F343342

General Info

Members Datasets Scaffolds Average Seq Length
230 174 194 287

Family's Representative Sequence

Representative Sequence 3300046529|Ga0495652_0249874|Ga0495652_0249874_302_1261
Length 319
Sequence MPPAHLERAAYGCGAVVAVWGEDEGMTEVPSPTRRVAVTGSSGKLGRAVVAHLRESGWEVLSLDRARVPGDPGPFIDVDLTDYGQVVEALSGTVDEHRVRVDAVVHLAAVPASGLRSNAATFANNSAATYHVFAAARASGIAKVVWASSETVLGLPFDTPPPYAPVDEEYAPRPESTYSLNKVLEEEMARHFCRWNPALSMVGLRFSNVMDVADYALFPEFDADPTLRKWNLWGYIDGRDGAQAVRLALELDQPGADVFIIANADTVMARSSASLMAEVFPAVEVRKELGEHETLLSIDKARRVLGYEPRHRWRDELGW

Samples

Sample ID Description Type Environment
1 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
4 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
5 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
6 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
7 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
8 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
9 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
10 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
11 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
12 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
13 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
14 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
15 2858868258 Micromonospora sp. MH33 Isolate Unclassified
16 2858882152 Micromonospora noduli MED15 Isolate Nodule
17 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
18 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
19 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
20 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
21 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
22 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
23 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
24 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
25 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
26 2902582711 Micromonospora sp. AP08 Isolate Unclassified
27 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
28 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
29 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
30 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
118 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
119 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
120 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
170 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
171 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
172 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
173 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
174 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.35
Metatranscriptomes 0
Isolates 15.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 2.61
Rhizoplane 16.96
Rhizosphere 62.61
Stem 0
Stem Tuber 0
Unclassified 16.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10021389 3300001979 Bacteria 2243
2 JGI24737J22298_10019434 3300001990 Bacteria 2173
3 JGI24737J22298_10075819 3300001990 Bacteria 1003
4 JGI25406J46586_10081613 3300003203 Bacteria 991
5 Ga0070668_100006929 3300005347 Bacteria 8397
6 Ga0070669_100360446 3300005353 Unclassified 1182
7 Ga0070667_100000272 3300005367 Bacteria 58738
8 Ga0070714_100000289 3300005435 Bacteria 38421
9 Ga0070694_100008500 3300005444 Bacteria 6280
10 Ga0070694_100035836 3300005444 Bacteria 3283
11 Ga0070708_100040998 3300005445 Bacteria 4058
12 Ga0070708_100394560 3300005445 Bacteria 1305
13 Ga0070707_100001354 3300005468 Bacteria 24079
14 Ga0070707_100332650 3300005468 Bacteria 1476
15 Ga0070698_100339550 3300005471 Bacteria 1433
16 Ga0070698_100409574 3300005471 Bacteria 1290
17 Ga0070699_100005684 3300005518 Bacteria 10921
18 Ga0070679_100301129 3300005530 Bacteria 1554
19 Ga0070697_100135438 3300005536 Bacteria 2068
20 Ga0070695_100005351 3300005545 Bacteria 7558
21 Ga0070695_100031173 3300005545 Bacteria 3323
22 Ga0070696_100003214 3300005546 Bacteria 10881
23 Ga0070696_100006448 3300005546 Bacteria 7846
24 Ga0070696_100199957 3300005546 Bacteria 1491
25 Ga0070665_100001466 3300005548 Bacteria 27627
26 Ga0070704_100148006 3300005549 Bacteria 1842
27 Ga0068857_100470683 3300005577 Bacteria 1177
28 Ga0068859_100220958 3300005617 Bacteria 1982
29 Ga0068864_100000597 3300005618 Bacteria 30646
30 Ga0068864_100271405 3300005618 Bacteria 1581
31 Ga0068863_100000135 3300005841 Bacteria 78221
32 Ga0068858_100151732 3300005842 Bacteria 2179
33 Ga0068860_100000526 3300005843 Bacteria 46691
34 Ga0068862_100000459 3300005844 Bacteria 44048
35 Ga0068862_100032026 3300005844 Bacteria 4442
36 Ga0081455_10168459 3300005937 Bacteria 1671
37 Ga0081539_10004755 3300005985 Bacteria 14661
38 Ga0081539_10024218 3300005985 Bacteria 3946
39 Ga0070717_10327373 3300006028 Bacteria 1366
40 Ga0075431_100166492 3300006847 Bacteria 2266
41 Ga0075433_10041301 3300006852 Bacteria 3995
42 Ga0075433_10053792 3300006852 Unclassified 3511
43 Ga0097620_100220960 3300006931 Bacteria 1982
44 Ga0105248_10421661 3300009177 Bacteria 1503
45 Ga0105238_10088106 3300009551 Bacteria 3090
46 Ga0105249_10084249 3300009553 Bacteria 2960
47 Ga0105249_10110472 3300009553 Bacteria 2598
48 Ga0105239_10483292 3300010375 Bacteria 1407
49 Ga0163162_10152674 3300013306 Bacteria 2428
50 Ga0157372_10197074 3300013307 Bacteria 2333
51 Ga0157372_10238117 3300013307 Bacteria 2111
52 Ga0157375_10855707 3300013308 Bacteria 1056
53 Ga0163163_10291189 3300014325 Bacteria 1685
54 Ga0157379_10021458 3300014968 Bacteria 5716
55 Ga0157376_10109018 3300014969 Bacteria 2433
56 Ga0213876_10151194 3300021384 Bacteria 1234
57 Ga0207680_10027078 3300025903 Bacteria 3187
58 Ga0207647_10048556 3300025904 Bacteria 2635
59 Ga0207652_10023937 3300025921 Bacteria 5065
60 Ga0207646_10002613 3300025922 Bacteria 21170
61 Ga0207646_10228120 3300025922 Bacteria 1683
62 Ga0207694_10148069 3300025924 Bacteria 1891
63 Ga0207650_10000136 3300025925 Bacteria 89925
64 Ga0207664_10000002 3300025929 Bacteria 657053
65 Ga0207711_10043383 3300025941 Bacteria 3836
66 Ga0207711_10062409 3300025941 Bacteria 3215
67 Ga0207689_10061226 3300025942 Bacteria 3095
68 Ga0207712_10010021 3300025961 Bacteria 6007
69 Ga0207668_10000360 3300025972 Bacteria 29295
70 Ga0207668_10118432 3300025972 Bacteria 2001
71 Ga0207658_10000379 3300025986 Bacteria 43390
72 Ga0207703_10125042 3300026035 Bacteria 2213
73 Ga0207639_10396788 3300026041 Bacteria 1242
74 Ga0207702_10098254 3300026078 Bacteria 2579
75 Ga0207641_10000770 3300026088 Bacteria 34326
76 Ga0207676_10000523 3300026095 Bacteria 32225
77 Ga0207674_10101400 3300026116 Bacteria 2859
78 Ga0207674_10214404 3300026116 Bacteria 1874
79 Ga0207683_10157949 3300026121 Bacteria 2049
80 Ga0207683_10546776 3300026121 Bacteria 1071
81 Ga0268266_10001720 3300028379 Bacteria 25070
82 Ga0268266_10246870 3300028379 Bacteria 1650
83 Ga0268265_10003113 3300028380 Bacteria 12100
84 Ga0268265_10183703 3300028380 Bacteria 1799
85 Ga0268264_10000192 3300028381 Bacteria 126749
86 Ga0268264_10102238 3300028381 Bacteria 2493
87 Ga0307515_10175371 3300028794 Bacteria 2117
88 Ga0265340_10010351 3300031247 Bacteria 4989
89 Ga0265340_10015722 3300031247 Bacteria 3928
90 Ga0307513_10000149 3300031456 Bacteria 99930
91 Ga0307513_10009755 3300031456 Bacteria 12127
92 Ga0307513_10231348 3300031456 Bacteria 1661
93 Ga0307408_100166130 3300031548 Bacteria 1758
94 Ga0265313_10027009 3300031595 Bacteria 3012
95 Ga0307508_10213027 3300031616 Bacteria 1532
96 Ga0316577_10088394 3300031733 Bacteria 1734
97 Ga0307410_10089730 3300031852 Bacteria 2179
98 Ga0307409_100078826 3300031995 Bacteria 2652
99 Ga0307409_100300139 3300031995 Bacteria 1494
100 Ga0307409_100538205 3300031995 Bacteria 1144
101 Ga0307409_100631608 3300031995 Bacteria 1062
102 Ga0307414_10301459 3300032004 Bacteria 1356
103 Ga0307415_100036332 3300032126 Bacteria 3227
104 Ga0307415_100135962 3300032126 Bacteria 1869
105 Ga0316574_0177636 3300035398 Bacteria 1370
106 Ga0373931_0130685 3300035691 Bacteria 1445
107 Ga0316582_0006271 3300036647 Bacteria 6227
108 Ga0395898_0016814 3300037466 Bacteria 7473
109 Ga0395898_0084056 3300037466 Bacteria 3068
110 Ga0395901_0033038 3300038443 Bacteria 5339
111 Ga0395901_0141641 3300038443 Bacteria 2527
112 Ga0395901_0434090 3300038443 Bacteria 1345
113 Ga0436365_1315805 3300039437 Bacteria 3542
114 Ga0439466_0078999 3300041411 Bacteria 1039
115 Ga0451791_0131954 3300041451 Bacteria 1345
116 Ga0451791_1544018 3300041451 Bacteria 2302
117 Ga0451793_1758943 3300041452 Bacteria 1741
118 Ga0451797_0389436 3300041453 Bacteria 1101
119 Ga0451795_0521830 3300041456 Bacteria 2679
120 Ga0451841_0696452 3300041498 Bacteria 1364
121 Ga0451849_1356552 3300041505 Bacteria 1520
122 Ga0451851_0789320 3300041507 Bacteria 1031
123 Ga0451843_0224344 3300041509 Bacteria 3290
124 Ga0451853_0019065 3300041512 Bacteria 9159
125 Ga0466965_0172552 3300044683 Bacteria 1138
126 Ga0466960_0016094 3300044901 Bacteria 3237
127 Ga0466960_0084791 3300044901 Bacteria 1604
128 Ga0466967_0380469 3300045976 Bacteria 1370
129 Ga0495592_0443362 3300046454 Bacteria 815
130 Ga0495629_0083448 3300046459 Bacteria 2230
131 Ga0495641_0132707 3300046461 Bacteria 1112
132 Ga0495653_0014309 3300046463 Bacteria 6470
133 Ga0495650_0025224 3300046471 Bacteria 2792
134 Ga0495608_0100133 3300046511 Bacteria 1869
135 Ga0495652_0249874 3300046529 Bacteria 1315
136 Ga0495635_0161493 3300046663 Bacteria 1525
137 Ga0495646_0069417 3300046680 Bacteria 2079
138 Ga0495674_0282603 3300047319 Bacteria 1359
139 Ga0495674_0369314 3300047319 Bacteria 1162
140 Ga0496101_0088296 3300048904 Bacteria 2303
141 Ga0496102_0000453 3300048905 Bacteria 46525
142 Ga0496102_0011636 3300048905 Bacteria 7594
143 Ga0496102_0041814 3300048905 Bacteria 4152
144 Ga0496102_0422112 3300048905 Bacteria 1253
145 Ga0496103_0009177 3300048906 Bacteria 5857
146 Ga0496103_0036687 3300048906 Bacteria 3002
147 Ga0496104_0008949 3300048907 Bacteria 8900
148 Ga0496104_0361000 3300048907 Bacteria 1365
149 Ga0496105_0012952 3300048908 Bacteria 6608
150 Ga0496105_0329760 3300048908 Bacteria 1222
151 Ga0496107_0120974 3300048910 Bacteria 1929
152 Ga0496108_0046614 3300048911 Bacteria 3621
153 Ga0496108_0070190 3300048911 Bacteria 2957
154 Ga0496108_0128391 3300048911 Bacteria 2178
155 Ga0496108_0154894 3300048911 Bacteria 1978
156 Ga0496109_0001632 3300048912 Bacteria 18743
157 Ga0496109_0181348 3300048912 Bacteria 1978
158 Ga0496109_0262530 3300048912 Bacteria 1627
159 Ga0496109_0335843 3300048912 Bacteria 1427
160 Ga0496110_0000651 3300048913 Bacteria 23688
161 Ga0496110_0150302 3300048913 Bacteria 2109
162 Ga0496111_0000163 3300048914 Bacteria 30013
163 Ga0496112_0014458 3300048915 Bacteria 7325
164 Ga0496113_0005546 3300048916 Bacteria 7883
165 Ga0496114_0036355 3300048917 Bacteria 4071
166 Ga0496114_0041155 3300048917 Bacteria 3829
167 Ga0496114_0058427 3300048917 Bacteria 3221
168 Ga0496114_0086481 3300048917 Bacteria 2657
169 Ga0496114_0116795 3300048917 Bacteria 2291
170 Ga0496114_0172002 3300048917 Bacteria 1888
171 Ga0496114_0498819 3300048917 Bacteria 1077
172 Ga0496114_0517794 3300048917 Bacteria 1055
173 Ga0496115_0299047 3300048918 Bacteria 1319
174 Ga0496119_0002013 3300048922 Bacteria 22997
175 Ga0496120_0000942 3300048923 Bacteria 39992
176 Ga0496124_0265590 3300048927 Bacteria 1260
177 Ga0501031_0002241 3300049568 Bacteria 12235
178 Ga0501036_0001837 3300049572 Bacteria 16480
179 Ga0501039_0003981 3300049575 Bacteria 11107
180 Ga0501040_0003782 3300049576 Bacteria 9813
181 Ga0501046_0112747 3300049580 Bacteria 2076
182 Ga0501047_0137317 3300049581 Bacteria 2325
183 Ga0501068_0073370 3300049584 Bacteria 2091
184 Ga0501070_0471035 3300049586 Bacteria 1011
185 Ga0501071_0256118 3300049587 Bacteria 1321
186 Ga0501073_0106958 3300049589 Bacteria 1941
187 Ga0501075_0447128 3300049591 Bacteria 985
188 Ga0501076_0361445 3300049592 Bacteria 1192
189 Ga0501045_0316854 3300049824 Bacteria 1160
190 nmdc:mga09592_282109_c1 3300050508 Bacteria 1441
191 nmdc:mga0a205_16720_c1 3300050515 Bacteria 6870
192 nmdc:mga0a205_34818_c1 3300050515 Bacteria 4833
193 Ga0500604_0017251 3300053151 Bacteria 1996
194 Ga0500616_0006242 3300053153 Bacteria 7859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046454 Ga0495592_0443362 Ga0495592_0443362_59_781 238
2 3300046680 Ga0495646_0069417 Ga0495646_0069417_11_817 266
3 3300005937 Ga0081455_10168459 Ga0081455_101684592 267
4 3300044901 Ga0466960_0016094 Ga0466960_0016094_1743_2618 268
5 3300005347 Ga0070668_100006929 Ga0070668_1000069295 269
6 3300005367 Ga0070667_100000272 Ga0070667_10000027246 269
7 3300005548 Ga0070665_100001466 Ga0070665_10000146618 269
8 3300005617 Ga0068859_100220958 Ga0068859_1002209583 269
9 3300005618 Ga0068864_100000597 Ga0068864_10000059719 269
10 3300005841 Ga0068863_100000135 Ga0068863_10000013539 269
11 3300005842 Ga0068858_100151732 Ga0068858_1001517322 269
12 3300005843 Ga0068860_100000526 Ga0068860_1000005267 269
13 3300005844 Ga0068862_100000459 Ga0068862_10000045915 269
14 3300006931 Ga0097620_100220960 Ga0097620_1002209603 269
15 3300009553 Ga0105249_10110472 Ga0105249_101104722 269
16 3300013306 Ga0163162_10152674 Ga0163162_101526741 269
17 3300014325 Ga0163163_10291189 Ga0163163_102911892 269
18 3300014968 Ga0157379_10021458 Ga0157379_100214583 269
19 3300025903 Ga0207680_10027078 Ga0207680_100270784 269
20 3300025925 Ga0207650_10000136 Ga0207650_1000013630 269
21 3300025941 Ga0207711_10043383 Ga0207711_100433833 269
22 3300025961 Ga0207712_10010021 Ga0207712_100100218 269
23 3300025972 Ga0207668_10000360 Ga0207668_100003608 269
24 3300025986 Ga0207658_10000379 Ga0207658_1000037943 269
25 3300026035 Ga0207703_10125042 Ga0207703_101250422 269
26 3300026088 Ga0207641_10000770 Ga0207641_1000077028 269
27 3300026095 Ga0207676_10000523 Ga0207676_1000052319 269
28 3300028379 Ga0268266_10001720 Ga0268266_1000172012 269
29 3300028380 Ga0268265_10003113 Ga0268265_100031137 269
30 3300028381 Ga0268264_10000192 Ga0268264_1000019288 269
31 3300009177 Ga0105248_10421661 Ga0105248_104216612 272
32 iso_pu_bacteria 2757320536 2758227057 273
33 iso_pu_bacteria 2977228692 2977229066 273
34 3300031456 Ga0307513_10231348 Ga0307513_102313482 277
35 3300045976 Ga0466967_0380469 Ga0466967_0380469_44_877 277
36 3300048922 Ga0496119_0002013 Ga0496119_0002013_8881_9723 277
37 3300048923 Ga0496120_0000942 Ga0496120_0000942_8916_9758 277
38 3300049581 Ga0501047_0137317 Ga0501047_0137317_1166_1999 277
39 3300049586 Ga0501070_0471035 Ga0501070_0471035_85_918 277
40 3300046463 Ga0495653_0014309 Ga0495653_0014309_2676_3518 278
41 iso_pu_bacteria 2675903059 2676480346 279
42 iso_pu_bacteria 2734482000 2734971024 279
43 iso_pu_bacteria 2835188231 2835188723 279
44 3300006847 Ga0075431_100166492 Ga0075431_1001664923 280
45 3300025941 Ga0207711_10062409 Ga0207711_100624091 280
46 iso_pu_bacteria 2643221690 2644505822 280
47 iso_pu_bacteria 2643221694 2644524343 280
48 iso_pu_bacteria 2643221722 2644668442 280
49 3300014969 Ga0157376_10109018 Ga0157376_101090184 281
50 3300031247 Ga0265340_10010351 Ga0265340_100103515 281
51 3300031247 Ga0265340_10015722 Ga0265340_100157223 281
52 3300046459 Ga0495629_0083448 Ga0495629_0083448_749_1600 281
53 3300048917 Ga0496114_0116795 Ga0496114_0116795_745_1596 281
54 3300026116 Ga0207674_10214404 Ga0207674_102144042 282
55 3300028379 Ga0268266_10246870 Ga0268266_102468702 282
56 3300031456 Ga0307513_10009755 Ga0307513_1000975514 282
57 3300031995 Ga0307409_100300139 Ga0307409_1003001391 282
58 3300046471 Ga0495650_0025224 Ga0495650_0025224_1023_1874 282
59 3300046511 Ga0495608_0100133 Ga0495608_0100133_293_1147 282
60 3300046663 Ga0495635_0161493 Ga0495635_0161493_545_1399 282
61 3300047319 Ga0495674_0282603 Ga0495674_0282603_298_1152 282
62 3300048904 Ga0496101_0088296 Ga0496101_0088296_643_1500 282
63 3300048905 Ga0496102_0000453 Ga0496102_0000453_38653_39513 282
64 3300048906 Ga0496103_0036687 Ga0496103_0036687_1353_2213 282
65 3300048907 Ga0496104_0361000 Ga0496104_0361000_159_1016 282
66 3300048912 Ga0496109_0335843 Ga0496109_0335843_404_1255 282
67 3300048915 Ga0496112_0014458 Ga0496112_0014458_1535_2389 282
68 3300048917 Ga0496114_0086481 Ga0496114_0086481_757_1614 282
69 3300048917 Ga0496114_0498819 Ga0496114_0498819_204_1055 282
70 iso_pu_bacteria 2643221567 2643853254 282
71 iso_pu_bacteria 2643221624 2644137217 282
72 3300005618 Ga0068864_100271405 Ga0068864_1002714052 283
73 3300006028 Ga0070717_10327373 Ga0070717_103273731 283
74 3300031616 Ga0307508_10213027 Ga0307508_102130272 283
75 3300031995 Ga0307409_100538205 Ga0307409_1005382052 283
76 3300037466 Ga0395898_0084056 Ga0395898_0084056_2158_3009 283
77 3300048905 Ga0496102_0011636 Ga0496102_0011636_5537_6394 283
78 3300048905 Ga0496102_0422112 Ga0496102_0422112_14_877 283
79 3300048907 Ga0496104_0008949 Ga0496104_0008949_476_1333 283
80 3300048908 Ga0496105_0012952 Ga0496105_0012952_4247_5104 283
81 3300048911 Ga0496108_0046614 Ga0496108_0046614_60_917 283
82 3300048912 Ga0496109_0001632 Ga0496109_0001632_17855_18712 283
83 3300048912 Ga0496109_0262530 Ga0496109_0262530_367_1224 283
84 3300048913 Ga0496110_0000651 Ga0496110_0000651_5105_5962 283
85 3300048914 Ga0496111_0000163 Ga0496111_0000163_17_874 283
86 3300048916 Ga0496113_0005546 Ga0496113_0005546_5163_6020 283
87 3300048917 Ga0496114_0041155 Ga0496114_0041155_2373_3230 283
88 3300048917 Ga0496114_0517794 Ga0496114_0517794_38_895 283
89 3300048927 Ga0496124_0265590 Ga0496124_0265590_226_1083 283
90 3300053151 Ga0500604_0017251 Ga0500604_0017251_304_1158 283
91 3300053153 Ga0500616_0006242 Ga0500616_0006242_1053_1907 283
92 iso_pu_bacteria 2884994152 2884997671 283
93 3300003203 JGI25406J46586_10081613 JGI25406J46586_100816131 284
94 3300005353 Ga0070669_100360446 Ga0070669_1003604461 284
95 3300005471 Ga0070698_100339550 Ga0070698_1003395502 284
96 3300005985 Ga0081539_10024218 Ga0081539_100242182 284
97 3300006852 Ga0075433_10053792 Ga0075433_100537924 284
98 3300031456 Ga0307513_10000149 Ga0307513_1000014979 284
99 3300031548 Ga0307408_100166130 Ga0307408_1001661301 284
100 3300031995 Ga0307409_100078826 Ga0307409_1000788263 284
101 3300031995 Ga0307409_100631608 Ga0307409_1006316082 284
102 3300032004 Ga0307414_10301459 Ga0307414_103014592 284
103 3300032126 Ga0307415_100135962 Ga0307415_1001359623 284
104 3300035691 Ga0373931_0130685 Ga0373931_0130685_11_919 284
105 3300041451 Ga0451791_0131954 Ga0451791_0131954_391_1248 284
106 3300041451 Ga0451791_1544018 Ga0451791_1544018_1048_1908 284
107 3300046461 Ga0495641_0132707 Ga0495641_0132707_86_961 284
108 3300048908 Ga0496105_0329760 Ga0496105_0329760_321_1178 284
109 3300048913 Ga0496110_0150302 Ga0496110_0150302_1067_1948 284
110 3300048917 Ga0496114_0058427 Ga0496114_0058427_824_1687 284
111 3300048918 Ga0496115_0299047 Ga0496115_0299047_418_1281 284
112 3300049568 Ga0501031_0002241 Ga0501031_0002241_7374_8246 284
113 3300049572 Ga0501036_0001837 Ga0501036_0001837_691_1563 284
114 3300049575 Ga0501039_0003981 Ga0501039_0003981_82_954 284
115 3300049576 Ga0501040_0003782 Ga0501040_0003782_3396_4268 284
116 3300049580 Ga0501046_0112747 Ga0501046_0112747_833_1705 284
117 3300049584 Ga0501068_0073370 Ga0501068_0073370_222_1094 284
118 3300049587 Ga0501071_0256118 Ga0501071_0256118_372_1244 284
119 3300049589 Ga0501073_0106958 Ga0501073_0106958_59_919 284
120 3300049591 Ga0501075_0447128 Ga0501075_0447128_58_930 284
121 3300049592 Ga0501076_0361445 Ga0501076_0361445_142_1014 284
122 3300049824 Ga0501045_0316854 Ga0501045_0316854_206_1078 284
123 3300050508 nmdc:mga09592_282109_c1 nmdc:mga09592_282109_c1_454_1308 284
124 3300050515 nmdc:mga0a205_16720_c1 nmdc:mga0a205_16720_c1_969_1823 284
125 3300005577 Ga0068857_100470683 Ga0068857_1004706832 285
126 3300028794 Ga0307515_10175371 Ga0307515_101753711 285
127 3300031852 Ga0307410_10089730 Ga0307410_100897302 285
128 iso_pu_bacteria 2919446982 2919450827 285
129 iso_pu_bacteria 8003870546 8003877467 285
130 3300005444 Ga0070694_100035836 Ga0070694_1000358362 286
131 3300005468 Ga0070707_100332650 Ga0070707_1003326501 286
132 3300005530 Ga0070679_100301129 Ga0070679_1003011292 286
133 3300005536 Ga0070697_100135438 Ga0070697_1001354382 286
134 3300005545 Ga0070695_100031173 Ga0070695_1000311732 286
135 3300005546 Ga0070696_100003214 Ga0070696_10000321412 286
136 3300013308 Ga0157375_10855707 Ga0157375_108557071 286
137 3300021384 Ga0213876_10151194 Ga0213876_101511941 286
138 3300025921 Ga0207652_10023937 Ga0207652_100239374 286
139 3300025922 Ga0207646_10228120 Ga0207646_102281202 286
140 3300025942 Ga0207689_10061226 Ga0207689_100612264 286
141 3300025972 Ga0207668_10118432 Ga0207668_101184322 286
142 3300026121 Ga0207683_10157949 Ga0207683_101579492 286
143 3300032126 Ga0307415_100036332 Ga0307415_1000363322 286
144 3300039437 Ga0436365_1315805 Ga0436365_1315805_403_1272 286
145 3300041411 Ga0439466_0078999 Ga0439466_0078999_120_1004 286
146 3300048911 Ga0496108_0070190 Ga0496108_0070190_212_1078 286
147 3300048911 Ga0496108_0154894 Ga0496108_0154894_42_905 286
148 3300048917 Ga0496114_0172002 Ga0496114_0172002_269_1135 286
149 iso_pu_bacteria 2867319477 2867319947 286
150 3300001990 JGI24737J22298_10075819 JGI24737J22298_100758191 287
151 3300005445 Ga0070708_100040998 Ga0070708_1000409982 287
152 3300005445 Ga0070708_100394560 Ga0070708_1003945602 287
153 3300005468 Ga0070707_100001354 Ga0070707_10000135425 287
154 3300005471 Ga0070698_100409574 Ga0070698_1004095741 287
155 3300005518 Ga0070699_100005684 Ga0070699_1000056842 287
156 3300005545 Ga0070695_100005351 Ga0070695_1000053516 287
157 3300005546 Ga0070696_100006448 Ga0070696_1000064486 287
158 3300005546 Ga0070696_100199957 Ga0070696_1001999572 287
159 3300005549 Ga0070704_100148006 Ga0070704_1001480062 287
160 3300005985 Ga0081539_10004755 Ga0081539_100047554 287
161 3300006852 Ga0075433_10041301 Ga0075433_100413012 287
162 3300009551 Ga0105238_10088106 Ga0105238_100881061 287
163 3300025922 Ga0207646_10002613 Ga0207646_1000261322 287
164 3300025924 Ga0207694_10148069 Ga0207694_101480692 287
165 3300031595 Ga0265313_10027009 Ga0265313_100270095 287
166 3300031733 Ga0316577_10088394 Ga0316577_100883942 287
167 3300035398 Ga0316574_0177636 Ga0316574_0177636_189_1079 287
168 3300036647 Ga0316582_0006271 Ga0316582_0006271_1665_2555 287
169 3300038443 Ga0395901_0141641 Ga0395901_0141641_1111_2004 287
170 3300038443 Ga0395901_0434090 Ga0395901_0434090_408_1274 287
171 3300048905 Ga0496102_0041814 Ga0496102_0041814_284_1156 287
172 3300048906 Ga0496103_0009177 Ga0496103_0009177_2570_3442 287
173 3300048917 Ga0496114_0036355 Ga0496114_0036355_1311_2183 287
174 3300050515 nmdc:mga0a205_34818_c1 nmdc:mga0a205_34818_c1_3662_4528 287
175 3300013307 Ga0157372_10238117 Ga0157372_102381172 288
176 3300026121 Ga0207683_10546776 Ga0207683_105467761 288
177 3300037466 Ga0395898_0016814 Ga0395898_0016814_323_1195 288
178 3300038443 Ga0395901_0033038 Ga0395901_0033038_3288_4160 288
179 3300041452 Ga0451793_1758943 Ga0451793_1758943_280_1152 288
180 3300041453 Ga0451797_0389436 Ga0451797_0389436_218_1090 288
181 3300041456 Ga0451795_0521830 Ga0451795_0521830_1712_2584 288
182 3300041498 Ga0451841_0696452 Ga0451841_0696452_398_1270 288
183 3300041505 Ga0451849_1356552 Ga0451849_1356552_135_1007 288
184 3300041507 Ga0451851_0789320 Ga0451851_0789320_123_995 288
185 3300041509 Ga0451843_0224344 Ga0451843_0224344_1170_2042 288
186 3300041512 Ga0451853_0019065 Ga0451853_0019065_3997_4869 288
187 3300046529 Ga0495652_0249874 Ga0495652_0249874_302_1261 288
188 3300048912 Ga0496109_0181348 Ga0496109_0181348_522_1442 288
189 iso_pu_bacteria 2855670206 2855670907 288
190 iso_pu_bacteria 2855676851 2855681272 288
191 iso_pu_bacteria 2857288857 2857289525 288
192 iso_pu_bacteria 2858848962 2858851851 288
193 iso_pu_bacteria 2858882152 2858882647 288
194 iso_pu_bacteria 2858888857 2858894823 288
195 iso_pu_bacteria 2858895516 2858899813 288
196 iso_pu_bacteria 2869048445 2869054060 288
197 iso_pu_bacteria 2869061728 2869064917 288
198 iso_pu_bacteria 2869068681 2869074602 288
199 iso_pu_bacteria 2880489317 2880490746 288
200 iso_pu_bacteria 2880495981 2880501828 288
201 iso_pu_bacteria 2929219909 2929223888 288
202 iso_pu_bacteria 8003830390 8003831312 288
203 iso_pu_bacteria 8054704163 8054705731 288
204 iso_pu_bacteria 8054727385 8054733824 288
205 iso_pu_bacteria 8054734606 8054735411 288
206 iso_pu_bacteria 8055412473 8055414444 288
207 3300044683 Ga0466965_0172552 Ga0466965_0172552_251_1126 289
208 3300047319 Ga0495674_0369314 Ga0495674_0369314_142_1014 289
209 3300048910 Ga0496107_0120974 Ga0496107_0120974_998_1870 289
210 iso_pu_bacteria 2858868258 2858868747 289
211 iso_pu_bacteria 2902582711 2902584475 289
212 iso_pu_bacteria 2929226422 2929230323 289
213 3300005444 Ga0070694_100008500 Ga0070694_1000085003 290
214 3300005844 Ga0068862_100032026 Ga0068862_1000320264 290
215 3300009553 Ga0105249_10084249 Ga0105249_100842493 290
216 3300010375 Ga0105239_10483292 Ga0105239_104832922 290
217 3300026041 Ga0207639_10396788 Ga0207639_103967882 290
218 3300028380 Ga0268265_10183703 Ga0268265_101837032 290
219 3300028381 Ga0268264_10102238 Ga0268264_101022382 290
220 3300005435 Ga0070714_100000289 Ga0070714_10000028919 291
221 3300025929 Ga0207664_10000002 Ga0207664_1000000241 291
222 3300044901 Ga0466960_0084791 Ga0466960_0084791_76_981 292
223 3300048911 Ga0496108_0128391 Ga0496108_0128391_299_1228 292
224 iso_pu_bacteria 2622736626 2623589857 292
225 3300001979 JGI24740J21852_10021389 JGI24740J21852_100213892 294
226 3300001990 JGI24737J22298_10019434 JGI24737J22298_100194342 294
227 3300013307 Ga0157372_10197074 Ga0157372_101970742 294
228 3300025904 Ga0207647_10048556 Ga0207647_100485562 294
229 3300026078 Ga0207702_10098254 Ga0207702_100982542 294
230 3300026116 Ga0207674_10101400 Ga0207674_101014003 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

36

218

0.84

PF04321

RmlD_sub_bind

RmlD substrate binding domain

34

211

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

37

196

0.82

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

37

212

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jkh-assembly1.cif.gz_B the nad+-bound form of human nsdhl 0.8933 5 177
6jkg-assembly1.cif.gz_A the nad+-free form of human nsdhl 0.8737 2 175
6jkg-assembly1.cif.gz_B the nad+-free form of human nsdhl 0.8696 3 175
6jkh-assembly1.cif.gz_A the nad+-bound form of human nsdhl 0.8666 3 175
6mfh-assembly1.cif.gz_A mutated uronate dehydrogenase 0.8323 5 284
ID Description Score Start End Superfamily
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8877 7 281 3.40.50.720
3aw9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8811 6 231 3.40.50.720
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8798 7 281 3.40.50.720
2pk3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8738 6 279 3.40.50.720
3aw9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8679 6 231 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A316I4N4-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9938 75 285 GO:0006012
GO:0016853
AF-S7WTY1-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) 0.9905 54 285 GO:0003978
AF-A0A6V8L1M2-F1-model_v4 UDP-glucose 4-epimerase 0.9902 5 285
AF-A0A1H0E048-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9873 2 284 GO:0003677
GO:0006355
AF-A0A0U4X0C6-F1-model_v4 NAD-dependent epimerase/dehydratase 0.9867 75 268

Feature Viewer

pLDDT pTM Quality
93.5 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map