F343230

General Info

Members Datasets Scaffolds Average Seq Length
230 156 222 208

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0675126|Ga0395901_0675126_298_1017
Length 239
Sequence MTLAVIPALRFAAAGMKDNLASKRGATSMKLYDTPLAPNPRRVRWFMAEKGIDDIEIVTLNLIQGEHRQPAYLAKTGVANVPALEMDDGTTITESVAICRYLESRYPEPNLFGRTPEEIAVIEMWMRRGEMLVSNPLMMMVRHTHPALAALEVQVPEIAEKNRESGIRGLKLLDRRLAESEWLAGPRLTIADIVAFSGVDFGRMIKFQAPEELANVGRWIAAMRARPAAAAGMPQALPA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
3 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
4 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
5 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
6 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
7 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
8 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
116 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
146 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
147 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
148 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
149 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
150 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
151 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
152 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
156 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.52
Metatranscriptomes 0
Isolates 3.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.78
Nodule 0
Rhizoplane 4.35
Rhizosphere 72.17
Stem 0
Stem Tuber 0
Unclassified 8.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1046881 3300003771 Bacteria 1020
2 Ga0055528_1010203 3300003790 Bacteria 3844
3 Ga0055530_10000579 3300003791 Bacteria 31675
4 Ga0055531_10001275 3300003794 Bacteria 18993
5 Ga0055543_1020075 3300004625 Bacteria 1231
6 Ga0065165_1000459 3300005262 Bacteria 63870
7 Ga0065165_1001159 3300005262 Bacteria 30735
8 Ga0070658_10670951 3300005327 Bacteria 899
9 Ga0070683_100872664 3300005329 Bacteria 863
10 Ga0070670_100015393 3300005331 Bacteria 6569
11 Ga0070666_10220014 3300005335 Bacteria 1339
12 Ga0070680_100047602 3300005336 Bacteria 3491
13 Ga0070660_100033339 3300005339 Bacteria 3882
14 Ga0070661_100244228 3300005344 Bacteria 1383
15 Ga0070668_100001380 3300005347 Bacteria 17432
16 Ga0070668_100011823 3300005347 Bacteria 6501
17 Ga0070659_100000056 3300005366 Bacteria 88478
18 Ga0070667_100144326 3300005367 Bacteria 2087
19 Ga0070667_100644685 3300005367 Bacteria 978
20 Ga0070662_100184189 3300005457 Bacteria 1648
21 Ga0070681_10075654 3300005458 Bacteria 3327
22 Ga0070681_10140448 3300005458 Bacteria 2346
23 Ga0070706_100118054 3300005467 Bacteria 2471
24 Ga0068853_100338075 3300005539 Bacteria 1398
25 Ga0070665_100000015 3300005548 Bacteria 462744
26 Ga0070665_100042006 3300005548 Bacteria 4596
27 Ga0068855_100084671 3300005563 Bacteria 3670
28 Ga0068855_100175348 3300005563 Bacteria 2426
29 Ga0068855_100367626 3300005563 Bacteria 1582
30 Ga0070664_100276406 3300005564 Bacteria 1514
31 Ga0068854_100344376 3300005578 Bacteria 1218
32 Ga0068859_100047982 3300005617 Bacteria 4291
33 Ga0068859_100234881 3300005617 Bacteria 1922
34 Ga0068864_100022755 3300005618 Bacteria 5256
35 Ga0068864_100075884 3300005618 Bacteria 2936
36 Ga0068864_100080074 3300005618 Bacteria 2861
37 Ga0068864_100300339 3300005618 Bacteria 1503
38 Ga0068861_100059991 3300005719 Bacteria 2914
39 Ga0068861_100323332 3300005719 Bacteria 1344
40 Ga0068863_100099361 3300005841 Bacteria 2765
41 Ga0068863_100207227 3300005841 Bacteria 1887
42 Ga0068858_100205825 3300005842 Bacteria 1862
43 Ga0068860_100000158 3300005843 Bacteria 110478
44 Ga0068860_100026569 3300005843 Bacteria 5579
45 Ga0068862_100012464 3300005844 Bacteria 7036
46 Ga0068862_100012471 3300005844 Bacteria 7034
47 Ga0068862_101155822 3300005844 Bacteria 771
48 Ga0070717_10169754 3300006028 Bacteria 1897
49 Ga0097620_100047982 3300006931 Bacteria 4291
50 Ga0097620_100234900 3300006931 Bacteria 1922
51 Ga0105240_10003983 3300009093 Bacteria 22787
52 Ga0105240_10077851 3300009093 Bacteria 4085
53 Ga0105241_10683388 3300009174 Bacteria 935
54 Ga0105248_10001174 3300009177 Bacteria 29276
55 Ga0105249_10117362 3300009553 Bacteria 2524
56 Ga0105249_10724545 3300009553 Bacteria 1056
57 Ga0105239_10348675 3300010375 Bacteria 1671
58 Ga0157373_10000182 3300013100 Bacteria 51778
59 Ga0157373_10000230 3300013100 Bacteria 45844
60 Ga0157370_10401570 3300013104 Bacteria 1261
61 Ga0163162_10380354 3300013306 Bacteria 1545
62 Ga0163162_10515720 3300013306 Bacteria 1325
63 Ga0157372_10192284 3300013307 Bacteria 2364
64 Ga0157375_10708595 3300013308 Bacteria 1160
65 Ga0163163_10059781 3300014325 Bacteria 3771
66 Ga0163163_10470750 3300014325 Bacteria 1317
67 Ga0157380_10735033 3300014326 Bacteria 996
68 Ga0209026_1001123 3300025250 Bacteria 12660
69 Ga0209565_1000491 3300025263 Bacteria 28967
70 Ga0209673_1002030 3300025273 Bacteria 15409
71 Ga0209675_1042190 3300025291 Bacteria 990
72 Ga0209564_1000892 3300025295 Bacteria 39200
73 Ga0209564_1015356 3300025295 Bacteria 3121
74 Ga0209564_1026671 3300025295 Bacteria 1900
75 Ga0209758_1000924 3300025297 Bacteria 39688
76 Ga0209758_1001122 3300025297 Bacteria 34484
77 Ga0209758_1001524 3300025297 Bacteria 26819
78 Ga0209050_1000049 3300025298 Bacteria 364096
79 Ga0209256_1005632 3300025299 Bacteria 7082
80 Ga0209257_1000692 3300025304 Bacteria 52346
81 Ga0209257_1031795 3300025304 Bacteria 1683
82 Ga0207680_10239855 3300025903 Bacteria 1249
83 Ga0207705_10023787 3300025909 Bacteria 4371
84 Ga0207705_10197642 3300025909 Bacteria 1523
85 Ga0207707_10012874 3300025912 Bacteria 7280
86 Ga0207695_10005069 3300025913 Bacteria 17658
87 Ga0207695_10022035 3300025913 Bacteria 7249
88 Ga0207695_10144744 3300025913 Bacteria 2322
89 Ga0207660_10016262 3300025917 Bacteria 4923
90 Ga0207660_10174530 3300025917 Bacteria 1666
91 Ga0207657_10010016 3300025919 Bacteria 9481
92 Ga0207657_10270919 3300025919 Bacteria 1350
93 Ga0207652_10010693 3300025921 Bacteria 7390
94 Ga0207694_10027881 3300025924 Bacteria 4303
95 Ga0207694_10071976 3300025924 Bacteria 2702
96 Ga0207644_10201422 3300025931 Bacteria 1570
97 Ga0207690_10000104 3300025932 Bacteria 68527
98 Ga0207690_10026386 3300025932 Bacteria 3658
99 Ga0207704_10000427 3300025938 Bacteria 18877
100 Ga0207711_10000552 3300025941 Bacteria 38214
101 Ga0207711_10001339 3300025941 Bacteria 23287
102 Ga0207711_10091375 3300025941 Bacteria 2677
103 Ga0207679_10325456 3300025945 Bacteria 1332
104 Ga0207667_10017653 3300025949 Bacteria 8027
105 Ga0207667_10059464 3300025949 Bacteria 4002
106 Ga0207667_10261426 3300025949 Bacteria 1770
107 Ga0207640_10241767 3300025981 Bacteria 1395
108 Ga0207658_10956709 3300025986 Bacteria 781
109 Ga0207703_10496021 3300026035 Bacteria 1146
110 Ga0207639_10215690 3300026041 Bacteria 1655
111 Ga0207639_10227300 3300026041 Bacteria 1615
112 Ga0207641_10148403 3300026088 Bacteria 2122
113 Ga0207676_10046944 3300026095 Bacteria 3345
114 Ga0207676_10064369 3300026095 Bacteria 2916
115 Ga0207676_10455727 3300026095 Bacteria 1206
116 Ga0207674_10225065 3300026116 Bacteria 1824
117 Ga0207675_100518684 3300026118 Bacteria 1188
118 Ga0207698_10017831 3300026142 Bacteria 4825
119 Ga0207698_11421246 3300026142 Bacteria 709
120 Ga0268266_10000005 3300028379 Bacteria 1448194
121 Ga0268266_10181634 3300028379 Bacteria 1916
122 Ga0268265_10025124 3300028380 Bacteria 4223
123 Ga0268265_10994670 3300028380 Bacteria 828
124 Ga0268264_10000029 3300028381 Bacteria 419246
125 Ga0307517_10004846 3300028786 Bacteria 20520
126 Ga0265338_10018985 3300028800 Bacteria 7325
127 Ga0265338_10395051 3300028800 Bacteria 987
128 Ga0307513_10010039 3300031456 Bacteria 11933
129 Ga0307513_10016728 3300031456 Bacteria 8826
130 Ga0307516_10000780 3300031730 Bacteria 43450
131 Ga0307413_10348653 3300031824 Bacteria 1141
132 Ga0307406_10559303 3300031901 Bacteria 937
133 Ga0307412_10922866 3300031911 Bacteria 767
134 Ga0373944_0003467 3300035089 Bacteria 4075
135 Ga0373927_0001105 3300035695 Bacteria 20513
136 Ga0373947_0110695 3300035725 Bacteria 1735
137 Ga0373925_0000067 3300037068 Bacteria 110348
138 Ga0395899_0002368 3300037312 Bacteria 15354
139 Ga0395899_0071522 3300037312 Bacteria 2538
140 Ga0395899_0084700 3300037312 Bacteria 2304
141 Ga0395900_0000006 3300037418 Bacteria 495364
142 Ga0395900_0026993 3300037418 Bacteria 5878
143 Ga0395900_0174393 3300037418 Bacteria 2187
144 Ga0395898_0016373 3300037466 Bacteria 7587
145 Ga0395898_0081102 3300037466 Bacteria 3128
146 Ga0395898_0155901 3300037466 Bacteria 2184
147 Ga0395898_0270086 3300037466 Bacteria 1622
148 Ga0395905_0003274 3300037471 Bacteria 17404
149 Ga0395905_0049782 3300037471 Bacteria 3927
150 Ga0436364_0346688 3300037853 Bacteria 1454
151 Ga0395901_0000001 3300038443 Bacteria 800383
152 Ga0395901_0016778 3300038443 Bacteria 7462
153 Ga0395901_0675126 3300038443 Bacteria 1033
154 Ga0436361_0021211 3300039447 Bacteria 1172
155 Ga0436361_0025578 3300039447 Bacteria 915
156 Ga0436363_1518347 3300039450 Bacteria 1317
157 Ga0466957_0425865 3300044842 Bacteria 911
158 Ga0495627_007359 3300046453 Bacteria 4226
159 Ga0495638_0002300 3300046460 Bacteria 15755
160 Ga0495638_0003364 3300046460 Bacteria 12614
161 Ga0495650_0145031 3300046471 Bacteria 856
162 Ga0495583_0014157 3300046506 Bacteria 4414
163 Ga0495610_0001532 3300046512 Bacteria 20368
164 Ga0495610_0011046 3300046512 Bacteria 5551
165 Ga0495632_0000761 3300046519 Bacteria 28951
166 Ga0495637_0007257 3300046520 Bacteria 5512
167 Ga0495637_0034815 3300046520 Bacteria 2203
168 Ga0495648_0000148 3300046524 Bacteria 84304
169 Ga0495648_0069781 3300046524 Bacteria 2044
170 Ga0495642_0063477 3300046528 Bacteria 1535
171 Ga0495668_0088824 3300046616 Bacteria 1694
172 Ga0495668_0091955 3300046616 Bacteria 1662
173 Ga0495611_0137580 3300046648 Bacteria 1140
174 Ga0495625_0001966 3300046660 Bacteria 23202
175 Ga0495625_0013180 3300046660 Bacteria 6658
176 Ga0495625_0092427 3300046660 Bacteria 2090
177 Ga0495625_0120806 3300046660 Bacteria 1783
178 Ga0495661_0232115 3300046665 Bacteria 951
179 Ga0495669_0121140 3300046684 Bacteria 1226
180 Ga0495669_0195347 3300046684 Bacteria 966
181 Ga0495671_0079931 3300046692 Bacteria 1602
182 Ga0495681_0197613 3300047470 Bacteria 817
183 Ga0495686_0009629 3300047472 Bacteria 6939
184 Ga0495686_0040729 3300047472 Bacteria 2961
185 Ga0495686_0266221 3300047472 Bacteria 957
186 Ga0496102_0112084 3300048905 Bacteria 2544
187 Ga0496102_0156248 3300048905 Bacteria 2144
188 Ga0496106_0121227 3300048909 Bacteria 2044
189 Ga0496107_0000929 3300048910 Bacteria 17287
190 Ga0496108_0055602 3300048911 Bacteria 3324
191 Ga0496109_0063981 3300048912 Bacteria 3365
192 Ga0496110_0052279 3300048913 Bacteria 3591
193 Ga0496112_0134897 3300048915 Bacteria 2439
194 Ga0496115_0006124 3300048918 Bacteria 8794
195 Ga0496115_0023993 3300048918 Bacteria 4737
196 Ga0496116_0077362 3300048919 Bacteria 2079
197 Ga0496117_0014515 3300048920 Bacteria 6780
198 Ga0496118_0019894 3300048921 Bacteria 5978
199 Ga0496119_0038313 3300048922 Bacteria 3100
200 Ga0496121_0000130 3300048924 Bacteria 168094
201 Ga0496121_0004688 3300048924 Bacteria 18127
202 Ga0496125_0145723 3300048928 Bacteria 1637
203 Ga0501033_0156589 3300049570 Bacteria 1641
204 Ga0501036_0429051 3300049572 Bacteria 1102
205 Ga0501047_0003160 3300049581 Bacteria 15617
206 Ga0501047_0030482 3300049581 Bacteria 5200
207 Ga0501044_0009826 3300049823 Bacteria 10403
208 Ga0501044_0376860 3300049823 Bacteria 1334
209 nmdc:mga0k408_88170_c1 3300050493 Bacteria 1822
210 Ga0500578_0000284 3300053086 Bacteria 62622
211 Ga0500643_026724 3300053087 Bacteria 1803
212 Ga0500554_002315 3300053102 Bacteria 3731
213 Ga0500555_001304 3300053103 Bacteria 7901
214 Ga0500556_0000706 3300053104 Bacteria 20354
215 Ga0500562_001544 3300053108 Bacteria 5701
216 Ga0500595_052122 3300053119 Bacteria 1264
217 Ga0500618_000063 3300053125 Bacteria 93515
218 Ga0500658_0002670 3300053134 Bacteria 6850
219 Ga0500559_0002789 3300053136 Bacteria 8842
220 Ga0500622_0133609 3300053156 Bacteria 1190
221 Ga0500645_014101 3300053730 Bacteria 2552
222 Ga0500645_019311 3300053730 Bacteria 2120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0014157 Ga0495583_0014157_1642_2274 194
2 iso_pu_bacteria 2510917020 2511120649 201
3 iso_pu_bacteria 2643221552 2643782771 201
4 iso_pu_bacteria 2643221598 2643999890 201
5 iso_pu_bacteria 2643221614 2644088320 201
6 iso_pu_bacteria 2643221661 2644343556 201
7 iso_pu_bacteria 2643221666 2644368966 201
8 iso_pu_bacteria 2857504554 2857509267 201
9 iso_pu_bacteria 2898329390 2898330917 201
10 3300031730 Ga0307516_10000780 Ga0307516_100007809 203
11 3300035089 Ga0373944_0003467 Ga0373944_0003467_2957_3568 203
12 3300035695 Ga0373927_0001105 Ga0373927_0001105_14055_14666 203
13 3300037068 Ga0373925_0000067 Ga0373925_0000067_99783_100394 203
14 3300050493 nmdc:mga0k408_88170_c1 nmdc:mga0k408_88170_c1_1028_1639 203
15 3300049581 Ga0501047_0030482 Ga0501047_0030482_3059_3673 204
16 3300049823 Ga0501044_0376860 Ga0501044_0376860_342_956 204
17 3300003771 Ga0055526_1046881 Ga0055526_10468812 205
18 3300003790 Ga0055528_1010203 Ga0055528_10102036 205
19 3300003791 Ga0055530_10000579 Ga0055530_1000057915 205
20 3300003794 Ga0055531_10001275 Ga0055531_1000127511 205
21 3300004625 Ga0055543_1020075 Ga0055543_10200752 205
22 3300005262 Ga0065165_1000459 Ga0065165_100045914 205
23 3300005262 Ga0065165_1001159 Ga0065165_10011592 205
24 3300005327 Ga0070658_10670951 Ga0070658_106709511 205
25 3300005329 Ga0070683_100872664 Ga0070683_1008726641 205
26 3300005331 Ga0070670_100015393 Ga0070670_1000153935 205
27 3300005335 Ga0070666_10220014 Ga0070666_102200141 205
28 3300005336 Ga0070680_100047602 Ga0070680_1000476023 205
29 3300005339 Ga0070660_100033339 Ga0070660_1000333392 205
30 3300005344 Ga0070661_100244228 Ga0070661_1002442282 205
31 3300005347 Ga0070668_100001380 Ga0070668_1000013808 205
32 3300005347 Ga0070668_100011823 Ga0070668_1000118236 205
33 3300005366 Ga0070659_100000056 Ga0070659_1000000569 205
34 3300005367 Ga0070667_100144326 Ga0070667_1001443264 205
35 3300005367 Ga0070667_100644685 Ga0070667_1006446852 205
36 3300005457 Ga0070662_100184189 Ga0070662_1001841892 205
37 3300005458 Ga0070681_10075654 Ga0070681_100756543 205
38 3300005458 Ga0070681_10140448 Ga0070681_101404482 205
39 3300005467 Ga0070706_100118054 Ga0070706_1001180542 205
40 3300005539 Ga0068853_100338075 Ga0068853_1003380752 205
41 3300005548 Ga0070665_100000015 Ga0070665_100000015315 205
42 3300005548 Ga0070665_100042006 Ga0070665_1000420062 205
43 3300005563 Ga0068855_100084671 Ga0068855_1000846712 205
44 3300005563 Ga0068855_100175348 Ga0068855_1001753482 205
45 3300005563 Ga0068855_100367626 Ga0068855_1003676262 205
46 3300005564 Ga0070664_100276406 Ga0070664_1002764062 205
47 3300005578 Ga0068854_100344376 Ga0068854_1003443762 205
48 3300005617 Ga0068859_100047982 Ga0068859_1000479823 205
49 3300005617 Ga0068859_100234881 Ga0068859_1002348812 205
50 3300005618 Ga0068864_100022755 Ga0068864_1000227552 205
51 3300005618 Ga0068864_100075884 Ga0068864_1000758842 205
52 3300005618 Ga0068864_100080074 Ga0068864_1000800742 205
53 3300005618 Ga0068864_100300339 Ga0068864_1003003392 205
54 3300005719 Ga0068861_100059991 Ga0068861_1000599912 205
55 3300005719 Ga0068861_100323332 Ga0068861_1003233322 205
56 3300005841 Ga0068863_100099361 Ga0068863_1000993611 205
57 3300005841 Ga0068863_100207227 Ga0068863_1002072272 205
58 3300005842 Ga0068858_100205825 Ga0068858_1002058251 205
59 3300005843 Ga0068860_100000158 Ga0068860_10000015880 205
60 3300005843 Ga0068860_100026569 Ga0068860_1000265695 205
61 3300005844 Ga0068862_100012464 Ga0068862_1000124647 205
62 3300005844 Ga0068862_100012471 Ga0068862_1000124716 205
63 3300005844 Ga0068862_101155822 Ga0068862_1011558222 205
64 3300006028 Ga0070717_10169754 Ga0070717_101697542 205
65 3300006931 Ga0097620_100047982 Ga0097620_1000479824 205
66 3300006931 Ga0097620_100234900 Ga0097620_1002349002 205
67 3300009093 Ga0105240_10003983 Ga0105240_1000398322 205
68 3300009093 Ga0105240_10077851 Ga0105240_100778515 205
69 3300009174 Ga0105241_10683388 Ga0105241_106833882 205
70 3300009177 Ga0105248_10001174 Ga0105248_1000117423 205
71 3300009553 Ga0105249_10117362 Ga0105249_101173624 205
72 3300009553 Ga0105249_10724545 Ga0105249_107245452 205
73 3300010375 Ga0105239_10348675 Ga0105239_103486751 205
74 3300013100 Ga0157373_10000182 Ga0157373_100001823 205
75 3300013100 Ga0157373_10000230 Ga0157373_100002303 205
76 3300013104 Ga0157370_10401570 Ga0157370_104015702 205
77 3300013306 Ga0163162_10380354 Ga0163162_103803542 205
78 3300013306 Ga0163162_10515720 Ga0163162_105157201 205
79 3300013307 Ga0157372_10192284 Ga0157372_101922842 205
80 3300013308 Ga0157375_10708595 Ga0157375_107085952 205
81 3300014325 Ga0163163_10059781 Ga0163163_100597812 205
82 3300014325 Ga0163163_10470750 Ga0163163_104707502 205
83 3300014326 Ga0157380_10735033 Ga0157380_107350332 205
84 3300025250 Ga0209026_1001123 Ga0209026_100112310 205
85 3300025263 Ga0209565_1000491 Ga0209565_100049129 205
86 3300025273 Ga0209673_1002030 Ga0209673_10020308 205
87 3300025291 Ga0209675_1042190 Ga0209675_10421902 205
88 3300025295 Ga0209564_1000892 Ga0209564_100089223 205
89 3300025295 Ga0209564_1015356 Ga0209564_10153562 205
90 3300025295 Ga0209564_1026671 Ga0209564_10266712 205
91 3300025297 Ga0209758_1000924 Ga0209758_100092417 205
92 3300025297 Ga0209758_1001122 Ga0209758_100112235 205
93 3300025297 Ga0209758_1001524 Ga0209758_100152431 205
94 3300025298 Ga0209050_1000049 Ga0209050_100004924 205
95 3300025299 Ga0209256_1005632 Ga0209256_10056326 205
96 3300025304 Ga0209257_1000692 Ga0209257_100069228 205
97 3300025304 Ga0209257_1031795 Ga0209257_10317952 205
98 3300025903 Ga0207680_10239855 Ga0207680_102398552 205
99 3300025909 Ga0207705_10023787 Ga0207705_100237874 205
100 3300025909 Ga0207705_10197642 Ga0207705_101976422 205
101 3300025912 Ga0207707_10012874 Ga0207707_100128744 205
102 3300025913 Ga0207695_10005069 Ga0207695_1000506912 205
103 3300025913 Ga0207695_10022035 Ga0207695_100220357 205
104 3300025913 Ga0207695_10144744 Ga0207695_101447443 205
105 3300025917 Ga0207660_10016262 Ga0207660_100162626 205
106 3300025917 Ga0207660_10174530 Ga0207660_101745302 205
107 3300025919 Ga0207657_10010016 Ga0207657_100100166 205
108 3300025919 Ga0207657_10270919 Ga0207657_102709192 205
109 3300025921 Ga0207652_10010693 Ga0207652_100106935 205
110 3300025924 Ga0207694_10027881 Ga0207694_100278813 205
111 3300025924 Ga0207694_10071976 Ga0207694_100719762 205
112 3300025931 Ga0207644_10201422 Ga0207644_102014222 205
113 3300025932 Ga0207690_10000104 Ga0207690_1000010438 205
114 3300025932 Ga0207690_10026386 Ga0207690_100263862 205
115 3300025938 Ga0207704_10000427 Ga0207704_100004273 205
116 3300025941 Ga0207711_10000552 Ga0207711_1000055223 205
117 3300025941 Ga0207711_10001339 Ga0207711_1000133921 205
118 3300025941 Ga0207711_10091375 Ga0207711_100913753 205
119 3300025945 Ga0207679_10325456 Ga0207679_103254562 205
120 3300025949 Ga0207667_10017653 Ga0207667_100176538 205
121 3300025949 Ga0207667_10059464 Ga0207667_100594644 205
122 3300025949 Ga0207667_10261426 Ga0207667_102614262 205
123 3300025981 Ga0207640_10241767 Ga0207640_102417672 205
124 3300025986 Ga0207658_10956709 Ga0207658_109567091 205
125 3300026035 Ga0207703_10496021 Ga0207703_104960212 205
126 3300026041 Ga0207639_10215690 Ga0207639_102156902 205
127 3300026041 Ga0207639_10227300 Ga0207639_102273002 205
128 3300026088 Ga0207641_10148403 Ga0207641_101484032 205
129 3300026095 Ga0207676_10046944 Ga0207676_100469443 205
130 3300026095 Ga0207676_10064369 Ga0207676_100643693 205
131 3300026095 Ga0207676_10455727 Ga0207676_104557272 205
132 3300026116 Ga0207674_10225065 Ga0207674_102250652 205
133 3300026118 Ga0207675_100518684 Ga0207675_1005186842 205
134 3300026142 Ga0207698_10017831 Ga0207698_100178315 205
135 3300026142 Ga0207698_11421246 Ga0207698_114212461 205
136 3300028379 Ga0268266_10000005 Ga0268266_10000005803 205
137 3300028379 Ga0268266_10181634 Ga0268266_101816342 205
138 3300028380 Ga0268265_10025124 Ga0268265_100251243 205
139 3300028380 Ga0268265_10994670 Ga0268265_109946702 205
140 3300028381 Ga0268264_10000029 Ga0268264_10000029278 205
141 3300028786 Ga0307517_10004846 Ga0307517_1000484622 205
142 3300028800 Ga0265338_10018985 Ga0265338_100189853 205
143 3300028800 Ga0265338_10395051 Ga0265338_103950512 205
144 3300031456 Ga0307513_10010039 Ga0307513_1001003910 205
145 3300031456 Ga0307513_10016728 Ga0307513_100167287 205
146 3300031824 Ga0307413_10348653 Ga0307413_103486531 205
147 3300031901 Ga0307406_10559303 Ga0307406_105593032 205
148 3300031911 Ga0307412_10922866 Ga0307412_109228661 205
149 3300035725 Ga0373947_0110695 Ga0373947_0110695_329_964 205
150 3300037312 Ga0395899_0002368 Ga0395899_0002368_10181_10816 205
151 3300037312 Ga0395899_0071522 Ga0395899_0071522_1659_2294 205
152 3300037312 Ga0395899_0084700 Ga0395899_0084700_1612_2286 205
153 3300037418 Ga0395900_0000006 Ga0395900_0000006_214325_214960 205
154 3300037418 Ga0395900_0026993 Ga0395900_0026993_4431_5069 205
155 3300037418 Ga0395900_0174393 Ga0395900_0174393_1075_1710 205
156 3300037466 Ga0395898_0016373 Ga0395898_0016373_402_1037 205
157 3300037466 Ga0395898_0081102 Ga0395898_0081102_261_896 205
158 3300037466 Ga0395898_0155901 Ga0395898_0155901_833_1471 205
159 3300037466 Ga0395898_0270086 Ga0395898_0270086_842_1477 205
160 3300037471 Ga0395905_0003274 Ga0395905_0003274_12101_12736 205
161 3300037471 Ga0395905_0049782 Ga0395905_0049782_373_1011 205
162 3300037853 Ga0436364_0346688 Ga0436364_0346688_342_959 205
163 3300038443 Ga0395901_0000001 Ga0395901_0000001_257573_258208 205
164 3300038443 Ga0395901_0016778 Ga0395901_0016778_4674_5312 205
165 3300038443 Ga0395901_0675126 Ga0395901_0675126_298_1017 205
166 3300039447 Ga0436361_0021211 Ga0436361_0021211_465_1082 205
167 3300039447 Ga0436361_0025578 Ga0436361_0025578_208_825 205
168 3300039450 Ga0436363_1518347 Ga0436363_1518347_185_802 205
169 3300044842 Ga0466957_0425865 Ga0466957_0425865_246_881 205
170 3300046453 Ga0495627_007359 Ga0495627_007359_1063_1680 205
171 3300046460 Ga0495638_0002300 Ga0495638_0002300_963_1580 205
172 3300046460 Ga0495638_0003364 Ga0495638_0003364_1188_1805 205
173 3300046471 Ga0495650_0145031 Ga0495650_0145031_164_781 205
174 3300046512 Ga0495610_0001532 Ga0495610_0001532_8177_8794 205
175 3300046512 Ga0495610_0011046 Ga0495610_0011046_3190_3807 205
176 3300046519 Ga0495632_0000761 Ga0495632_0000761_3761_4378 205
177 3300046520 Ga0495637_0007257 Ga0495637_0007257_162_779 205
178 3300046520 Ga0495637_0034815 Ga0495637_0034815_516_1133 205
179 3300046524 Ga0495648_0000148 Ga0495648_0000148_2701_3318 205
180 3300046524 Ga0495648_0069781 Ga0495648_0069781_306_923 205
181 3300046528 Ga0495642_0063477 Ga0495642_0063477_733_1365 205
182 3300046616 Ga0495668_0088824 Ga0495668_0088824_655_1290 205
183 3300046616 Ga0495668_0091955 Ga0495668_0091955_31_648 205
184 3300046648 Ga0495611_0137580 Ga0495611_0137580_160_792 205
185 3300046660 Ga0495625_0001966 Ga0495625_0001966_970_1587 205
186 3300046660 Ga0495625_0013180 Ga0495625_0013180_584_1201 205
187 3300046660 Ga0495625_0092427 Ga0495625_0092427_820_1437 205
188 3300046660 Ga0495625_0120806 Ga0495625_0120806_1032_1667 205
189 3300046665 Ga0495661_0232115 Ga0495661_0232115_218_850 205
190 3300046684 Ga0495669_0121140 Ga0495669_0121140_327_959 205
191 3300046684 Ga0495669_0195347 Ga0495669_0195347_19_651 205
192 3300046692 Ga0495671_0079931 Ga0495671_0079931_147_764 205
193 3300047470 Ga0495681_0197613 Ga0495681_0197613_46_663 205
194 3300047472 Ga0495686_0009629 Ga0495686_0009629_529_1146 205
195 3300047472 Ga0495686_0040729 Ga0495686_0040729_1482_2099 205
196 3300047472 Ga0495686_0266221 Ga0495686_0266221_297_929 205
197 3300048905 Ga0496102_0112084 Ga0496102_0112084_1381_2013 205
198 3300048905 Ga0496102_0156248 Ga0496102_0156248_711_1358 205
199 3300048909 Ga0496106_0121227 Ga0496106_0121227_271_888 205
200 3300048910 Ga0496107_0000929 Ga0496107_0000929_16644_17261 205
201 3300048911 Ga0496108_0055602 Ga0496108_0055602_1642_2274 205
202 3300048912 Ga0496109_0063981 Ga0496109_0063981_273_905 205
203 3300048913 Ga0496110_0052279 Ga0496110_0052279_2194_2826 205
204 3300048915 Ga0496112_0134897 Ga0496112_0134897_1373_2005 205
205 3300048918 Ga0496115_0006124 Ga0496115_0006124_4163_4780 205
206 3300048918 Ga0496115_0023993 Ga0496115_0023993_533_1168 205
207 3300048919 Ga0496116_0077362 Ga0496116_0077362_1411_2058 205
208 3300048920 Ga0496117_0014515 Ga0496117_0014515_5069_5716 205
209 3300048921 Ga0496118_0019894 Ga0496118_0019894_1809_2456 205
210 3300048922 Ga0496119_0038313 Ga0496119_0038313_266_913 205
211 3300048924 Ga0496121_0000130 Ga0496121_0000130_64777_65424 205
212 3300048924 Ga0496121_0004688 Ga0496121_0004688_12597_13214 205
213 3300048928 Ga0496125_0145723 Ga0496125_0145723_327_944 205
214 3300049570 Ga0501033_0156589 Ga0501033_0156589_525_1169 205
215 3300049572 Ga0501036_0429051 Ga0501036_0429051_400_1044 205
216 3300049581 Ga0501047_0003160 Ga0501047_0003160_4837_5472 205
217 3300049823 Ga0501044_0009826 Ga0501044_0009826_6049_6693 205
218 3300053086 Ga0500578_0000284 Ga0500578_0000284_47280_47897 205
219 3300053087 Ga0500643_026724 Ga0500643_026724_507_1124 205
220 3300053102 Ga0500554_002315 Ga0500554_002315_2195_2812 205
221 3300053103 Ga0500555_001304 Ga0500555_001304_7172_7789 205
222 3300053104 Ga0500556_0000706 Ga0500556_0000706_2476_3093 205
223 3300053108 Ga0500562_001544 Ga0500562_001544_484_1101 205
224 3300053119 Ga0500595_052122 Ga0500595_052122_92_727 205
225 3300053125 Ga0500618_000063 Ga0500618_000063_4180_4797 205
226 3300053134 Ga0500658_0002670 Ga0500658_0002670_5432_6049 205
227 3300053136 Ga0500559_0002789 Ga0500559_0002789_774_1391 205
228 3300053156 Ga0500622_0133609 Ga0500622_0133609_479_1096 205
229 3300053730 Ga0500645_014101 Ga0500645_014101_980_1597 205
230 3300053730 Ga0500645_019311 Ga0500645_019311_366_1001 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

27

104

0.96

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

37

105

0.9

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

153

231

0.9

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

31

110

0.89

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

125

227

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n0v-assembly1.cif.gz_B crystal structure of a glutathione s-transferase domain-containing protein (marinobacter aquaeolei vt8), target efi-507332 0.9358 1 200
3erf-assembly1.cif.gz_A crystal structure of gtt2 from saccharomyces cerevisiae 0.9154 1 205
3erf-assembly1.cif.gz_A crystal structure of gtt2 from saccharomyces cerevisiae 0.9111 1 205
7miq-assembly1.cif.gz_B crystal structure of a glutathione s-transferase class gtt2 of vibrio parahaemolyticus (vpgstt2) 0.9087 1 200
3m8n-assembly2.cif.gz_D crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.8829 2 200
ID Description Score Start End Superfamily
3ibhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9422 1 77 3.40.30.10
af_Q7JVZ8_6_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9336 3 78 3.40.30.10
af_I1KAF0_1_75_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9335 1 76 3.40.30.10
3ljrB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9224 1 82 3.40.30.10
4pxoB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9161 4 75 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A258CVF2-F1-model_v4 Glutathione S-transferase 0.9869 1 149 GO:0016740
AF-A0A4Q3RYY2-F1-model_v4 Glutathione S-transferase 0.9774 1 205 GO:0016740
AF-A0A4Q3T898-F1-model_v4 Glutathione S-transferase 0.976 1 97 GO:0005737
GO:0016740
AF-A0A6B3ULG7-F1-model_v4 Glutathione S-transferase 0.9742 1 204 GO:0016740
AF-A0A258CVF2-F1-model_v4 Glutathione S-transferase 0.974 1 149 GO:0016740

Feature Viewer

pLDDT pTM Quality
93.1 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map