F343637

General Info

Members Datasets Scaffolds Average Seq Length
231 188 229 168

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10010646|rootL2_100106464
Length 201
Sequence MKTPPLLKTIRRTPVRPGLGTAALVAALLATAGCSSPVKLDQNSAAAPVETRNVTPAAPGNASGTAGGVGQSNVAVVDVVPKQPPSAAAPSDIPRVVYFDFDSYVVRDEYRNVIEGNAKLLSTDRKKRVLIEGHTDERGGSEYNLALGQRRAEAVARSLSLLGVQDGQLEPVSFGKERPVATGSDEAAWAKNRRAELKERQ

Samples

Sample ID Description Type Environment
1 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
2 2643221660 Methylibium sp. Root1272 Isolate Unclassified
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
103 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
104 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
105 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
108 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
109 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
113 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
114 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
115 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
116 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
117 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
118 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
119 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
120 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
121 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
122 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
148 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
149 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
150 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
151 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
164 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
165 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
166 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
167 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
168 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
169 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
170 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
171 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
172 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
173 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
174 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
175 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
176 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
177 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
186 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
187 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.64
Metatranscriptomes 6.49
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 0
Rhizoplane 0.87
Rhizosphere 88.31
Stem 0
Stem Tuber 0
Unclassified 6.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006778J45830_1049618 3300003162 Bacteria 3603
2 Ga0006777J48905_1043221 3300003308 Bacteria 1763
3 rootH1_10025822 3300003316 Bacteria 5542
4 rootL2_10010646 3300003322 Bacteria 6712
5 rootL2_10219894 3300003322 Bacteria 1209
6 rootH1_10020709 3300003323 Bacteria 2177
7 Ga0007409J51694_1095500 3300003575 Bacteria 1100
8 Ga0070658_10203767 3300005327 Bacteria 1670
9 Ga0070670_100139529 3300005331 Bacteria 2096
10 Ga0068869_100047294 3300005334 Bacteria 3107
11 Ga0068868_100064924 3300005338 Bacteria 2899
12 Ga0070687_100255975 3300005343 Bacteria 1090
13 Ga0070661_100011675 3300005344 Bacteria 6124
14 Ga0070661_100615778 3300005344 Bacteria 879
15 Ga0070668_100350267 3300005347 Bacteria 1250
16 Ga0070675_100011334 3300005354 Bacteria 6978
17 Ga0070675_100099839 3300005354 Bacteria 2444
18 Ga0070671_100020757 3300005355 Bacteria 5357
19 Ga0070671_100172240 3300005355 Bacteria 1831
20 Ga0070671_100824862 3300005355 Bacteria 808
21 Ga0070674_100007899 3300005356 Bacteria 6295
22 Ga0070674_100389046 3300005356 Bacteria 1136
23 Ga0070673_100022984 3300005364 Bacteria 4549
24 Ga0070688_100610543 3300005365 Bacteria 836
25 Ga0070659_100001311 3300005366 Bacteria 18019
26 Ga0070667_100113296 3300005367 Bacteria 2354
27 Ga0070667_100172902 3300005367 Bacteria 1908
28 Ga0070708_100031559 3300005445 Bacteria 4587
29 Ga0070663_100000287 3300005455 Bacteria 25700
30 Ga0070678_100140033 3300005456 Bacteria 1935
31 Ga0070678_100775721 3300005456 Bacteria 869
32 Ga0070662_100226064 3300005457 Bacteria 1495
33 Ga0068867_100000005 3300005459 Bacteria 174097
34 Ga0068867_100010861 3300005459 Bacteria 6422
35 Ga0070706_100471393 3300005467 Bacteria 1168
36 Ga0068853_101112043 3300005539 Bacteria 762
37 Ga0070672_100013084 3300005543 Bacteria 5849
38 Ga0070672_100268166 3300005543 Bacteria 1441
39 Ga0070665_100052833 3300005548 Bacteria 4075
40 Ga0070665_100090627 3300005548 Bacteria 3063
41 Ga0070664_100042947 3300005564 Bacteria 3814
42 Ga0070664_100044929 3300005564 Bacteria 3730
43 Ga0068857_100006957 3300005577 Bacteria 9735
44 Ga0068852_100093461 3300005616 Bacteria 2696
45 Ga0068859_100048585 3300005617 Bacteria 4262
46 Ga0068864_100018198 3300005618 Bacteria 5866
47 Ga0068870_10279790 3300005840 Bacteria 1046
48 Ga0068863_100041884 3300005841 Bacteria 4353
49 Ga0075365_10085304 3300006038 Bacteria 2145
50 Ga0075365_10313179 3300006038 Bacteria 1105
51 Ga0097621_100459586 3300006237 Bacteria 1148
52 Ga0075370_10160586 3300006353 Bacteria 1319
53 Ga0068871_100849161 3300006358 Bacteria 844
54 Ga0097620_100048585 3300006931 Bacteria 4262
55 Ga0105245_10012578 3300009098 Bacteria 7367
56 Ga0105247_10200347 3300009101 Bacteria 1341
57 Ga0114129_10105626 3300009147 Bacteria 3891
58 Ga0105243_10000515 3300009148 Bacteria 39435
59 Ga0105243_10014889 3300009148 Bacteria 5887
60 Ga0105243_10324799 3300009148 Bacteria 1403
61 Ga0105243_10402857 3300009148 Bacteria 1272
62 Ga0105238_11852484 3300009551 Bacteria 636
63 Ga0105249_10299788 3300009553 Bacteria 1611
64 Ga0105246_10115656 3300011119 Bacteria 1979
65 Ga0157378_10113282 3300013297 Bacteria 2490
66 Ga0163162_10200579 3300013306 Bacteria 2124
67 Ga0157375_10270778 3300013308 Bacteria 1860
68 Ga0182008_10085305 3300014497 Bacteria 1555
69 Ga0157377_10000022 3300014745 Bacteria 146702
70 Ga0157376_10317052 3300014969 Bacteria 1481
71 Ga0157376_10674645 3300014969 Bacteria 1036
72 Ga0163161_10994878 3300017792 Bacteria 716
73 Ga0207682_10061696 3300025893 Bacteria 1570
74 Ga0207680_10286448 3300025903 Bacteria 1146
75 Ga0207643_10153538 3300025908 Bacteria 1382
76 Ga0207705_10295124 3300025909 Bacteria 1242
77 Ga0207649_10025501 3300025920 Bacteria 3446
78 Ga0207681_10057884 3300025923 Bacteria 2651
79 Ga0207694_11121826 3300025924 Bacteria 666
80 Ga0207650_10362352 3300025925 Bacteria 1194
81 Ga0207659_10066264 3300025926 Bacteria 2620
82 Ga0207659_10119008 3300025926 Bacteria 2021
83 Ga0207687_10089587 3300025927 Bacteria 2240
84 Ga0207644_10015278 3300025931 Bacteria 5150
85 Ga0207644_10082447 3300025931 Bacteria 2379
86 Ga0207644_10931435 3300025931 Bacteria 728
87 Ga0207690_10007774 3300025932 Bacteria 6365
88 Ga0207706_10114947 3300025933 Bacteria 2367
89 Ga0207706_10269918 3300025933 Bacteria 1485
90 Ga0207709_10007798 3300025935 Bacteria 5935
91 Ga0207669_10294334 3300025937 Bacteria 1231
92 Ga0207691_10050226 3300025940 Bacteria 3819
93 Ga0207691_10271381 3300025940 Bacteria 1460
94 Ga0207689_10076801 3300025942 Bacteria 2746
95 Ga0207679_10000387 3300025945 Bacteria 31614
96 Ga0207679_10174125 3300025945 Bacteria 1774
97 Ga0207651_10072682 3300025960 Bacteria 2443
98 Ga0207668_10645384 3300025972 Bacteria 926
99 Ga0207677_10171766 3300026023 Bacteria 1696
100 Ga0207678_10003250 3300026067 Bacteria 14667
101 Ga0207641_10099616 3300026088 Bacteria 2557
102 Ga0207648_10000032 3300026089 Bacteria 128009
103 Ga0207648_10012318 3300026089 Bacteria 8005
104 Ga0207676_10693133 3300026095 Bacteria 986
105 Ga0207674_10050701 3300026116 Bacteria 4239
106 Ga0207683_10188490 3300026121 Bacteria 1872
107 Ga0207698_10088084 3300026142 Bacteria 2531
108 Ga0209974_10001360 3300027876 Bacteria 8805
109 Ga0209974_10044030 3300027876 Bacteria 1488
110 Ga0268266_10689120 3300028379 Bacteria 984
111 Ga0268264_10071883 3300028381 Bacteria 2932
112 Ga0307517_10169152 3300028786 Bacteria 1442
113 Ga0307515_10001640 3300028794 Bacteria 49762
114 Ga0307515_10175306 3300028794 Bacteria 2118
115 Ga0307512_10011308 3300030522 Bacteria 8463
116 Ga0307513_10593878 3300031456 Bacteria 817
117 Ga0307509_10090539 3300031507 Bacteria 3135
118 Ga0307408_100000099 3300031548 Bacteria 95526
119 Ga0307514_10269819 3300031649 Bacteria 986
120 Ga0307516_10002118 3300031730 Bacteria 26899
121 Ga0307410_10553685 3300031852 Bacteria 953
122 Ga0307412_11416283 3300031911 Bacteria 629
123 Ga0307414_10100961 3300032004 Bacteria 2171
124 Ga0307411_10000548 3300032005 Bacteria 13322
125 Ga0307415_100242131 3300032126 Bacteria 1460
126 Ga0373948_0001547 3300034817 Bacteria 3222
127 Ga0373940_0071947 3300035088 Bacteria 1008
128 Ga0373939_0000006 3300035114 Bacteria 78721
129 Ga0373960_0000041 3300035121 Bacteria 16652
130 Ga0373960_0042937 3300035121 Bacteria 1315
131 Ga0395905_0014801 3300037471 Bacteria 7438
132 Ga0395905_0015154 3300037471 Bacteria 7335
133 Ga0395905_0031460 3300037471 Bacteria 4996
134 Ga0395905_0186836 3300037471 Bacteria 1945
135 Ga0395905_0216879 3300037471 Bacteria 1791
136 Ga0451793_0269323 3300041452 Bacteria 945
137 Ga0451800_1416708 3300041459 Bacteria 1604
138 Ga0451839_0385584 3300041496 Bacteria 777
139 Ga0451853_1597157 3300041512 Bacteria 582
140 Ga0439449_0024324 3300042007 Bacteria 2265
141 Ga0439457_009639 3300042014 Bacteria 2244
142 Ga0450917_000320 3300042120 Bacteria 3566
143 Ga0450890_007561 3300042127 Bacteria 1388
144 Ga0450891_001120 3300042129 Bacteria 2785
145 Ga0450892_000574 3300042130 Bacteria 4224
146 Ga0450899_021455 3300042135 Bacteria 757
147 Ga0450900_010669 3300042136 Bacteria 1181
148 Ga0450903_006717 3300042138 Bacteria 1906
149 Ga0450889_000176 3300042144 Bacteria 6865
150 Ga0450916_003550 3300042530 Bacteria 1717
151 Ga0450901_010940 3300042533 Bacteria 941
152 Ga0466969_0000054 3300044656 Bacteria 59867
153 Ga0466969_0049343 3300044656 Bacteria 2077
154 Ga0466965_0060188 3300044683 Bacteria 1896
155 Ga0466965_0083893 3300044683 Bacteria 1613
156 Ga0466965_0272376 3300044683 Bacteria 912
157 Ga0466966_0027007 3300044684 Bacteria 3744
158 Ga0466966_0033284 3300044684 Bacteria 3337
159 Ga0466961_0016982 3300044693 Bacteria 4675
160 Ga0466961_0100951 3300044693 Bacteria 1817
161 Ga0466964_0151304 3300044706 Bacteria 1076
162 Ga0466971_0059369 3300044719 Bacteria 1727
163 Ga0466960_0079699 3300044901 Bacteria 1647
164 Ga0466959_0017209 3300045049 Bacteria 5294
165 Ga0466959_0091265 3300045049 Bacteria 2187
166 Ga0451576_0050084 3300045051 Bacteria 4382
167 Ga0451576_0111614 3300045051 Bacteria 2845
168 Ga0495590_0009145 3300046457 Bacteria 3760
169 Ga0495650_0002924 3300046471 Bacteria 12972
170 Ga0495582_0090084 3300046473 Bacteria 1710
171 Ga0495648_0101701 3300046524 Bacteria 1585
172 Ga0495622_0416818 3300046557 Bacteria 577
173 Ga0495668_0327139 3300046616 Bacteria 841
174 Ga0495613_0609214 3300046689 Bacteria 726
175 Ga0495671_0075795 3300046692 Bacteria 1650
176 Ga0495660_0081285 3300046810 Bacteria 1699
177 Ga0501306_016781 3300049127 Bacteria 987
178 Ga0501308_000293 3300049128 Bacteria 3027
179 Ga0501309_000252 3300049129 Bacteria 3860
180 Ga0501310_000326 3300049130 Bacteria 4339
181 Ga0501305_002993 3300049161 Bacteria 1876
182 Ga0501307_002455 3300049162 Bacteria 1730
183 Ga0501291_007226 3300049514 Bacteria 1500
184 Ga0501294_010882 3300049517 Bacteria 902
185 Ga0501297_006902 3300049520 Bacteria 1222
186 Ga0501300_002648 3300049523 Bacteria 2684
187 Ga0501312_002342 3300049528 Bacteria 2034
188 Ga0501314_000195 3300049530 Bacteria 3296
189 Ga0501315_000230 3300049531 Bacteria 3485
190 Ga0501315_006252 3300049531 Bacteria 1319
191 Ga0501316_011706 3300049532 Bacteria 1016
192 Ga0501317_004826 3300049533 Bacteria 1420
193 Ga0501032_0373304 3300049569 Bacteria 917
194 Ga0501034_0155196 3300049571 Bacteria 2264
195 Ga0501039_0301274 3300049575 Bacteria 1260
196 Ga0501043_0000004 3300049579 Bacteria 291085
197 Ga0501046_0000016 3300049580 Bacteria 234374
198 Ga0501047_0000012 3300049581 Bacteria 368824
199 Ga0501048_0000348 3300049582 Bacteria 31936
200 Ga0501210_002761 3300049657 Bacteria 1113
201 Ga0501211_005725 3300049658 Bacteria 1237
202 Ga0501217_012446 3300049661 Bacteria 1895
203 Ga0501223_010382 3300049663 Bacteria 1876
204 Ga0501235_003600 3300049669 Bacteria 3349
205 Ga0501236_004216 3300049670 Bacteria 1696
206 Ga0501253_003782 3300049683 Bacteria 1850
207 Ga0501258_001968 3300049687 Bacteria 1757
208 Ga0501221_005699 3300049704 Bacteria 2089
209 Ga0501225_0093539 3300049705 Bacteria 872
210 Ga0501262_016406 3300049759 Bacteria 980
211 Ga0501262_018823 3300049759 Bacteria 930
212 Ga0501267_000310 3300049764 Bacteria 3591
213 Ga0501268_042176 3300049765 Bacteria 862
214 Ga0501269_002260 3300049766 Bacteria 2392
215 Ga0501272_001703 3300049769 Bacteria 2115
216 Ga0501035_0112622 3300049822 Bacteria 2384
217 Ga0501035_0136360 3300049822 Bacteria 2136
218 Ga0501044_0220327 3300049823 Bacteria 1848
219 Ga0501044_0314318 3300049823 Bacteria 1492
220 Ga0501045_0042574 3300049824 Bacteria 3305
221 nmdc:mga0yw44_181773_c1 3300050492 Bacteria 1384
222 nmdc:mga0yw44_56627_c1 3300050492 Bacteria 2389
223 nmdc:mga0k408_811_c1 3300050493 Bacteria 17212
224 nmdc:mga07m45_151240_c1 3300050496 Bacteria 1346
225 nmdc:mga05p37_87097_c1 3300050507 Bacteria 3849
226 Ga0500650_0296771 3300053098 Bacteria 716
227 Ga0500570_057257 3300053724 Bacteria 1913
228 Ga0590071_000345 3300059421 Bacteria 13660
229 Ga0466962_0017228 3300061719 Bacteria 3480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100007899 Ga0070674_1000078993 144
2 3300025972 Ga0207668_10645384 Ga0207668_106453842 145
3 3300037471 Ga0395905_0015154 Ga0395905_0015154_4706_5239 147
4 3300041496 Ga0451839_0385584 Ga0451839_0385584_72_656 151
5 3300046457 Ga0495590_0009145 Ga0495590_0009145_634_1164 151
6 3300046810 Ga0495660_0081285 Ga0495660_0081285_581_1111 151
7 3300005355 Ga0070671_100824862 Ga0070671_1008248621 152
8 3300005331 Ga0070670_100139529 Ga0070670_1001395292 154
9 3300005355 Ga0070671_100020757 Ga0070671_1000207576 154
10 3300005356 Ga0070674_100389046 Ga0070674_1003890461 154
11 3300005367 Ga0070667_100172902 Ga0070667_1001729022 154
12 3300005456 Ga0070678_100775721 Ga0070678_1007757212 154
13 3300005548 Ga0070665_100052833 Ga0070665_1000528332 154
14 3300005617 Ga0068859_100048585 Ga0068859_1000485853 154
15 3300006931 Ga0097620_100048585 Ga0097620_1000485853 154
16 3300034817 Ga0373948_0001547 Ga0373948_0001547_146_679 154
17 3300035088 Ga0373940_0071947 Ga0373940_0071947_108_641 154
18 3300035114 Ga0373939_0000006 Ga0373939_0000006_45272_45805 154
19 3300035121 Ga0373960_0000041 Ga0373960_0000041_4651_5184 154
20 3300005618 Ga0068864_100018198 Ga0068864_1000181983 155
21 3300005841 Ga0068863_100041884 Ga0068863_1000418843 155
22 3300009101 Ga0105247_10200347 Ga0105247_102003472 155
23 3300013306 Ga0163162_10200579 Ga0163162_102005791 155
24 3300013308 Ga0157375_10270778 Ga0157375_102707782 155
25 3300025931 Ga0207644_10082447 Ga0207644_100824472 155
26 3300026088 Ga0207641_10099616 Ga0207641_100996162 155
27 3300028381 Ga0268264_10071883 Ga0268264_100718833 155
28 3300041452 Ga0451793_0269323 Ga0451793_0269323_289_858 155
29 3300045051 Ga0451576_0050084 Ga0451576_0050084_3388_3924 155
30 3300046616 Ga0495668_0327139 Ga0495668_0327139_163_774 155
31 3300050492 nmdc:mga0yw44_181773_c1 nmdc:mga0yw44_181773_c1_373_906 155
32 3300028794 Ga0307515_10175306 Ga0307515_101753062 156
33 3300041512 Ga0451853_1597157 Ga0451853_1597157_29_562 156
34 3300003323 rootH1_10020709 rootH1_100207092 157
35 3300006353 Ga0075370_10160586 Ga0075370_101605862 157
36 3300049127 Ga0501306_016781 Ga0501306_016781_130_666 157
37 3300049128 Ga0501308_000293 Ga0501308_000293_1190_1726 157
38 3300049129 Ga0501309_000252 Ga0501309_000252_1589_2125 157
39 3300049130 Ga0501310_000326 Ga0501310_000326_1441_1977 157
40 3300049161 Ga0501305_002993 Ga0501305_002993_612_1148 157
41 3300049162 Ga0501307_002455 Ga0501307_002455_409_945 157
42 3300049514 Ga0501291_007226 Ga0501291_007226_937_1473 157
43 3300049517 Ga0501294_010882 Ga0501294_010882_109_645 157
44 3300049520 Ga0501297_006902 Ga0501297_006902_636_1172 157
45 3300049523 Ga0501300_002648 Ga0501300_002648_1186_1722 157
46 3300049528 Ga0501312_002342 Ga0501312_002342_126_662 157
47 3300049530 Ga0501314_000195 Ga0501314_000195_1402_1938 157
48 3300049531 Ga0501315_000230 Ga0501315_000230_1422_1958 157
49 3300049532 Ga0501316_011706 Ga0501316_011706_356_892 157
50 3300049533 Ga0501317_004826 Ga0501317_004826_156_692 157
51 3300049657 Ga0501210_002761 Ga0501210_002761_184_720 157
52 3300049658 Ga0501211_005725 Ga0501211_005725_162_698 157
53 3300049661 Ga0501217_012446 Ga0501217_012446_511_1047 157
54 3300049663 Ga0501223_010382 Ga0501223_010382_62_598 157
55 3300049669 Ga0501235_003600 Ga0501235_003600_1238_1774 157
56 3300049670 Ga0501236_004216 Ga0501236_004216_719_1255 157
57 3300049683 Ga0501253_003782 Ga0501253_003782_725_1261 157
58 3300049687 Ga0501258_001968 Ga0501258_001968_730_1266 157
59 3300049704 Ga0501221_005699 Ga0501221_005699_614_1150 157
60 3300049705 Ga0501225_0093539 Ga0501225_0093539_84_620 157
61 3300049759 Ga0501262_018823 Ga0501262_018823_138_674 157
62 3300049764 Ga0501267_000310 Ga0501267_000310_2659_3195 157
63 3300049765 Ga0501268_042176 Ga0501268_042176_97_633 157
64 3300049766 Ga0501269_002260 Ga0501269_002260_932_1468 157
65 3300049769 Ga0501272_001703 Ga0501272_001703_936_1472 157
66 3300050496 nmdc:mga07m45_151240_c1 nmdc:mga07m45_151240_c1_351_887 157
67 3300006038 Ga0075365_10313179 Ga0075365_103131791 159
68 3300014497 Ga0182008_10085305 Ga0182008_100853052 160
69 3300032004 Ga0307414_10100961 Ga0307414_101009612 160
70 3300032005 Ga0307411_10000548 Ga0307411_1000054811 160
71 3300049531 Ga0501315_006252 Ga0501315_006252_450_986 160
72 3300049759 Ga0501262_016406 Ga0501262_016406_433_969 160
73 3300053098 Ga0500650_0296771 Ga0500650_0296771_37_567 160
74 3300005347 Ga0070668_100350267 Ga0070668_1003502671 161
75 3300005354 Ga0070675_100099839 Ga0070675_1000998393 161
76 3300005355 Ga0070671_100172240 Ga0070671_1001722402 161
77 3300005456 Ga0070678_100140033 Ga0070678_1001400333 161
78 3300005539 Ga0068853_101112043 Ga0068853_1011120431 161
79 3300005543 Ga0070672_100268166 Ga0070672_1002681661 161
80 3300005840 Ga0068870_10279790 Ga0068870_102797901 161
81 3300009148 Ga0105243_10324799 Ga0105243_103247992 161
82 3300009553 Ga0105249_10299788 Ga0105249_102997882 161
83 3300017792 Ga0163161_10994878 Ga0163161_109948781 161
84 3300025893 Ga0207682_10061696 Ga0207682_100616962 161
85 3300025908 Ga0207643_10153538 Ga0207643_101535382 161
86 3300025923 Ga0207681_10057884 Ga0207681_100578842 161
87 3300025926 Ga0207659_10066264 Ga0207659_100662644 161
88 3300025931 Ga0207644_10931435 Ga0207644_109314351 161
89 3300025940 Ga0207691_10271381 Ga0207691_102713812 161
90 3300025960 Ga0207651_10072682 Ga0207651_100726822 161
91 3300026121 Ga0207683_10188490 Ga0207683_101884903 161
92 3300042120 Ga0450917_000320 Ga0450917_000320_1824_2360 161
93 3300042127 Ga0450890_007561 Ga0450890_007561_236_772 161
94 3300042129 Ga0450891_001120 Ga0450891_001120_678_1214 161
95 3300042130 Ga0450892_000574 Ga0450892_000574_2845_3381 161
96 3300042136 Ga0450900_010669 Ga0450900_010669_577_1113 161
97 3300042138 Ga0450903_006717 Ga0450903_006717_625_1161 161
98 3300042144 Ga0450889_000176 Ga0450889_000176_942_1478 161
99 3300042530 Ga0450916_003550 Ga0450916_003550_170_706 161
100 3300042533 Ga0450901_010940 Ga0450901_010940_341_877 161
101 3300028794 Ga0307515_10001640 Ga0307515_100016409 162
102 3300030522 Ga0307512_10011308 Ga0307512_100113086 162
103 3300031852 Ga0307410_10553685 Ga0307410_105536852 162
104 3300032126 Ga0307415_100242131 Ga0307415_1002421312 162
105 3300044656 Ga0466969_0000054 Ga0466969_0000054_55377_55910 162
106 3300044683 Ga0466965_0272376 Ga0466965_0272376_324_881 162
107 3300044684 Ga0466966_0033284 Ga0466966_0033284_429_962 162
108 3300044693 Ga0466961_0016982 Ga0466961_0016982_3519_4052 162
109 3300045049 Ga0466959_0017209 Ga0466959_0017209_4211_4744 162
110 3300046471 Ga0495650_0002924 Ga0495650_0002924_6521_7063 162
111 3300046692 Ga0495671_0075795 Ga0495671_0075795_612_1145 162
112 3300053724 Ga0500570_057257 Ga0500570_057257_1267_1800 162
113 3300027876 Ga0209974_10044030 Ga0209974_100440301 163
114 3300046473 Ga0495582_0090084 Ga0495582_0090084_279_830 163
115 3300046557 Ga0495622_0416818 Ga0495622_0416818_13_564 163
116 3300046689 Ga0495613_0609214 Ga0495613_0609214_141_692 163
117 3300027876 Ga0209974_10001360 Ga0209974_100013608 164
118 3300044683 Ga0466965_0060188 Ga0466965_0060188_148_678 165
119 3300049569 Ga0501032_0373304 Ga0501032_0373304_62_613 165
120 3300049579 Ga0501043_0000004 Ga0501043_0000004_59191_59742 165
121 3300049580 Ga0501046_0000016 Ga0501046_0000016_232094_232645 165
122 3300049581 Ga0501047_0000012 Ga0501047_0000012_231774_232325 165
123 3300049582 Ga0501048_0000348 Ga0501048_0000348_8570_9121 165
124 3300049823 Ga0501044_0220327 Ga0501044_0220327_513_1064 165
125 3300049824 Ga0501045_0042574 Ga0501045_0042574_1792_2343 165
126 3300005467 Ga0070706_100471393 Ga0070706_1004713932 166
127 3300042007 Ga0439449_0024324 Ga0439449_0024324_118_660 166
128 3300042014 Ga0439457_009639 Ga0439457_009639_980_1522 166
129 3300005334 Ga0068869_100047294 Ga0068869_1000472943 167
130 3300005338 Ga0068868_100064924 Ga0068868_1000649242 167
131 3300005343 Ga0070687_100255975 Ga0070687_1002559752 167
132 3300005344 Ga0070661_100615778 Ga0070661_1006157782 167
133 3300005354 Ga0070675_100011334 Ga0070675_1000113344 167
134 3300005364 Ga0070673_100022984 Ga0070673_1000229842 167
135 3300005365 Ga0070688_100610543 Ga0070688_1006105431 167
136 3300005367 Ga0070667_100113296 Ga0070667_1001132962 167
137 3300005457 Ga0070662_100226064 Ga0070662_1002260642 167
138 3300005459 Ga0068867_100010861 Ga0068867_1000108619 167
139 3300005543 Ga0070672_100013084 Ga0070672_1000130844 167
140 3300005577 Ga0068857_100006957 Ga0068857_10000695710 167
141 3300006237 Ga0097621_100459586 Ga0097621_1004595862 167
142 3300009098 Ga0105245_10012578 Ga0105245_100125782 167
143 3300011119 Ga0105246_10115656 Ga0105246_101156562 167
144 3300014969 Ga0157376_10674645 Ga0157376_106746452 167
145 3300025903 Ga0207680_10286448 Ga0207680_102864482 167
146 3300025925 Ga0207650_10362352 Ga0207650_103623521 167
147 3300025926 Ga0207659_10119008 Ga0207659_101190082 167
148 3300025927 Ga0207687_10089587 Ga0207687_100895872 167
149 3300025931 Ga0207644_10015278 Ga0207644_100152783 167
150 3300025933 Ga0207706_10114947 Ga0207706_101149473 167
151 3300025937 Ga0207669_10294334 Ga0207669_102943341 167
152 3300025940 Ga0207691_10050226 Ga0207691_100502263 167
153 3300025942 Ga0207689_10076801 Ga0207689_100768013 167
154 3300026023 Ga0207677_10171766 Ga0207677_101717662 167
155 3300026089 Ga0207648_10012318 Ga0207648_100123182 167
156 3300026095 Ga0207676_10693133 Ga0207676_106931332 167
157 3300026116 Ga0207674_10050701 Ga0207674_100507014 167
158 3300044901 Ga0466960_0079699 Ga0466960_0079699_631_1170 168
159 3300049571 Ga0501034_0155196 Ga0501034_0155196_413_943 168
160 3300049822 Ga0501035_0136360 Ga0501035_0136360_1551_2081 168
161 3300049823 Ga0501044_0314318 Ga0501044_0314318_719_1249 168
162 3300044656 Ga0466969_0049343 Ga0466969_0049343_1512_2051 169
163 3300044683 Ga0466965_0083893 Ga0466965_0083893_962_1501 169
164 3300044684 Ga0466966_0027007 Ga0466966_0027007_2280_2819 169
165 3300044693 Ga0466961_0100951 Ga0466961_0100951_849_1388 169
166 3300044706 Ga0466964_0151304 Ga0466964_0151304_390_929 169
167 3300044719 Ga0466971_0059369 Ga0466971_0059369_1144_1683 169
168 3300045049 Ga0466959_0091265 Ga0466959_0091265_1358_1897 169
169 3300061719 Ga0466962_0017228 Ga0466962_0017228_2642_3181 169
170 3300009148 Ga0105243_10402857 Ga0105243_104028572 172
171 iso_pu_bacteria 2643221544 2643746343 172
172 3300003575 Ga0007409J51694_1095500 Ga0007409J51694_10955002 173
173 3300005327 Ga0070658_10203767 Ga0070658_102037672 173
174 3300005564 Ga0070664_100044929 Ga0070664_1000449293 173
175 3300006038 Ga0075365_10085304 Ga0075365_100853043 173
176 3300006358 Ga0068871_100849161 Ga0068871_1008491612 173
177 3300014969 Ga0157376_10317052 Ga0157376_103170522 173
178 3300025945 Ga0207679_10174125 Ga0207679_101741252 173
179 3300046524 Ga0495648_0101701 Ga0495648_0101701_757_1326 173
180 3300049575 Ga0501039_0301274 Ga0501039_0301274_645_1175 173
181 3300050492 nmdc:mga0yw44_56627_c1 nmdc:mga0yw44_56627_c1_1281_1811 173
182 3300005344 Ga0070661_100011675 Ga0070661_1000116759 174
183 3300005366 Ga0070659_100001311 Ga0070659_1000013112 174
184 3300005548 Ga0070665_100090627 Ga0070665_1000906272 174
185 3300005564 Ga0070664_100042947 Ga0070664_1000429473 174
186 3300013297 Ga0157378_10113282 Ga0157378_101132822 174
187 3300025920 Ga0207649_10025501 Ga0207649_100255013 174
188 3300025932 Ga0207690_10007774 Ga0207690_100077747 174
189 3300025933 Ga0207706_10269918 Ga0207706_102699182 174
190 3300025945 Ga0207679_10000387 Ga0207679_1000038725 174
191 3300028379 Ga0268266_10689120 Ga0268266_106891201 174
192 3300037471 Ga0395905_0186836 Ga0395905_0186836_1367_1900 174
193 iso_pu_bacteria 2643221660 2644340195 174
194 3300003316 rootH1_10025822 rootH1_100258223 176
195 3300009148 Ga0105243_10014889 Ga0105243_100148896 176
196 3300025909 Ga0207705_10295124 Ga0207705_102951242 176
197 3300031548 Ga0307408_100000099 Ga0307408_10000009935 176
198 3300037471 Ga0395905_0216879 Ga0395905_0216879_1194_1733 176
199 3300045051 Ga0451576_0111614 Ga0451576_0111614_1528_2064 176
200 3300059421 Ga0590071_000345 Ga0590071_000345_10203_10808 176
201 3300005445 Ga0070708_100031559 Ga0070708_1000315598 177
202 3300009147 Ga0114129_10105626 Ga0114129_101056263 177
203 3300037471 Ga0395905_0014801 Ga0395905_0014801_5479_6018 177
204 3300042135 Ga0450899_021455 Ga0450899_021455_167_706 177
205 3300049822 Ga0501035_0112622 Ga0501035_0112622_396_935 177
206 3300050507 nmdc:mga05p37_87097_c1 nmdc:mga05p37_87097_c1_1533_2084 177
207 3300031456 Ga0307513_10593878 Ga0307513_105938781 178
208 3300031911 Ga0307412_11416283 Ga0307412_114162831 179
209 3300050493 nmdc:mga0k408_811_c1 nmdc:mga0k408_811_c1_12904_13449 179
210 3300003322 rootL2_10010646 rootL2_100106464 182
211 3300005459 Ga0068867_100000005 Ga0068867_10000000575 182
212 3300005616 Ga0068852_100093461 Ga0068852_1000934612 182
213 3300009148 Ga0105243_10000515 Ga0105243_1000051541 182
214 3300009551 Ga0105238_11852484 Ga0105238_118524841 182
215 3300014745 Ga0157377_10000022 Ga0157377_1000002299 182
216 3300025924 Ga0207694_11121826 Ga0207694_111218261 182
217 3300025935 Ga0207709_10007798 Ga0207709_100077988 182
218 3300026089 Ga0207648_10000032 Ga0207648_1000003235 182
219 3300026142 Ga0207698_10088084 Ga0207698_100880841 182
220 3300028786 Ga0307517_10169152 Ga0307517_101691522 182
221 3300031507 Ga0307509_10090539 Ga0307509_100905395 182
222 3300031649 Ga0307514_10269819 Ga0307514_102698192 182
223 3300031730 Ga0307516_10002118 Ga0307516_100021183 182
224 3300035121 Ga0373960_0042937 Ga0373960_0042937_406_1011 182
225 3300041459 Ga0451800_1416708 Ga0451800_1416708_896_1501 182
226 3300003162 Ga0006778J45830_1049618 Ga0006778J45830_10496183 183
227 3300003308 Ga0006777J48905_1043221 Ga0006777J48905_10432212 183
228 3300003322 rootL2_10219894 rootL2_102198942 183
229 3300005455 Ga0070663_100000287 Ga0070663_10000028712 183
230 3300026067 Ga0207678_10003250 Ga0207678_100032507 183
231 3300037471 Ga0395905_0031460 Ga0395905_0031460_245_796 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00691

OmpA

OmpA family

98

193

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5n2c-assembly1.cif.gz_A crystal structure of the peptidoglycan-associated lipoprotein from burkholderia cenocepacia 0.965 77 183
4b5c-assembly3.cif.gz_C crystal structure of the peptidoglycan-associated lipoprotein from burkholderia pseudomallei 0.9647 77 183
5n2c-assembly1.cif.gz_C crystal structure of the peptidoglycan-associated lipoprotein from burkholderia cenocepacia 0.9623 77 183
2hqs-assembly1.cif.gz_H crystal structure of tolb/pal complex 0.9571 78 183
4g4x-assembly1.cif.gz_A crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii 0.9558 77 183
ID Description Score Start End Superfamily
5n2cC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9623 77 183 3.30.1330.60
5u1hB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9546 78 180 3.30.1330.60
2w8bC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9396 77 181 3.30.1330.60
3td4B00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9315 79 180 3.30.1330.60
2w8bC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9226 77 181 3.30.1330.60
ID Description Score Start End GO Terms
AF-A0A432RN74-F1-model_v4 Peptidoglycan-associated lipoprotein 0.9686 97 183 GO:0009279
AF-A0A3C0TD60-F1-model_v4 Peptidoglycan-associated lipoprotein Pal 0.9672 76 183 GO:0009279
GO:0051301
AF-A0A250FFT9-F1-model_v4 deleted 0.9633 79 180
AF-A0A1N7I303-F1-model_v4 OmpA family protein 0.9588 79 180 GO:0009279
AF-A0A7C5JEA3-F1-model_v4 OmpA-like domain-containing protein 0.9582 80 182 GO:0016020

Feature Viewer

pLDDT pTM Quality
72.19 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map