F343249

General Info

Members Datasets Scaffolds Average Seq Length
230 142 460 129

Family's Representative Sequence

Representative Sequence 3300041494|Ga0451837_1620667|Ga0451837_1620667_23_484
Length 153
Sequence MDGQVRTWCESAFFNIFDMATIFSRIIAGEIPSYKVAENEQFYAFLDINPLVKGHTLVVPKREVDYIFDLEDEEVAAMHVFAKGVALAIQKAFPCKKVGEAVIGLEVPHAHIHLIPIQNESDMLFSNPKLKLSGEEFVAIAKAINEAWETNKK

Samples

Sample ID Description Type Environment
1 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
41 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
42 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
48 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
49 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
50 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
51 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
57 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
58 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
59 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
60 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
61 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
62 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
63 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
64 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
65 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
73 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
74 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
75 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
76 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
77 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
80 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
81 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
82 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
88 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
89 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
90 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
91 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
92 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
93 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
94 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
95 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
100 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
101 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
102 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
103 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
104 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
105 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
106 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
107 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
108 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
109 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
110 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
111 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
112 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
113 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
114 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
115 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
116 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
117 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
118 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
119 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
120 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
121 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
122 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
123 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
124 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
125 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
126 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
127 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
128 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
129 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
130 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
131 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
132 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
133 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
134 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
135 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
136 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
137 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
138 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
139 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
140 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
141 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
142 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.17
Metatranscriptomes 1.3
Isolates 16.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.87
Bulb 0
Endosphere 1.74
Nodule 0.43
Rhizoplane 3.48
Rhizosphere 76.09
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451837_1620667 3300041494 Bacteria 595
2 SwRhRL2b_contig_1167130 2162886007 Bacteria 2556
3 SwRhRL2b_contig_3354572 2162886007 Bacteria 2862
4 SwRhRL2b_contig_532598 2162886007 Bacteria 1956
5 SwRhRL2b_contig_677025 2162886007 Bacteria 181955
6 JGI24741J21665_1003987 3300001915 Bacteria 3374
7 rootH1_10116302 3300003323 Bacteria 10511
8 Ga0006562J51391_1014574 3300003578 Bacteria 1230
9 Ga0055534_1004897 3300003784 Bacteria 3745
10 Ga0065704_10070133 3300005289 Bacteria 1266035
11 Ga0065704_10070931 3300005289 Bacteria 14475
12 Ga0065704_10077064 3300005289 Bacteria 4866
13 Ga0065704_10078617 3300005289 Bacteria 4380
14 Ga0070683_100001421 3300005329 Bacteria 18374
15 Ga0070682_100000064 3300005337 Bacteria 100988
16 Ga0070660_100763304 3300005339 Bacteria 812
17 Ga0070689_100799359 3300005340 Bacteria 829
18 Ga0070661_100290887 3300005344 Bacteria 1269
19 Ga0070688_100123958 3300005365 Bacteria 1734
20 Ga0070685_10283476 3300005466 Unclassified 1110
21 Ga0070684_100004754 3300005535 Bacteria 10381
22 Ga0068860_101811131 3300005843 Bacteria 632
23 Ga0105244_10000068 3300009036 Bacteria 121140
24 Ga0105250_10076097 3300009092 Bacteria 1358
25 Ga0105243_10000742 3300009148 Bacteria 31235
26 Ga0105243_10197014 3300009148 Bacteria 1764
27 Ga0105248_10000253 3300009177 Bacteria 62488
28 Ga0157373_10000540 3300013100 Bacteria 29579
29 Ga0157373_10416347 3300013100 Bacteria 964
30 Ga0157373_10663243 3300013100 Bacteria 762
31 Ga0157371_10162327 3300013102 Bacteria 1596
32 Ga0157370_10000389 3300013104 Bacteria 55069
33 Ga0157370_10009640 3300013104 Bacteria 10272
34 Ga0157370_10020859 3300013104 Bacteria 6539
35 Ga0157370_10181597 3300013104 Bacteria 1955
36 Ga0157369_10007602 3300013105 Bacteria 12468
37 Ga0157369_10078429 3300013105 Bacteria 3539
38 Ga0163162_11440243 3300013306 Bacteria 784
39 Ga0157375_10161106 3300013308 Bacteria 2385
40 Ga0157375_10557093 3300013308 Bacteria 1308
41 Ga0157375_10881933 3300013308 Bacteria 1040
42 Ga0157375_11158880 3300013308 Bacteria 906
43 Ga0182008_10000062 3300014497 Bacteria 90671
44 Ga0157376_12693185 3300014969 Unclassified 537
45 Ga0182006_1000001 3300015261 Bacteria 1091090
46 Ga0163161_10015565 3300017792 Bacteria 5304
47 Ga0163161_10136689 3300017792 Bacteria 1853
48 Ga0209675_1000146 3300025291 Bacteria 93829
49 Ga0207655_1000164 3300025728 Bacteria 121490
50 Ga0207657_10651366 3300025919 Bacteria 820
51 Ga0207657_10885583 3300025919 Bacteria 688
52 Ga0207709_10041410 3300025935 Bacteria 2763
53 Ga0207670_10248180 3300025936 Unclassified 1374
54 Ga0207711_10005240 3300025941 Bacteria 10990
55 Ga0207661_10002753 3300025944 Bacteria 12099
56 Ga0207702_10617711 3300026078 Bacteria 1064
57 Ga0268264_11751400 3300028381 Bacteria 632
58 Ga0265334_10058463 3300028573 Bacteria 1458
59 Ga0265322_10041005 3300028654 Bacteria 1318
60 Ga0265322_10126731 3300028654 Bacteria 728
61 Ga0265336_10009904 3300028666 Bacteria 3279
62 Ga0307515_10246162 3300028794 Bacteria 1549
63 Ga0265331_10099043 3300031250 Bacteria 1343
64 Ga0265327_10131563 3300031251 Bacteria 1177
65 Ga0265316_10005059 3300031344 Bacteria 12939
66 Ga0316579_10141154 3300031691 Bacteria 1161
67 Ga0265342_10443949 3300031712 Bacteria 666
68 Ga0316576_10019497 3300031727 Bacteria 4650
69 Ga0316576_10783941 3300031727 Bacteria 687
70 Ga0316578_10107326 3300031728 Bacteria 1676
71 Ga0316577_10000768 3300031733 Bacteria 13810
72 Ga0307412_10000036 3300031911 Bacteria 192270
73 Ga0307412_10004577 3300031911 Bacteria 7709
74 Ga0307412_10074538 3300031911 Bacteria 2325
75 Ga0307412_12219814 3300031911 Bacteria 511
76 Ga0307416_100000044 3300032002 Bacteria 127948
77 Ga0307414_10000043 3300032004 Bacteria 137764
78 Ga0307414_10337860 3300032004 Bacteria 1288
79 Ga0307414_10348872 3300032004 Bacteria 1269
80 Ga0307414_10494392 3300032004 Bacteria 1081
81 Ga0307411_11747649 3300032005 Bacteria 576
82 Ga0316574_0736914 3300035398 Bacteria 603
83 Ga0316574_0760794 3300035398 Bacteria 591
84 Ga0316582_0832489 3300036647 Unclassified 632
85 Ga0316584_0003091 3300036712 Bacteria 10734
86 Ga0316584_0058280 3300036712 Bacteria 2892
87 Ga0316584_0578643 3300036712 Unclassified 781
88 Ga0400487_32923 3300039110 Bacteria 1067
89 Ga0439466_0080645 3300041411 Bacteria 1026
90 Ga0439465_0000174 3300041413 Bacteria 16458
91 Ga0451787_418263 3300041441 Bacteria 556
92 Ga0451795_0130960 3300041456 Unclassified 2223
93 Ga0451795_1239575 3300041456 Bacteria 980
94 Ga0451795_1494607 3300041456 Bacteria 859
95 Ga0451795_1549683 3300041456 Unclassified 647
96 Ga0451837_0679356 3300041494 Unclassified 607
97 Ga0451837_1214640 3300041494 Bacteria 522
98 Ga0451852_20408 3300041508 Unclassified 501
99 Ga0451852_32298 3300041508 Bacteria 1364
100 Ga0451855_0449777 3300041511 Bacteria 1197
101 Ga0451855_0958919 3300041511 Bacteria 1264
102 Ga0451855_0977108 3300041511 Bacteria 717
103 Ga0451855_1385702 3300041511 Bacteria 710
104 Ga0451853_1936912 3300041512 Bacteria 675
105 Ga0439445_0000052 3300042004 Bacteria 16868
106 Ga0451577_0000044 3300042876 Bacteria 329357
107 Ga0451577_0000097 3300042876 Bacteria 193351
108 Ga0451577_0007653 3300042876 Bacteria 10594
109 Ga0451577_0122928 3300042876 Bacteria 2325
110 Ga0451577_0172633 3300042876 Bacteria 1948
111 Ga0451577_0313361 3300042876 Bacteria 1422
112 Ga0451577_1254393 3300042876 Bacteria 660
113 Ga0451577_1836038 3300042876 Bacteria 531
114 Ga0453683_0000022 3300044673 Bacteria 269593
115 Ga0453683_0000109 3300044673 Bacteria 123662
116 Ga0453683_0009817 3300044673 Bacteria 6377
117 Ga0453683_0056617 3300044673 Bacteria 2454
118 Ga0453683_0093999 3300044673 Bacteria 1880
119 Ga0453683_0196933 3300044673 Bacteria 1279
120 Ga0453683_0269465 3300044673 Bacteria 1086
121 Ga0453683_0933225 3300044673 Unclassified 574
122 Ga0453684_0000283 3300044712 Bacteria 219542
123 Ga0453684_0000525 3300044712 Bacteria 146588
124 Ga0453684_0001815 3300044712 Bacteria 56298
125 Ga0453684_0014538 3300044712 Bacteria 12569
126 Ga0453684_0035128 3300044712 Bacteria 6935
127 Ga0453684_0040682 3300044712 Bacteria 6307
128 Ga0453684_0045913 3300044712 Bacteria 5820
129 Ga0453684_0124764 3300044712 Bacteria 3101
130 Ga0453684_0220267 3300044712 Unclassified 2199
131 Ga0453684_0331834 3300044712 Bacteria 1720
132 Ga0453684_0458716 3300044712 Bacteria 1417
133 Ga0453684_0514693 3300044712 Bacteria 1323
134 Ga0453684_0781131 3300044712 Bacteria 1031
135 Ga0453684_0943994 3300044712 Bacteria 921
136 Ga0453684_1148212 3300044712 Unclassified 818
137 Ga0453684_1175001 3300044712 Bacteria 807
138 Ga0453684_1391646 3300044712 Viruses 728
139 Ga0453684_1706333 3300044712 Bacteria 643
140 Ga0451576_0000047 3300045051 Bacteria 329357
141 Ga0451576_0001695 3300045051 Bacteria 36451
142 Ga0451576_0009859 3300045051 Bacteria 11036
143 Ga0451576_0010712 3300045051 Bacteria 10498
144 Ga0451576_0046362 3300045051 Bacteria 4577
145 Ga0451576_0150351 3300045051 Unclassified 2428
146 Ga0495627_000081 3300046453 Bacteria 116262
147 Ga0495627_011017 3300046453 Bacteria 3258
148 Ga0495590_0008826 3300046457 Bacteria 3832
149 Ga0495638_0211223 3300046460 Bacteria 1090
150 Ga0495638_0319065 3300046460 Bacteria 831
151 Ga0495596_0000460 3300046500 Bacteria 25870
152 Ga0495606_0011197 3300046507 Bacteria 7343
153 Ga0495606_0022259 3300046507 Bacteria 4622
154 Ga0495632_0011361 3300046519 Bacteria 5199
155 Ga0495643_0007304 3300046522 Bacteria 7140
156 Ga0495643_0159428 3300046522 Bacteria 1111
157 Ga0495663_0000043 3300046525 Bacteria 63128
158 Ga0495654_0000003 3300046530 Bacteria 863485
159 Ga0495609_0000103 3300046538 Bacteria 100012
160 Ga0495633_0000114 3300046558 Bacteria 108708
161 Ga0495633_0001074 3300046558 Bacteria 22098
162 Ga0495625_0000120 3300046660 Bacteria 121527
163 Ga0495686_0000596 3300047472 Bacteria 50380
164 Ga0495686_0003285 3300047472 Bacteria 14137
165 Ga0496102_0219008 3300048905 Bacteria 1794
166 Ga0496105_1035709 3300048908 Bacteria 612
167 Ga0496113_0055135 3300048916 Bacteria 2979
168 Ga0496116_0000191 3300048919 Bacteria 122348
169 Ga0496117_0000188 3300048920 Bacteria 126828
170 Ga0496118_0001243 3300048921 Bacteria 39137
171 Ga0496119_0000098 3300048922 Bacteria 126786
172 Ga0496120_0172125 3300048923 Bacteria 1070
173 Ga0496121_0206352 3300048924 Bacteria 1396
174 Ga0496122_0000307 3300048925 Bacteria 108043
175 Ga0496122_0001271 3300048925 Bacteria 42139
176 Ga0496122_0001648 3300048925 Bacteria 34655
177 Ga0496122_0020218 3300048925 Bacteria 6030
178 Ga0496122_0020256 3300048925 Bacteria 6022
179 Ga0496123_0002361 3300048926 Bacteria 23661
180 Ga0496123_0085067 3300048926 Bacteria 1904
181 Ga0496123_0380269 3300048926 Bacteria 648
182 Ga0496124_0001097 3300048927 Bacteria 42578
183 Ga0496125_0027448 3300048928 Bacteria 5159
184 Ga0496125_0082922 3300048928 Bacteria 2441
185 Ga0496125_0092546 3300048928 Bacteria 2260
186 Ga0496126_0001794 3300048929 Bacteria 31570
187 Ga0501223_000313 3300049663 Bacteria 12047
188 Ga0501251_055185 3300049681 Bacteria 640
189 Ga0501241_000025 3300049758 Bacteria 60000
190 Ga0501269_000013 3300049766 Bacteria 60610
191 Ga0500578_0054906 3300053086 Bacteria 2550
192 Ga0500622_0005026 3300053156 Bacteria 8059
193 2511234931 2511231000 Bacteria 4488346
194 2585144268 2582581278 Bacteria 5296881
195 2585157945 2582581281 Bacteria 4487904
196 2585162245 2582581282 Bacteria 4495830
197 2585425681 2582581873 Bacteria 3032664
198 2587680500 2585428045 Bacteria 5203023
199 2587748801 2585428060 Bacteria 5304711
200 2587753395 2585428061 Bacteria 3939663
201 2587868322 2585428095 Bacteria 3789702
202 2587945476 2585428115 Bacteria 4420269
203 2588212178 2585428182 Bacteria 5007281
204 2588216992 2585428183 Bacteria 5166119
205 2588217180 2585428184 Bacteria 4978681
206 2588222031 2585428185 Bacteria 4969476
207 2588234778 2585428187 Bacteria 4629388
208 2588447738 2588253712 Bacteria 5403181
209 2590604582 2588254255 Bacteria 5014294
210 2590610380 2588254257 Bacteria 5436094
211 2729200589 2728369107 Bacteria 5082720
212 2740060597 2739367874 Bacteria 4872888
213 2753671429 2751185877 Bacteria 4921427
214 2765575873 2765235839 Bacteria 5314748
215 2772604305 2772190705 Bacteria 4666226
216 2775674177 2775506739 Bacteria 3855222
217 2816876397 2816332188 Bacteria 5133218
218 2842086421 2842083920 Bacteria 4857652
219 2871721880 2871720351 Bacteria 4862476
220 2889293639 2889290771 Bacteria 5530962
221 2906001021 2905999023 Bacteria 4591259
222 2919100491 2919097161 Bacteria 3860339
223 2919403601 2919399522 Bacteria 5164947
224 2945924642 2945924605 Bacteria 4296724
225 2946024244 2946019816 Bacteria 4621265
226 2977247593 2977243572 Bacteria 4374394
227 2984574609 2984572630 Bacteria 4186940
228 2984608061 2984606641 Bacteria 4186971
229 2993374933 2993372514 Bacteria 4214139
230 2993481788 2993480792 Bacteria 4022225
231 Ga0451837_1620667
232 SwRhRL2b_contig_1167130
233 SwRhRL2b_contig_3354572
234 SwRhRL2b_contig_532598
235 SwRhRL2b_contig_677025
236 JGI24741J21665_1003987
237 rootH1_10116302
238 Ga0006562J51391_1014574
239 Ga0055534_1004897
240 Ga0065704_10070133
241 Ga0065704_10070931
242 Ga0065704_10077064
243 Ga0065704_10078617
244 Ga0070683_100001421
245 Ga0070682_100000064
246 Ga0070660_100763304
247 Ga0070689_100799359
248 Ga0070661_100290887
249 Ga0070688_100123958
250 Ga0070685_10283476
251 Ga0070684_100004754
252 Ga0068860_101811131
253 Ga0105244_10000068
254 Ga0105250_10076097
255 Ga0105243_10000742
256 Ga0105243_10197014
257 Ga0105248_10000253
258 Ga0157373_10000540
259 Ga0157373_10416347
260 Ga0157373_10663243
261 Ga0157371_10162327
262 Ga0157370_10000389
263 Ga0157370_10009640
264 Ga0157370_10020859
265 Ga0157370_10181597
266 Ga0157369_10007602
267 Ga0157369_10078429
268 Ga0163162_11440243
269 Ga0157375_10161106
270 Ga0157375_10557093
271 Ga0157375_10881933
272 Ga0157375_11158880
273 Ga0182008_10000062
274 Ga0157376_12693185
275 Ga0182006_1000001
276 Ga0163161_10015565
277 Ga0163161_10136689
278 Ga0209675_1000146
279 Ga0207655_1000164
280 Ga0207657_10651366
281 Ga0207657_10885583
282 Ga0207709_10041410
283 Ga0207670_10248180
284 Ga0207711_10005240
285 Ga0207661_10002753
286 Ga0207702_10617711
287 Ga0268264_11751400
288 Ga0265334_10058463
289 Ga0265322_10041005
290 Ga0265322_10126731
291 Ga0265336_10009904
292 Ga0307515_10246162
293 Ga0265331_10099043
294 Ga0265327_10131563
295 Ga0265316_10005059
296 Ga0316579_10141154
297 Ga0265342_10443949
298 Ga0316576_10019497
299 Ga0316576_10783941
300 Ga0316578_10107326
301 Ga0316577_10000768
302 Ga0307412_10000036
303 Ga0307412_10004577
304 Ga0307412_10074538
305 Ga0307412_12219814
306 Ga0307416_100000044
307 Ga0307414_10000043
308 Ga0307414_10337860
309 Ga0307414_10348872
310 Ga0307414_10494392
311 Ga0307411_11747649
312 Ga0316574_0736914
313 Ga0316574_0760794
314 Ga0316582_0832489
315 Ga0316584_0003091
316 Ga0316584_0058280
317 Ga0316584_0578643
318 Ga0400487_32923
319 Ga0439466_0080645
320 Ga0439465_0000174
321 Ga0451787_418263
322 Ga0451795_0130960
323 Ga0451795_1239575
324 Ga0451795_1494607
325 Ga0451795_1549683
326 Ga0451837_0679356
327 Ga0451837_1214640
328 Ga0451852_20408
329 Ga0451852_32298
330 Ga0451855_0449777
331 Ga0451855_0958919
332 Ga0451855_0977108
333 Ga0451855_1385702
334 Ga0451853_1936912
335 Ga0439445_0000052
336 Ga0451577_0000044
337 Ga0451577_0000097
338 Ga0451577_0007653
339 Ga0451577_0122928
340 Ga0451577_0172633
341 Ga0451577_0313361
342 Ga0451577_1254393
343 Ga0451577_1836038
344 Ga0453683_0000022
345 Ga0453683_0000109
346 Ga0453683_0009817
347 Ga0453683_0056617
348 Ga0453683_0093999
349 Ga0453683_0196933
350 Ga0453683_0269465
351 Ga0453683_0933225
352 Ga0453684_0000283
353 Ga0453684_0000525
354 Ga0453684_0001815
355 Ga0453684_0014538
356 Ga0453684_0035128
357 Ga0453684_0040682
358 Ga0453684_0045913
359 Ga0453684_0124764
360 Ga0453684_0220267
361 Ga0453684_0331834
362 Ga0453684_0458716
363 Ga0453684_0514693
364 Ga0453684_0781131
365 Ga0453684_0943994
366 Ga0453684_1148212
367 Ga0453684_1175001
368 Ga0453684_1391646
369 Ga0453684_1706333
370 Ga0451576_0000047
371 Ga0451576_0001695
372 Ga0451576_0009859
373 Ga0451576_0010712
374 Ga0451576_0046362
375 Ga0451576_0150351
376 Ga0495627_000081
377 Ga0495627_011017
378 Ga0495590_0008826
379 Ga0495638_0211223
380 Ga0495638_0319065
381 Ga0495596_0000460
382 Ga0495606_0011197
383 Ga0495606_0022259
384 Ga0495632_0011361
385 Ga0495643_0007304
386 Ga0495643_0159428
387 Ga0495663_0000043
388 Ga0495654_0000003
389 Ga0495609_0000103
390 Ga0495633_0000114
391 Ga0495633_0001074
392 Ga0495625_0000120
393 Ga0495686_0000596
394 Ga0495686_0003285
395 Ga0496102_0219008
396 Ga0496105_1035709
397 Ga0496113_0055135
398 Ga0496116_0000191
399 Ga0496117_0000188
400 Ga0496118_0001243
401 Ga0496119_0000098
402 Ga0496120_0172125
403 Ga0496121_0206352
404 Ga0496122_0000307
405 Ga0496122_0001271
406 Ga0496122_0001648
407 Ga0496122_0020218
408 Ga0496122_0020256
409 Ga0496123_0002361
410 Ga0496123_0085067
411 Ga0496123_0380269
412 Ga0496124_0001097
413 Ga0496125_0027448
414 Ga0496125_0082922
415 Ga0496125_0092546
416 Ga0496126_0001794
417 Ga0501223_000313
418 Ga0501251_055185
419 Ga0501241_000025
420 Ga0501269_000013
421 Ga0500578_0054906
422 Ga0500622_0005026
423 2511234931
424 2585144268
425 2585157945
426 2585162245
427 2585425681
428 2587680500
429 2587748801
430 2587753395
431 2587868322
432 2587945476
433 2588212178
434 2588216992
435 2588217180
436 2588222031
437 2588234778
438 2588447738
439 2590604582
440 2590610380
441 2729200589
442 2740060597
443 2753671429
444 2765575873
445 2772604305
446 2775674177
447 2816876397
448 2842086421
449 2871721880
450 2889293639
451 2906001021
452 2919100491
453 2919403601
454 2945924642
455 2946024244
456 2977247593
457 2984574609
458 2984608061
459 2993374933
460 2993481788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

28

120

0.91

PF04677

CwfJ_C_1

Protein similar to CwfJ C-terminus 1

34

129

0.91

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

20

129

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p0t-assembly1.cif.gz_B crystal structure of an hit-like protein from mycobacterium paratuberculosis 0.9251 1 128
7mqw-assembly1.cif.gz_B histidine triad protein 0.9133 1 128
3p0t-assembly1.cif.gz_B crystal structure of an hit-like protein from mycobacterium paratuberculosis 0.9115 1 128
7mqw-assembly1.cif.gz_B histidine triad protein 0.9 1 128
4zgl-assembly2.cif.gz_D hit like protein 0.8974 3 97
ID Description Score Start End Superfamily
af_P9WML3_1_133_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9574 3 128 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.941 16 98 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9297 1 104 3.30.428.10
af_P9WML3_1_133_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9289 3 128 3.30.428.10
af_F4K1R2_26_184_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9265 3 129 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A5C1I6Y5-F1-model_v4 HIT family protein 0.9966 3 128 GO:0003824
GO:0009117
AF-A0A358M0E2-F1-model_v4 deleted 0.9965 1 127
AF-A0A497YNP7-F1-model_v4 deleted 0.9962 1 128
AF-A0A5C6RZI0-F1-model_v4 HIT family protein 0.9948 2 129 GO:0003824
GO:0009117
AF-A0A642C457-F1-model_v4 HIT family protein 0.9948 16 128 GO:0003824
GO:0009117

Map