F344047

General Info

Members Datasets Scaffolds Average Seq Length
231 177 462 163

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10639648|Ga0157378_106396482
Length 161
Sequence MTLTDLDVETLQGEKTTFGELTGGNAVLIVNVASKCGFTRQYEGLEKLHEEKSGLTVLGVPCNQFGAQEPGSAEEIAEFCSTTYGVTFPLLEKTDVNGPNKHPLYAQLEQVADAEGHTGDIRWNFEKFLVAPGGQVVGRFPPQVTPDDPQIVEAIEGVLPK

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
109 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
110 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
111 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
114 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 2501939600 Micromonospora sp. L5 Isolate Unclassified
168 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
169 2558860280 Kutzneria sp. 744 Isolate Unclassified
170 2643221670 Streptomyces sp. Root431 Isolate Unclassified
171 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
172 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
173 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
174 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
175 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
176 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
177 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 0
Isolates 4.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.26
Nodule 0
Rhizoplane 2.6
Rhizosphere 80.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10639648 3300013297 Bacteria 1078
2 Ga0070676_10258630 3300005328 Bacteria 1165
3 Ga0070683_100004871 3300005329 Bacteria 11120
4 Ga0068869_100001079 3300005334 Bacteria 15899
5 Ga0070680_100093741 3300005336 Bacteria 2488
6 Ga0070682_100332166 3300005337 Bacteria 1127
7 Ga0068868_100005859 3300005338 Bacteria 8667
8 Ga0070660_100030301 3300005339 Bacteria 4059
9 Ga0070661_100093493 3300005344 Bacteria 2228
10 Ga0070692_10018430 3300005345 Bacteria 3358
11 Ga0070668_100272524 3300005347 Bacteria 1411
12 Ga0070675_100002086 3300005354 Bacteria 14800
13 Ga0070675_100975535 3300005354 Bacteria 778
14 Ga0070671_100001318 3300005355 Bacteria 18648
15 Ga0070659_100039209 3300005366 Bacteria 3697
16 Ga0070713_100814210 3300005436 Bacteria 896
17 Ga0070710_10012114 3300005437 Bacteria 4274
18 Ga0070700_100214453 3300005441 Bacteria 1360
19 Ga0070663_100053341 3300005455 Bacteria 2886
20 Ga0070678_100781012 3300005456 Bacteria 866
21 Ga0070678_100877763 3300005456 Bacteria 819
22 Ga0070662_100178368 3300005457 Bacteria 1673
23 Ga0070681_10014736 3300005458 Bacteria 7772
24 Ga0070685_10905102 3300005466 Bacteria 657
25 Ga0070684_100018046 3300005535 Bacteria 5803
26 Ga0070672_100166330 3300005543 Bacteria 1832
27 Ga0070696_100545952 3300005546 Bacteria 928
28 Ga0070665_100524826 3300005548 Bacteria 1196
29 Ga0070664_100027222 3300005564 Bacteria 4749
30 Ga0068857_100015650 3300005577 Bacteria 6630
31 Ga0068854_100130688 3300005578 Bacteria 1917
32 Ga0068852_100030829 3300005616 Bacteria 4419
33 Ga0068861_100207306 3300005719 Bacteria 1649
34 Ga0068858_100025181 3300005842 Bacteria 5537
35 Ga0081455_10013005 3300005937 Bacteria 8251
36 Ga0070717_10423900 3300006028 Bacteria 1197
37 Ga0075365_10010607 3300006038 Bacteria 5377
38 Ga0075365_10050326 3300006038 Bacteria 2748
39 Ga0075365_10073925 3300006038 Bacteria 2298
40 Ga0075365_10084467 3300006038 Bacteria 2155
41 Ga0075365_10096600 3300006038 Bacteria 2019
42 Ga0075365_10129644 3300006038 Bacteria 1745
43 Ga0075365_10218483 3300006038 Bacteria 1337
44 Ga0075368_10046895 3300006042 Bacteria 1710
45 Ga0075363_100084232 3300006048 Bacteria 1743
46 Ga0075364_10029273 3300006051 Bacteria 3531
47 Ga0075364_10061911 3300006051 Bacteria 2455
48 Ga0075367_10041475 3300006178 Bacteria 2691
49 Ga0068865_100248800 3300006881 Bacteria 1402
50 Ga0068865_100651751 3300006881 Bacteria 895
51 Ga0068865_101024908 3300006881 Bacteria 724
52 Ga0111539_10008385 3300009094 Bacteria 13148
53 Ga0105245_10004563 3300009098 Bacteria 12224
54 Ga0105243_10323067 3300009148 Bacteria 1407
55 Ga0105243_10557977 3300009148 Bacteria 1095
56 Ga0105243_10753842 3300009148 Bacteria 955
57 Ga0105242_10419365 3300009176 Bacteria 1254
58 Ga0105242_10503374 3300009176 Bacteria 1152
59 Ga0105237_10961353 3300009545 Bacteria 861
60 Ga0105249_10154990 3300009553 Bacteria 2208
61 Ga0105239_10079966 3300010375 Bacteria 3597
62 Ga0105246_10161970 3300011119 Bacteria 1705
63 Ga0157370_11156325 3300013104 Bacteria 699
64 Ga0157374_10553399 3300013296 Bacteria 1158
65 Ga0157372_10190600 3300013307 Bacteria 2375
66 Ga0157372_10643304 3300013307 Bacteria 1235
67 Ga0157377_10017362 3300014745 Bacteria 3720
68 Ga0207645_10253481 3300025907 Bacteria 1165
69 Ga0207643_10060846 3300025908 Bacteria 2156
70 Ga0207707_10014194 3300025912 Bacteria 6940
71 Ga0207660_10574998 3300025917 Bacteria 917
72 Ga0207662_10711010 3300025918 Bacteria 705
73 Ga0207657_10100786 3300025919 Bacteria 2397
74 Ga0207649_10062566 3300025920 Bacteria 2346
75 Ga0207652_10132661 3300025921 Bacteria 2222
76 Ga0207650_10226359 3300025925 Bacteria 1507
77 Ga0207659_10505272 3300025926 Bacteria 1024
78 Ga0207700_10186276 3300025928 Bacteria 1741
79 Ga0207700_10643767 3300025928 Bacteria 945
80 Ga0207700_11188704 3300025928 Bacteria 681
81 Ga0207644_10001883 3300025931 Bacteria 13659
82 Ga0207690_10072932 3300025932 Bacteria 2372
83 Ga0207706_10009879 3300025933 Bacteria 8753
84 Ga0207686_10093528 3300025934 Bacteria 1991
85 Ga0207709_10245437 3300025935 Bacteria 1305
86 Ga0207691_10197391 3300025940 Bacteria 1752
87 Ga0207689_10002869 3300025942 Bacteria 15896
88 Ga0207689_10440695 3300025942 Bacteria 1088
89 Ga0207661_10018304 3300025944 Bacteria 5204
90 Ga0207679_10004044 3300025945 Bacteria 9110
91 Ga0207712_10130717 3300025961 Bacteria 1913
92 Ga0207668_10592814 3300025972 Bacteria 965
93 Ga0207640_10345890 3300025981 Bacteria 1193
94 Ga0207677_10003976 3300026023 Bacteria 7882
95 Ga0207703_10028107 3300026035 Bacteria 4430
96 Ga0207678_10003786 3300026067 Bacteria 13604
97 Ga0207708_10233901 3300026075 Bacteria 1476
98 Ga0207674_10006434 3300026116 Bacteria 13809
99 Ga0207675_100254257 3300026118 Bacteria 1701
100 Ga0207683_10010322 3300026121 Bacteria 7965
101 Ga0207683_10512736 3300026121 Bacteria 1108
102 Ga0207698_10033057 3300026142 Bacteria 3754
103 Ga0207698_10338621 3300026142 Bacteria 1416
104 Ga0207428_10100041 3300027907 Bacteria 2241
105 Ga0268265_10068978 3300028380 Bacteria 2744
106 Ga0265327_10000131 3300031251 Bacteria 164189
107 Ga0307513_10129175 3300031456 Bacteria 2476
108 Ga0307408_100517745 3300031548 Bacteria 1047
109 Ga0307408_101474441 3300031548 Bacteria 643
110 Ga0307514_10015217 3300031649 Bacteria 6356
111 Ga0307405_10013243 3300031731 Bacteria 4396
112 Ga0307405_10642951 3300031731 Bacteria 871
113 Ga0307413_10196125 3300031824 Bacteria 1454
114 Ga0307413_10384955 3300031824 Bacteria 1094
115 Ga0307410_10000337 3300031852 Bacteria 18104
116 Ga0307410_10355751 3300031852 Bacteria 1171
117 Ga0307406_10490480 3300031901 Bacteria 994
118 Ga0307407_10014519 3300031903 Bacteria 3860
119 Ga0307412_10448608 3300031911 Bacteria 1062
120 Ga0307412_11401471 3300031911 Bacteria 632
121 Ga0307409_100003360 3300031995 Bacteria 8672
122 Ga0307409_100046355 3300031995 Bacteria 3290
123 Ga0307409_102020889 3300031995 Bacteria 606
124 Ga0307416_100482017 3300032002 Bacteria 1300
125 Ga0307416_101154955 3300032002 Bacteria 880
126 Ga0307414_10362880 3300032004 Bacteria 1247
127 Ga0307414_11665035 3300032004 Bacteria 595
128 Ga0307415_100183433 3300032126 Bacteria 1644
129 Ga0307415_100701195 3300032126 Bacteria 913
130 Ga0373930_0078433 3300034816 Bacteria 760
131 Ga0373932_0000490 3300035112 Bacteria 12188
132 Ga0373932_0081836 3300035112 Bacteria 1021
133 Ga0316574_0088619 3300035398 Bacteria 1971
134 Ga0373931_0000013 3300035691 Bacteria 266932
135 Ga0373931_0000119 3300035691 Bacteria 35668
136 Ga0316584_0100916 3300036712 Bacteria 2161
137 Ga0373925_0479336 3300037068 Bacteria 1020
138 Ga0395901_0118247 3300038443 Bacteria 2785
139 Ga0436365_0856652 3300039437 Bacteria 1236
140 Ga0439465_0245396 3300041413 Bacteria 661
141 Ga0451791_0595733 3300041451 Bacteria 554
142 Ga0451797_0560502 3300041453 Bacteria 1513
143 Ga0451837_0333515 3300041494 Bacteria 828
144 Ga0451853_2493849 3300041512 Bacteria 1177
145 Ga0439433_0068081 3300041999 Bacteria 855
146 Ga0439446_0007724 3300042156 Bacteria 2834
147 Ga0466969_0017967 3300044656 Bacteria 3689
148 Ga0466966_0118584 3300044684 Bacteria 1627
149 Ga0466966_0235947 3300044684 Bacteria 1103
150 Ga0466961_0131584 3300044693 Bacteria 1568
151 Ga0466963_0495815 3300044694 Bacteria 862
152 Ga0466971_0090971 3300044719 Bacteria 1397
153 Ga0466957_0031687 3300044842 Bacteria 3161
154 Ga0466960_0023858 3300044901 Bacteria 2752
155 Ga0466959_0663980 3300045049 Bacteria 699
156 Ga0466967_0106500 3300045976 Bacteria 2570
157 Ga0495629_0065614 3300046459 Bacteria 2534
158 Ga0495641_0073661 3300046461 Bacteria 1532
159 Ga0495664_0443447 3300046477 Bacteria 778
160 Ga0495618_0765005 3300046514 Bacteria 564
161 Ga0495630_0077682 3300046517 Bacteria 2503
162 Ga0495640_0052166 3300046533 Bacteria 2810
163 Ga0495586_0153770 3300046535 Bacteria 1295
164 Ga0495634_0041575 3300046642 Bacteria 3121
165 Ga0495658_0059360 3300046683 Bacteria 2190
166 Ga0495680_0353255 3300047322 Bacteria 1023
167 Ga0496101_0203347 3300048904 Bacteria 1532
168 Ga0496102_0308657 3300048905 Bacteria 1491
169 Ga0496104_1188140 3300048907 Bacteria 666
170 Ga0496114_0445761 3300048917 Bacteria 1146
171 Ga0501032_0058667 3300049569 Bacteria 2584
172 Ga0501033_0259866 3300049570 Bacteria 1229
173 Ga0501034_0031187 3300049571 Bacteria 5416
174 Ga0501034_0394150 3300049571 Bacteria 1308
175 Ga0501037_0330035 3300049573 Bacteria 1055
176 Ga0501038_0628419 3300049574 Bacteria 810
177 Ga0501043_0002750 3300049579 Bacteria 14712
178 Ga0501043_0190335 3300049579 Bacteria 1596
179 Ga0501047_0027234 3300049581 Bacteria 5506
180 Ga0501047_0048067 3300049581 Bacteria 4121
181 Ga0501048_0925162 3300049582 Bacteria 627
182 Ga0501068_0022384 3300049584 Bacteria 3696
183 Ga0501068_0033128 3300049584 Bacteria 3076
184 Ga0501069_0001967 3300049585 Bacteria 10266
185 Ga0501070_0004216 3300049586 Bacteria 12358
186 Ga0501070_0010981 3300049586 Bacteria 7645
187 Ga0501070_0031214 3300049586 Bacteria 4463
188 Ga0501070_0474995 3300049586 Bacteria 1006
189 Ga0501071_0005183 3300049587 Bacteria 8350
190 Ga0501072_0811994 3300049588 Bacteria 732
191 Ga0501073_0007190 3300049589 Bacteria 8291
192 Ga0501073_0120672 3300049589 Bacteria 1817
193 Ga0501073_0539374 3300049589 Bacteria 806
194 Ga0501080_0000269 3300049742 Bacteria 39318
195 Ga0501080_0049157 3300049742 Bacteria 3925
196 Ga0501080_0910571 3300049742 Bacteria 766
197 Ga0501081_0314616 3300049743 Bacteria 1150
198 Ga0501083_0001867 3300049744 Bacteria 14463
199 Ga0501083_0204495 3300049744 Bacteria 1288
200 Ga0501035_0000742 3300049822 Bacteria 35160
201 Ga0501044_0000313 3300049823 Bacteria 61310
202 nmdc:mga03n38_282061_c1 3300050490 Bacteria 887
203 nmdc:mga00v17_360826_c1 3300050491 Bacteria 945
204 nmdc:mga00v17_47140_c1 3300050491 Bacteria 2609
205 nmdc:mga0yw44_123120_c1 3300050492 Bacteria 1672
206 nmdc:mga0yw44_126249_c1 3300050492 Bacteria 1652
207 nmdc:mga0yw44_133851_c1 3300050492 Bacteria 1607
208 nmdc:mga0yw44_19896_c1 3300050492 Bacteria 3712
209 nmdc:mga0yw44_276099_c1 3300050492 Bacteria 1122
210 nmdc:mga0yw44_4489_c1 3300050492 Bacteria 6410
211 nmdc:mga0yw44_71433_c1 3300050492 Bacteria 2155
212 nmdc:mga0yw44_87576_c1 3300050492 Bacteria 1963
213 nmdc:mga06z11_158757_c1 3300050494 Bacteria 1291
214 nmdc:mga07m45_152036_c1 3300050496 Bacteria 1342
215 nmdc:mga09592_617392_c1 3300050508 Bacteria 928
216 nmdc:mga08y16_33800_c1 3300050511 Bacteria 5371
217 Ga0500566_0000073 3300053094 Bacteria 48667
218 Ga0501084_0000918 3300054114 Bacteria 22781
219 Ga0501082_0030746 3300060353 Bacteria 4629
220 Ga0501082_0349912 3300060353 Bacteria 1288
221 2501942136 2501939600 Bacteria 6907073
222 2552105440 2551306166 Bacteria 9731570
223 2559430748 2558860280 Bacteria 11429938
224 2644386077 2643221670 Bacteria 6497041
225 2808873569 2808606365 Bacteria 4301966
226 2819699291 2818991463 Bacteria 7948711
227 2856864514 2856858025 Bacteria 7255264
228 2867511741 2867507094 Bacteria 6506033
229 2918502229 2918501144 Bacteria 8668083
230 2997600716 2997600082 Bacteria 9896405
231 649813958 649633069 Bacteria 6962533
232 Ga0157378_10639648
233 Ga0070676_10258630
234 Ga0070683_100004871
235 Ga0068869_100001079
236 Ga0070680_100093741
237 Ga0070682_100332166
238 Ga0068868_100005859
239 Ga0070660_100030301
240 Ga0070661_100093493
241 Ga0070692_10018430
242 Ga0070668_100272524
243 Ga0070675_100002086
244 Ga0070675_100975535
245 Ga0070671_100001318
246 Ga0070659_100039209
247 Ga0070713_100814210
248 Ga0070710_10012114
249 Ga0070700_100214453
250 Ga0070663_100053341
251 Ga0070678_100781012
252 Ga0070678_100877763
253 Ga0070662_100178368
254 Ga0070681_10014736
255 Ga0070685_10905102
256 Ga0070684_100018046
257 Ga0070672_100166330
258 Ga0070696_100545952
259 Ga0070665_100524826
260 Ga0070664_100027222
261 Ga0068857_100015650
262 Ga0068854_100130688
263 Ga0068852_100030829
264 Ga0068861_100207306
265 Ga0068858_100025181
266 Ga0081455_10013005
267 Ga0070717_10423900
268 Ga0075365_10010607
269 Ga0075365_10050326
270 Ga0075365_10073925
271 Ga0075365_10084467
272 Ga0075365_10096600
273 Ga0075365_10129644
274 Ga0075365_10218483
275 Ga0075368_10046895
276 Ga0075363_100084232
277 Ga0075364_10029273
278 Ga0075364_10061911
279 Ga0075367_10041475
280 Ga0068865_100248800
281 Ga0068865_100651751
282 Ga0068865_101024908
283 Ga0111539_10008385
284 Ga0105245_10004563
285 Ga0105243_10323067
286 Ga0105243_10557977
287 Ga0105243_10753842
288 Ga0105242_10419365
289 Ga0105242_10503374
290 Ga0105237_10961353
291 Ga0105249_10154990
292 Ga0105239_10079966
293 Ga0105246_10161970
294 Ga0157370_11156325
295 Ga0157374_10553399
296 Ga0157372_10190600
297 Ga0157372_10643304
298 Ga0157377_10017362
299 Ga0207645_10253481
300 Ga0207643_10060846
301 Ga0207707_10014194
302 Ga0207660_10574998
303 Ga0207662_10711010
304 Ga0207657_10100786
305 Ga0207649_10062566
306 Ga0207652_10132661
307 Ga0207650_10226359
308 Ga0207659_10505272
309 Ga0207700_10186276
310 Ga0207700_10643767
311 Ga0207700_11188704
312 Ga0207644_10001883
313 Ga0207690_10072932
314 Ga0207706_10009879
315 Ga0207686_10093528
316 Ga0207709_10245437
317 Ga0207691_10197391
318 Ga0207689_10002869
319 Ga0207689_10440695
320 Ga0207661_10018304
321 Ga0207679_10004044
322 Ga0207712_10130717
323 Ga0207668_10592814
324 Ga0207640_10345890
325 Ga0207677_10003976
326 Ga0207703_10028107
327 Ga0207678_10003786
328 Ga0207708_10233901
329 Ga0207674_10006434
330 Ga0207675_100254257
331 Ga0207683_10010322
332 Ga0207683_10512736
333 Ga0207698_10033057
334 Ga0207698_10338621
335 Ga0207428_10100041
336 Ga0268265_10068978
337 Ga0265327_10000131
338 Ga0307513_10129175
339 Ga0307408_100517745
340 Ga0307408_101474441
341 Ga0307514_10015217
342 Ga0307405_10013243
343 Ga0307405_10642951
344 Ga0307413_10196125
345 Ga0307413_10384955
346 Ga0307410_10000337
347 Ga0307410_10355751
348 Ga0307406_10490480
349 Ga0307407_10014519
350 Ga0307412_10448608
351 Ga0307412_11401471
352 Ga0307409_100003360
353 Ga0307409_100046355
354 Ga0307409_102020889
355 Ga0307416_100482017
356 Ga0307416_101154955
357 Ga0307414_10362880
358 Ga0307414_11665035
359 Ga0307415_100183433
360 Ga0307415_100701195
361 Ga0373930_0078433
362 Ga0373932_0000490
363 Ga0373932_0081836
364 Ga0316574_0088619
365 Ga0373931_0000013
366 Ga0373931_0000119
367 Ga0316584_0100916
368 Ga0373925_0479336
369 Ga0395901_0118247
370 Ga0436365_0856652
371 Ga0439465_0245396
372 Ga0451791_0595733
373 Ga0451797_0560502
374 Ga0451837_0333515
375 Ga0451853_2493849
376 Ga0439433_0068081
377 Ga0439446_0007724
378 Ga0466969_0017967
379 Ga0466966_0118584
380 Ga0466966_0235947
381 Ga0466961_0131584
382 Ga0466963_0495815
383 Ga0466971_0090971
384 Ga0466957_0031687
385 Ga0466960_0023858
386 Ga0466959_0663980
387 Ga0466967_0106500
388 Ga0495629_0065614
389 Ga0495641_0073661
390 Ga0495664_0443447
391 Ga0495618_0765005
392 Ga0495630_0077682
393 Ga0495640_0052166
394 Ga0495586_0153770
395 Ga0495634_0041575
396 Ga0495658_0059360
397 Ga0495680_0353255
398 Ga0496101_0203347
399 Ga0496102_0308657
400 Ga0496104_1188140
401 Ga0496114_0445761
402 Ga0501032_0058667
403 Ga0501033_0259866
404 Ga0501034_0031187
405 Ga0501034_0394150
406 Ga0501037_0330035
407 Ga0501038_0628419
408 Ga0501043_0002750
409 Ga0501043_0190335
410 Ga0501047_0027234
411 Ga0501047_0048067
412 Ga0501048_0925162
413 Ga0501068_0022384
414 Ga0501068_0033128
415 Ga0501069_0001967
416 Ga0501070_0004216
417 Ga0501070_0010981
418 Ga0501070_0031214
419 Ga0501070_0474995
420 Ga0501071_0005183
421 Ga0501072_0811994
422 Ga0501073_0007190
423 Ga0501073_0120672
424 Ga0501073_0539374
425 Ga0501080_0000269
426 Ga0501080_0049157
427 Ga0501080_0910571
428 Ga0501081_0314616
429 Ga0501083_0001867
430 Ga0501083_0204495
431 Ga0501035_0000742
432 Ga0501044_0000313
433 nmdc:mga03n38_282061_c1
434 nmdc:mga00v17_360826_c1
435 nmdc:mga00v17_47140_c1
436 nmdc:mga0yw44_123120_c1
437 nmdc:mga0yw44_126249_c1
438 nmdc:mga0yw44_133851_c1
439 nmdc:mga0yw44_19896_c1
440 nmdc:mga0yw44_276099_c1
441 nmdc:mga0yw44_4489_c1
442 nmdc:mga0yw44_71433_c1
443 nmdc:mga0yw44_87576_c1
444 nmdc:mga06z11_158757_c1
445 nmdc:mga07m45_152036_c1
446 nmdc:mga09592_617392_c1
447 nmdc:mga08y16_33800_c1
448 Ga0500566_0000073
449 Ga0501084_0000918
450 Ga0501082_0030746
451 Ga0501082_0349912
452 2501942136
453 2552105440
454 2559430748
455 2644386077
456 2808873569
457 2819699291
458 2856864514
459 2867511741
460 2918502229
461 2997600716
462 649813958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

3

109

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7l8l-assembly1.cif.gz_A crystal structure of human r152h gpx4-u46c 0.9298 2 160
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9245 1 162
2gs3-assembly1.cif.gz_A crystal structure of the selenocysteine to glycine mutant of human glutathione peroxidase 4(gpx4) 0.9162 2 160
5h5r-assembly1.cif.gz_A crystal structure of human gpx4 in complex with gxpep-2 0.9132 1 160
5l71-assembly1.cif.gz_A crystal structure of mouse phospholipid hydroperoxide glutathione peroxidase 4 (gpx4) 0.9132 1 160
ID Description Score Start End Superfamily
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9349 2 162 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9287 1 160 3.40.30.10
af_Q4CY93_66_221_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9251 2 159 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9231 1 160 3.40.30.10
af_P06610_1_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9156 2 162 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6V8LJH2-F1-model_v4 Glutathione peroxidase 0.9755 1 161 GO:0004601
GO:0034599
AF-A0A6F8Z012-F1-model_v4 Glutathione peroxidase 0.9737 1 161 GO:0004601
GO:0034599
AF-A0A7W1ZA70-F1-model_v4 Glutathione peroxidase 0.9737 3 162 GO:0004601
GO:0034599
AF-A0A1H2HPF9-F1-model_v4 Glutathione peroxidase 0.973 1 162 GO:0004601
GO:0034599
AF-A0A1G6NWZ3-F1-model_v4 Glutathione peroxidase 0.9719 1 162 GO:0004601
GO:0034599

Map