| 7 | 3300049581 | Ga0501047_0036320 | Ga0501047_0036320_1351_2691 | 378 |
| 8 | 3300049823 | Ga0501044_0024324 | Ga0501044_0024324_932_2272 | 389 |
| 9 | 3300048908 | Ga0496105_0120570 | Ga0496105_0120570_14_1324 | 390 |
| 10 | 3300039438 | Ga0436360_0683763 | Ga0436360_0683763_89_1492 | 391 |
| 11 | 3300044712 | Ga0453684_0009769 | Ga0453684_0009769_12163_13506 | 392 |
| 12 | 3300032005 | Ga0307411_10001861 | Ga0307411_100018617 | 394 |
| 13 | 3300049571 | Ga0501034_0024133 | Ga0501034_0024133_4595_5935 | 395 |
| 14 | 3300049579 | Ga0501043_0008633 | Ga0501043_0008633_5600_6940 | 395 |
| 15 | 3300049580 | Ga0501046_0002539 | Ga0501046_0002539_7638_8978 | 395 |
| 16 | 3300049586 | Ga0501070_0006209 | Ga0501070_0006209_247_1587 | 395 |
| 17 | 3300053077 | Ga0495601_0018745 | Ga0495601_0018745_2231_3580 | 398 |
| 18 | 3300049571 | Ga0501034_0212549 | Ga0501034_0212549_521_1876 | 399 |
| 19 | 3300025949 | Ga0207667_10145213 | Ga0207667_101452132 | 402 |
| 20 | 3300028800 | Ga0265338_10001162 | Ga0265338_1000116238 | 402 |
| 21 | 3300006844 | Ga0075428_100064544 | Ga0075428_1000645443 | 403 |
| 22 | 3300046511 | Ga0495608_0121914 | Ga0495608_0121914_69_1457 | 403 |
| 23 | 3300048915 | Ga0496112_0056397 | Ga0496112_0056397_1194_2555 | 405 |
| 24 | iso_pu_bacteria | 2599185353 | 2600199432 | 405 |
| 25 | iso_pu_bacteria | 2600254943 | 2600401664 | 405 |
| 26 | 3300009101 | Ga0105247_10114019 | Ga0105247_101140192 | 406 |
| 27 | 3300005471 | Ga0070698_100062007 | Ga0070698_1000620074 | 407 |
| 28 | 3300026088 | Ga0207641_10018730 | Ga0207641_100187309 | 407 |
| 29 | 3300031241 | Ga0265325_10003872 | Ga0265325_100038727 | 408 |
| 30 | 3300031249 | Ga0265339_10003333 | Ga0265339_1000333312 | 408 |
| 31 | 3300031250 | Ga0265331_10005570 | Ga0265331_100055703 | 408 |
| 32 | 3300031595 | Ga0265313_10000050 | Ga0265313_1000005046 | 408 |
| 33 | 3300031711 | Ga0265314_10000306 | Ga0265314_1000030646 | 408 |
| 34 | 3300031712 | Ga0265342_10011241 | Ga0265342_100112418 | 408 |
| 35 | 3300009098 | Ga0105245_10014698 | Ga0105245_100146988 | 409 |
| 36 | 3300009177 | Ga0105248_10090189 | Ga0105248_100901892 | 409 |
| 37 | 3300009553 | Ga0105249_10176203 | Ga0105249_101762032 | 409 |
| 38 | 3300025961 | Ga0207712_10133661 | Ga0207712_101336612 | 409 |
| 39 | 3300048913 | Ga0496110_0152607 | Ga0496110_0152607_556_1932 | 409 |
| 40 | 3300049577 | Ga0501041_0062448 | Ga0501041_0062448_872_2233 | 409 |
| 41 | 3300049586 | Ga0501070_0036924 | Ga0501070_0036924_1203_2558 | 409 |
| 42 | 3300049588 | Ga0501072_0062921 | Ga0501072_0062921_942_2303 | 409 |
| 43 | 3300049742 | Ga0501080_0252840 | Ga0501080_0252840_24_1385 | 409 |
| 44 | 3300050515 | nmdc:mga0a205_134441_c1 | nmdc:mga0a205_134441_c1_110_1450 | 409 |
| 45 | 3300054114 | Ga0501084_0035133 | Ga0501084_0035133_1581_2942 | 409 |
| 46 | 3300060353 | Ga0501082_0146331 | Ga0501082_0146331_56_1417 | 409 |
| 47 | iso_pu_bacteria | 2687453257 | 2688065827 | 410 |
| 48 | iso_pu_bacteria | 2889415604 | 2889421825 | 410 |
| 49 | iso_pu_bacteria | 2920107658 | 2920113199 | 410 |
| 50 | 3300006844 | Ga0075428_100384115 | Ga0075428_1003841152 | 411 |
| 51 | 3300006847 | Ga0075431_100394247 | Ga0075431_1003942471 | 411 |
| 52 | 3300049571 | Ga0501034_0008844 | Ga0501034_0008844_1182_2558 | 411 |
| 53 | 3300013307 | Ga0157372_10297332 | Ga0157372_102973322 | 412 |
| 54 | 3300021361 | Ga0213872_10009926 | Ga0213872_100099265 | 412 |
| 55 | 3300037418 | Ga0395900_0065728 | Ga0395900_0065728_1702_3087 | 412 |
| 56 | 3300039438 | Ga0436360_0561605 | Ga0436360_0561605_6458_7834 | 412 |
| 57 | 3300039447 | Ga0436361_0887939 | Ga0436361_0887939_141_1514 | 412 |
| 58 | 3300039453 | Ga0436362_0094217 | Ga0436362_0094217_5078_6454 | 412 |
| 59 | 3300006844 | Ga0075428_100005581 | Ga0075428_1000055819 | 413 |
| 60 | 3300009094 | Ga0111539_10149618 | Ga0111539_101496182 | 413 |
| 61 | 3300049571 | Ga0501034_0009576 | Ga0501034_0009576_1225_2613 | 414 |
| 62 | 3300025914 | Ga0207671_10145975 | Ga0207671_101459752 | 415 |
| 63 | 3300031251 | Ga0265327_10000159 | Ga0265327_1000015918 | 415 |
| 64 | 3300005617 | Ga0068859_100000536 | Ga0068859_10000053634 | 416 |
| 65 | 3300006931 | Ga0097620_100000536 | Ga0097620_10000053634 | 416 |
| 66 | 3300009094 | Ga0111539_10340648 | Ga0111539_103406482 | 416 |
| 67 | 3300047320 | Ga0495672_0000511 | Ga0495672_0000511_24778_26142 | 416 |
| 68 | 3300005295 | Ga0065707_10102079 | Ga0065707_101020793 | 417 |
| 69 | 3300025936 | Ga0207670_10151774 | Ga0207670_101517742 | 417 |
| 70 | 3300032005 | Ga0307411_10042528 | Ga0307411_100425282 | 417 |
| 71 | 3300005563 | Ga0068855_100204008 | Ga0068855_1002040082 | 418 |
| 72 | 3300038443 | Ga0395901_0204468 | Ga0395901_0204468_116_1504 | 418 |
| 73 | 3300005354 | Ga0070675_100061769 | Ga0070675_1000617692 | 419 |
| 74 | 3300005436 | Ga0070713_100068079 | Ga0070713_1000680792 | 419 |
| 75 | 3300005548 | Ga0070665_100000298 | Ga0070665_10000029825 | 419 |
| 76 | 3300005577 | Ga0068857_100005931 | Ga0068857_1000059317 | 419 |
| 77 | 3300006852 | Ga0075433_10000067 | Ga0075433_1000006711 | 419 |
| 78 | 3300009094 | Ga0111539_10039646 | Ga0111539_100396469 | 419 |
| 79 | 3300009174 | Ga0105241_10071000 | Ga0105241_100710002 | 419 |
| 80 | 3300009177 | Ga0105248_10220838 | Ga0105248_102208382 | 419 |
| 81 | 3300010375 | Ga0105239_10005562 | Ga0105239_1000556211 | 419 |
| 82 | 3300013307 | Ga0157372_10051779 | Ga0157372_100517795 | 419 |
| 83 | 3300013307 | Ga0157372_10315957 | Ga0157372_103159571 | 419 |
| 84 | 3300025911 | Ga0207654_10037541 | Ga0207654_100375412 | 419 |
| 85 | 3300025913 | Ga0207695_10000534 | Ga0207695_1000053437 | 419 |
| 86 | 3300025926 | Ga0207659_10063738 | Ga0207659_100637383 | 419 |
| 87 | 3300025949 | Ga0207667_10074363 | Ga0207667_100743635 | 419 |
| 88 | 3300026116 | Ga0207674_10004220 | Ga0207674_1000422022 | 419 |
| 89 | 3300028379 | Ga0268266_10007671 | Ga0268266_100076716 | 419 |
| 90 | 3300035725 | Ga0373947_0036894 | Ga0373947_0036894_579_1991 | 419 |
| 91 | 3300046463 | Ga0495653_0041661 | Ga0495653_0041661_981_2393 | 419 |
| 92 | 3300046476 | Ga0495662_0014703 | Ga0495662_0014703_1783_3108 | 419 |
| 93 | 3300046514 | Ga0495618_0083867 | Ga0495618_0083867_627_1952 | 419 |
| 94 | 3300046517 | Ga0495630_0008235 | Ga0495630_0008235_3880_5292 | 419 |
| 95 | 3300046517 | Ga0495630_0038028 | Ga0495630_0038028_1150_2475 | 419 |
| 96 | 3300046533 | Ga0495640_0028934 | Ga0495640_0028934_1199_2524 | 419 |
| 97 | 3300046535 | Ga0495586_0017815 | Ga0495586_0017815_2251_3576 | 419 |
| 98 | 3300047319 | Ga0495674_0008030 | Ga0495674_0008030_8393_9805 | 419 |
| 99 | 3300047471 | Ga0495684_0013498 | Ga0495684_0013498_2351_3763 | 419 |
| 100 | 3300050511 | nmdc:mga08y16_82312_c1 | nmdc:mga08y16_82312_c1_307_1629 | 419 |
| 101 | 3300050515 | nmdc:mga0a205_74642_c1 | nmdc:mga0a205_74642_c1_732_2054 | 419 |
| 102 | 3300050515 | nmdc:mga0a205_81_c1 | nmdc:mga0a205_81_c1_5102_6427 | 419 |
| 103 | 3300005367 | Ga0070667_100024993 | Ga0070667_1000249933 | 420 |
| 104 | 3300005548 | Ga0070665_100027308 | Ga0070665_1000273087 | 420 |
| 105 | 3300025928 | Ga0207700_10057749 | Ga0207700_100577492 | 420 |
| 106 | 3300025986 | Ga0207658_10028220 | Ga0207658_100282203 | 420 |
| 107 | 3300047320 | Ga0495672_0036820 | Ga0495672_0036820_1028_2365 | 420 |
| 108 | 3300049569 | Ga0501032_0002071 | Ga0501032_0002071_7081_8406 | 420 |
| 109 | 3300049572 | Ga0501036_0016999 | Ga0501036_0016999_1463_2788 | 420 |
| 110 | 3300049573 | Ga0501037_0017093 | Ga0501037_0017093_723_2048 | 420 |
| 111 | 3300049574 | Ga0501038_0012817 | Ga0501038_0012817_5838_7163 | 420 |
| 112 | 3300049579 | Ga0501043_0001446 | Ga0501043_0001446_17444_18769 | 420 |
| 113 | 3300049580 | Ga0501046_0026523 | Ga0501046_0026523_2657_3982 | 420 |
| 114 | 3300049581 | Ga0501047_0031616 | Ga0501047_0031616_1323_2648 | 420 |
| 115 | 3300049582 | Ga0501048_0010340 | Ga0501048_0010340_4154_5479 | 420 |
| 116 | 3300049583 | Ga0501067_0035163 | Ga0501067_0035163_945_2270 | 420 |
| 117 | 3300049586 | Ga0501070_0009038 | Ga0501070_0009038_2418_3743 | 420 |
| 118 | 3300049589 | Ga0501073_0002480 | Ga0501073_0002480_7014_8339 | 420 |
| 119 | 3300049590 | Ga0501074_0001790 | Ga0501074_0001790_549_1874 | 420 |
| 120 | 3300049823 | Ga0501044_0027270 | Ga0501044_0027270_2271_3596 | 420 |
| 121 | 3300005327 | Ga0070658_10000605 | Ga0070658_100006053 | 421 |
| 122 | 3300005337 | Ga0070682_100000039 | Ga0070682_100000039112 | 421 |
| 123 | 3300009093 | Ga0105240_10067893 | Ga0105240_100678934 | 421 |
| 124 | 3300013105 | Ga0157369_10281447 | Ga0157369_102814472 | 421 |
| 125 | 3300025909 | Ga0207705_10003885 | Ga0207705_100038852 | 421 |
| 126 | 3300025913 | Ga0207695_10005806 | Ga0207695_1000580616 | 421 |
| 127 | 3300005844 | Ga0068862_100296228 | Ga0068862_1002962281 | 422 |
| 128 | 3300028380 | Ga0268265_10232539 | Ga0268265_102325391 | 422 |
| 129 | iso_pu_bacteria | 2671180531 | 2673167463 | 422 |
| 130 | 3300031852 | Ga0307410_10095083 | Ga0307410_100950832 | 423 |
| 131 | 3300045051 | Ga0451576_0000298 | Ga0451576_0000298_63062_64462 | 423 |
| 132 | 3300048912 | Ga0496109_0145062 | Ga0496109_0145062_592_1983 | 423 |
| 133 | 3300049569 | Ga0501032_0001915 | Ga0501032_0001915_662_2044 | 423 |
| 134 | 3300049584 | Ga0501068_0002132 | Ga0501068_0002132_3099_4481 | 423 |
| 135 | 3300049589 | Ga0501073_0000083 | Ga0501073_0000083_37712_39094 | 423 |
| 136 | 3300049593 | Ga0501077_0000088 | Ga0501077_0000088_19908_21290 | 423 |
| 137 | 3300049742 | Ga0501080_0003162 | Ga0501080_0003162_12896_14278 | 423 |
| 138 | 3300049823 | Ga0501044_0002166 | Ga0501044_0002166_2677_4059 | 423 |
| 139 | iso_pu_bacteria | 2643221699 | 2644548383 | 423 |
| 140 | 3300005353 | Ga0070669_100037385 | Ga0070669_1000373852 | 424 |
| 141 | 3300005355 | Ga0070671_100006755 | Ga0070671_1000067554 | 424 |
| 142 | 3300005367 | Ga0070667_100013914 | Ga0070667_1000139147 | 424 |
| 143 | 3300005548 | Ga0070665_100000121 | Ga0070665_100000121149 | 424 |
| 144 | 3300005548 | Ga0070665_100048252 | Ga0070665_1000482524 | 424 |
| 145 | 3300005617 | Ga0068859_100001281 | Ga0068859_10000128122 | 424 |
| 146 | 3300005841 | Ga0068863_100004023 | Ga0068863_10000402316 | 424 |
| 147 | 3300005842 | Ga0068858_100007271 | Ga0068858_10000727116 | 424 |
| 148 | 3300005843 | Ga0068860_100010284 | Ga0068860_10001028411 | 424 |
| 149 | 3300006931 | Ga0097620_100001281 | Ga0097620_10000128122 | 424 |
| 150 | 3300009094 | Ga0111539_10245718 | Ga0111539_102457182 | 424 |
| 151 | 3300013296 | Ga0157374_10158724 | Ga0157374_101587241 | 424 |
| 152 | 3300014325 | Ga0163163_10018256 | Ga0163163_100182568 | 424 |
| 153 | 3300014968 | Ga0157379_10009954 | Ga0157379_100099545 | 424 |
| 154 | 3300025903 | Ga0207680_10072372 | Ga0207680_100723722 | 424 |
| 155 | 3300025931 | Ga0207644_10006669 | Ga0207644_1000666915 | 424 |
| 156 | 3300026088 | Ga0207641_10007468 | Ga0207641_100074687 | 424 |
| 157 | 3300028379 | Ga0268266_10000106 | Ga0268266_1000010615 | 424 |
| 158 | 3300028379 | Ga0268266_10271941 | Ga0268266_102719412 | 424 |
| 159 | 3300028786 | Ga0307517_10012557 | Ga0307517_1001255711 | 424 |
| 160 | 3300031456 | Ga0307513_10002446 | Ga0307513_1000244623 | 424 |
| 161 | 3300031995 | Ga0307409_100073044 | Ga0307409_1000730443 | 424 |
| 162 | 3300046462 | Ga0495651_0160248 | Ga0495651_0160248_34_1389 | 424 |
| 163 | 3300048918 | Ga0496115_0001049 | Ga0496115_0001049_595_1944 | 424 |
| 164 | 3300050511 | nmdc:mga08y16_129670_c1 | nmdc:mga08y16_129670_c1_1198_2607 | 424 |
| 165 | 3300005331 | Ga0070670_100021899 | Ga0070670_1000218992 | 425 |
| 166 | 3300005355 | Ga0070671_100039118 | Ga0070671_1000391183 | 425 |
| 167 | 3300005617 | Ga0068859_100065105 | Ga0068859_1000651054 | 425 |
| 168 | 3300005841 | Ga0068863_100064279 | Ga0068863_1000642795 | 425 |
| 169 | 3300005985 | Ga0081539_10003625 | Ga0081539_1000362514 | 425 |
| 170 | 3300006931 | Ga0097620_100065102 | Ga0097620_1000651024 | 425 |
| 171 | 3300009551 | Ga0105238_10048857 | Ga0105238_100488574 | 425 |
| 172 | 3300025917 | Ga0207660_10076178 | Ga0207660_100761783 | 425 |
| 173 | 3300025924 | Ga0207694_10013350 | Ga0207694_100133506 | 425 |
| 174 | 3300026088 | Ga0207641_10031526 | Ga0207641_100315265 | 425 |
| 175 | 3300026118 | Ga0207675_100095840 | Ga0207675_1000958404 | 425 |
| 176 | 3300031730 | Ga0307516_10001565 | Ga0307516_1000156523 | 425 |
| 177 | 3300037312 | Ga0395899_0001195 | Ga0395899_0001195_11952_13301 | 425 |
| 178 | 3300037418 | Ga0395900_0003408 | Ga0395900_0003408_15433_16782 | 425 |
| 179 | 3300037466 | Ga0395898_0004322 | Ga0395898_0004322_11953_13302 | 425 |
| 180 | 3300037471 | Ga0395905_0002819 | Ga0395905_0002819_16865_18214 | 425 |
| 181 | 3300038443 | Ga0395901_0000342 | Ga0395901_0000342_43454_44803 | 425 |
| 182 | 3300046559 | Ga0495667_0006866 | Ga0495667_0006866_2519_3931 | 425 |
| 183 | 3300046689 | Ga0495613_0011010 | Ga0495613_0011010_3952_5364 | 425 |
| 184 | 3300005347 | Ga0070668_100078745 | Ga0070668_1000787452 | 426 |
| 185 | 3300005539 | Ga0068853_100064199 | Ga0068853_1000641992 | 426 |
| 186 | 3300005843 | Ga0068860_100080942 | Ga0068860_1000809424 | 426 |
| 187 | 3300025972 | Ga0207668_10080061 | Ga0207668_100800612 | 426 |
| 188 | 3300026041 | Ga0207639_10054590 | Ga0207639_100545901 | 426 |
| 189 | 3300028381 | Ga0268264_10002325 | Ga0268264_1000232525 | 426 |
| 190 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011729 | 426 |
| 191 | 3300031456 | Ga0307513_10000162 | Ga0307513_1000016224 | 426 |
| 192 | 3300053111 | Ga0500572_000706 | Ga0500572_000706_2547_3893 | 426 |
| 193 | 3300042876 | Ga0451577_0091473 | Ga0451577_0091473_1283_2689 | 427 |
| 194 | 3300044712 | Ga0453684_0001061 | Ga0453684_0001061_81582_82988 | 427 |
| 195 | 3300048915 | Ga0496112_0060193 | Ga0496112_0060193_1627_2973 | 427 |
| 196 | 3300053094 | Ga0500566_0018488 | Ga0500566_0018488_1882_3258 | 427 |
| 197 | 3300046694 | Ga0495649_0000981 | Ga0495649_0000981_17560_18939 | 428 |
| 198 | 3300046689 | Ga0495613_0000576 | Ga0495613_0000576_18590_19933 | 430 |
| 199 | 3300049569 | Ga0501032_0053318 | Ga0501032_0053318_718_2082 | 430 |
| 200 | 3300049571 | Ga0501034_0056418 | Ga0501034_0056418_1233_2597 | 430 |
| 201 | 3300049574 | Ga0501038_0013604 | Ga0501038_0013604_500_1864 | 430 |
| 202 | 3300049575 | Ga0501039_0039757 | Ga0501039_0039757_1284_2648 | 430 |
| 203 | 3300049579 | Ga0501043_0005548 | Ga0501043_0005548_2962_4326 | 430 |
| 204 | 3300049581 | Ga0501047_0008706 | Ga0501047_0008706_7511_8875 | 430 |
| 205 | 3300049583 | Ga0501067_0012398 | Ga0501067_0012398_2173_3537 | 430 |
| 206 | 3300049742 | Ga0501080_0004733 | Ga0501080_0004733_5767_7131 | 430 |
| 207 | 3300049822 | Ga0501035_0006382 | Ga0501035_0006382_3179_4543 | 430 |
| 208 | 3300049823 | Ga0501044_0119038 | Ga0501044_0119038_310_1674 | 430 |
| 209 | 3300060353 | Ga0501082_0021081 | Ga0501082_0021081_1216_2580 | 430 |
| 210 | 3300027378 | Ga0209981_1000043 | Ga0209981_10000439 | 431 |
| 211 | 3300027543 | Ga0209999_1004449 | Ga0209999_10044492 | 431 |
| 212 | 3300046558 | Ga0495633_0000510 | Ga0495633_0000510_37591_38970 | 431 |
| 213 | 3300048925 | Ga0496122_0011257 | Ga0496122_0011257_7517_8896 | 431 |
| 214 | 3300048926 | Ga0496123_0000699 | Ga0496123_0000699_1410_2789 | 431 |
| 215 | 3300013102 | Ga0157371_10064475 | Ga0157371_100644751 | 432 |
| 216 | 3300013105 | Ga0157369_10032567 | Ga0157369_100325674 | 432 |
| 217 | 3300006847 | Ga0075431_100033542 | Ga0075431_1000335426 | 433 |
| 218 | 3300050510 | nmdc:mga06r32_29262_c1 | nmdc:mga06r32_29262_c1_2233_3633 | 433 |
| 219 | 3300031251 | Ga0265327_10005226 | Ga0265327_1000522619 | 434 |
| 220 | 3300005341 | Ga0070691_10032400 | Ga0070691_100324002 | 436 |
| 221 | 3300005458 | Ga0070681_10104337 | Ga0070681_101043374 | 436 |
| 222 | 3300009093 | Ga0105240_10093376 | Ga0105240_100933762 | 436 |
| 223 | 3300013104 | Ga0157370_10148051 | Ga0157370_101480512 | 436 |
| 224 | 3300025912 | Ga0207707_10065663 | Ga0207707_100656634 | 436 |
| 225 | 3300025913 | Ga0207695_10000575 | Ga0207695_1000057525 | 436 |
| 226 | 3300025913 | Ga0207695_10105675 | Ga0207695_101056753 | 436 |
| 227 | 3300049581 | Ga0501047_0042192 | Ga0501047_0042192_1857_3221 | 436 |
| 228 | iso_pu_bacteria | 2643221663 | 2644352432 | 446 |
| 229 | 3300003781 | Ga0055536_1005404 | Ga0055536_10054048 | 447 |
| 230 | 3300048919 | Ga0496116_0023211 | Ga0496116_0023211_1949_3328 | 447 |
| 231 | iso_pu_bacteria | 2643221699 | 2644553151 | 447 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gae-assembly1.cif.gz_g | rnc in complex with a translocating secyeg | 0.894 | 10 | 422 |
| 5ch4-assembly1.cif.gz_Y | peptide-bound state of thermus thermophilus secyeg | 0.8889 | 1 | 425 |
| 5nco-assembly1.cif.gz_g | quaternary complex between srp, sr, and secyeg bound to the translating ribosome | 0.8884 | 8 | 425 |
| 2zjs-assembly1.cif.gz_Y | crystal structure of secye translocon from thermus thermophilus with a fab fragment | 0.8851 | 5 | 422 |
| 5nco-assembly1.cif.gz_g | quaternary complex between srp, sr, and secyeg bound to the translating ribosome | 0.8844 | 8 | 425 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AGA2_15_429_1.10.3370.10 | Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain | 0.9601 | 10 | 425 | 1.10.3370.10 |
| af_P0AGA2_15_429_1.10.3370.10 | Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain | 0.9533 | 10 | 425 | 1.10.3370.10 |
| af_Q6ZG25_138_543_1.10.3370.10 | Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain | 0.9369 | 17 | 425 | 1.10.3370.10 |
| af_O08387_1_424_1.10.3370.10 | Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain | 0.9254 | 6 | 425 | 1.10.3370.10 |
| af_P9WGN3_1_436_1.10.3370.10 | Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain | 0.9235 | 3 | 425 | 1.10.3370.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F0FCS0-F1-model_v4 | Protein translocase subunit SecY | 0.9679 | 10 | 433 |
GO:0005886
GO:0006605 GO:0043952 GO:0065002 |
| AF-A0A7W2B8I5-F1-model_v4 | Protein translocase subunit SecY | 0.965 | 1 | 433 |
GO:0005886
GO:0006605 GO:0043952 GO:0065002 |
| AF-A0A2E6IZX3-F1-model_v4 | Protein translocase subunit SecY | 0.9631 | 3 | 436 |
GO:0005886
GO:0006605 GO:0043952 GO:0065002 |
| AF-A0A7Y0D2H5-F1-model_v4 | Protein translocase subunit SecY | 0.962 | 15 | 436 |
GO:0005886
GO:0006605 GO:0043952 GO:0065002 |
| AF-A0A529TKS3-F1-model_v4 | Preprotein translocase subunit SecY | 0.9617 | 1 | 396 |
GO:0015031
GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar