F342342

General Info

Members Datasets Scaffolds Average Seq Length
229 165 167 183

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0007915|Ga0495588_0007915_225_854
Length 209
Sequence LWIQFFFIAMLITIPPIYFTHQESSMSKAVVVYFSGYGHTKRVAEAAAEGAHAALIEIDAEGNVPEAAWGQLDEAQSIIFGAPTYMGSVPWQFKKFADATSKKWFVRQWQDKAFGGFTNSASLNGDKQVSLIFLQTLASQHGGIWVSLGLAPANSSASTRADVNNLGGSVGALVQSPSDVDAQGIPDGDLETVRLYAARIAGIGQRLHA

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
4 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
5 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
6 2547132181 Kosakonia sacchari SP1 Isolate Stem
7 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
8 2561511199 Enterobacter sp. R4-368 Isolate Nodule
9 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
10 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
11 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
12 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
13 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
14 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
15 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
16 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
17 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
18 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
19 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
20 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
21 2738541297 Duganella sp. GV083 Isolate Unclassified
22 2738541357 Duganella sp. GV053 Isolate Unclassified
23 2738543003 Duganella sp. GV066 Isolate Unclassified
24 2738543026 Duganella sp. GV089 Isolate Unclassified
25 2738543029 Duganella sp. GV039 Isolate Unclassified
26 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
27 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
28 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
29 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
30 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
31 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
32 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
33 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
34 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
35 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
36 2821131069 Duganella sp. 1224 Isolate Unclassified
37 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
38 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
39 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
40 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
41 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
42 2857553236 Duganella sp. R-74557 Isolate Unclassified
43 2857564685 Duganella sp. R-74599 Isolate Unclassified
44 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
45 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
46 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
47 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
48 2904424332 Duganella sp. 1411 Isolate Rhizosphere
49 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
50 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
51 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
52 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
53 2919476304 Duganella sp. 3397 Isolate Unclassified
54 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
55 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
56 2937539931 Pantoea sp. LS15 Isolate Unclassified
57 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
58 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
59 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
62 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
63 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
64 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
65 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
81 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
82 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
83 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
103 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
106 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
107 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
114 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
115 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
121 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
153 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
154 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
159 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 639633007 Azoarcus olearius BH72 Isolate Unclassified
162 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
163 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
164 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
165 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.93
Metatranscriptomes 0
Isolates 27.07

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 8.3
Nodule 1.75
Rhizoplane 5.68
Rhizosphere 56.33
Stem 0.44
Stem Tuber 3.06
Unclassified 24.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C1453 2010549000 Bacteria 2766
2 SwRhRL2b_contig_2229698 2162886007 Bacteria 2022
3 JGI25150J39212_1011086 3300002774 Bacteria 1647
4 JGI25151J46595_10004501 3300003187 Bacteria 7364
5 JGI25151J46595_10056500 3300003187 Bacteria 1286
6 JGI25153J46596_10018272 3300003215 Bacteria 2730
7 Ga0058692_1000143 3300003856 Bacteria 45126
8 Ga0058692_1000220 3300003856 Bacteria 33626
9 Ga0065703_1000156 3300005272 Bacteria 19400
10 Ga0065704_10076968 3300005289 Bacteria 4904
11 Ga0065704_10095727 3300005289 Bacteria 2475
12 Ga0070670_100000555 3300005331 Bacteria 29638
13 Ga0070666_10424347 3300005335 Bacteria 958
14 Ga0070668_100478261 3300005347 Bacteria 1075
15 Ga0070669_100023222 3300005353 Bacteria 4441
16 Ga0068857_100186200 3300005577 Bacteria 1890
17 Ga0075364_10048728 3300006051 Bacteria 2761
18 Ga0075364_10474787 3300006051 Bacteria 855
19 Ga0075366_10020354 3300006195 Bacteria 3850
20 Ga0079104_1001008 3300006946 Bacteria 21846
21 Ga0079104_1004309 3300006946 Bacteria 6158
22 Ga0105251_10000074 3300009011 Bacteria 95770
23 Ga0105251_10001560 3300009011 Bacteria 19624
24 Ga0105251_10105885 3300009011 Bacteria 1284
25 Ga0105251_10168691 3300009011 Bacteria 986
26 Ga0105244_10004605 3300009036 Bacteria 9438
27 Ga0105244_10010947 3300009036 Bacteria 5470
28 Ga0105244_10060316 3300009036 Bacteria 1911
29 Ga0105244_10157024 3300009036 Bacteria 1088
30 Ga0105244_10342434 3300009036 Bacteria 689
31 Ga0105250_10145746 3300009092 Bacteria 983
32 Ga0105243_10000179 3300009148 Bacteria 73496
33 Ga0105243_10012229 3300009148 Bacteria 6490
34 Ga0105243_11106053 3300009148 Bacteria 801
35 Ga0105249_10002431 3300009553 Bacteria 16168
36 Ga0157373_10291220 3300013100 Bacteria 1158
37 Ga0157371_10006626 3300013102 Bacteria 9498
38 Ga0183366_1002 3300015679 Bacteria 791639
39 Ga0183370_1002 3300015680 Bacteria 791639
40 Ga0183369_1002 3300015685 Bacteria 791621
41 Ga0183368_1005 3300015687 Bacteria 791621
42 Ga0163161_10048990 3300017792 Bacteria 3052
43 Ga0213872_10001458 3300021361 Bacteria 15380
44 Ga0213872_10001622 3300021361 Bacteria 14246
45 Ga0213872_10013049 3300021361 Bacteria 3895
46 Ga0213872_10016954 3300021361 Bacteria 3373
47 Ga0213872_10021073 3300021361 Bacteria 3001
48 Ga0213872_10119746 3300021361 Bacteria 1164
49 Ga0213876_10000030 3300021384 Bacteria 216610
50 Ga0207425_1000318 3300025245 Bacteria 34531
51 Ga0209129_1015482 3300025258 Bacteria 1568
52 Ga0209676_1003774 3300025292 Bacteria 8977
53 Ga0209025_1001351 3300025294 Bacteria 32990
54 Ga0209025_1004142 3300025294 Bacteria 12875
55 Ga0209758_1000675 3300025297 Bacteria 50917
56 Ga0209050_1005132 3300025298 Bacteria 8406
57 Ga0209257_1016861 3300025304 Bacteria 2920
58 Ga0207655_1001016 3300025728 Bacteria 28449
59 Ga0207655_1001148 3300025728 Bacteria 25838
60 Ga0207655_1002997 3300025728 Bacteria 12932
61 Ga0207655_1003488 3300025728 Bacteria 11681
62 Ga0207655_1061245 3300025728 Bacteria 1454
63 Ga0207713_1000304 3300025735 Bacteria 56183
64 Ga0207713_1000662 3300025735 Bacteria 32760
65 Ga0207713_1016187 3300025735 Bacteria 3794
66 Ga0207681_10000677 3300025923 Bacteria 22353
67 Ga0207650_10001422 3300025925 Bacteria 17253
68 Ga0207709_10000166 3300025935 Bacteria 89679
69 Ga0207709_10006532 3300025935 Bacteria 6550
70 Ga0207712_10002481 3300025961 Bacteria 11889
71 Ga0207668_10327249 3300025972 Bacteria 1274
72 Ga0207674_10222066 3300026116 Bacteria 1838
73 Ga0209281_1000050 3300027111 Bacteria 320102
74 Ga0209371_1000048 3300027312 Bacteria 281705
75 Ga0209371_1000054 3300027312 Bacteria 259676
76 Ga0268266_10507735 3300028379 Bacteria 1152
77 Ga0265323_10028467 3300028653 Bacteria 2095
78 Ga0268256_1000012 3300030500 Bacteria 794553
79 Ga0268256_1000049 3300030500 Bacteria 307229
80 Ga0316181_1239567 3300030744 Bacteria 3013
81 Ga0265316_10025231 3300031344 Bacteria 4964
82 Ga0373931_0027141 3300035691 Bacteria 2920
83 Ga0373925_0244514 3300037068 Bacteria 1438
84 Ga0436365_0368505 3300039437 Bacteria 454216
85 Ga0436361_0047539 3300039447 Bacteria 4730
86 Ga0436361_0081531 3300039447 Bacteria 6653
87 Ga0436361_0082784 3300039447 Bacteria 1625
88 Ga0436361_0118848 3300039447 Bacteria 1808
89 Ga0436361_0444655 3300039447 Bacteria 2018
90 Ga0436361_0709381 3300039447 Bacteria 3409
91 Ga0436361_0843401 3300039447 Bacteria 3240
92 Ga0436361_1055199 3300039447 Bacteria 816
93 Ga0451793_1526223 3300041452 Bacteria 2076
94 Ga0451841_0811573 3300041498 Bacteria 818
95 Ga0451843_1775924 3300041509 Bacteria 1122
96 Ga0451577_0165977 3300042876 Bacteria 1989
97 Ga0451577_1146671 3300042876 Bacteria 694
98 Ga0453684_0016015 3300044712 Bacteria 11776
99 Ga0453684_0809557 3300044712 Bacteria 1010
100 Ga0451576_0153935 3300045051 Bacteria 2398
101 Ga0451576_0213185 3300045051 Bacteria 2017
102 Ga0451576_0744945 3300045051 Bacteria 1029
103 Ga0466958_0054159 3300045836 Bacteria 2433
104 Ga0495617_000050 3300046452 Bacteria 109761
105 Ga0495627_000001 3300046453 Bacteria 1104709
106 Ga0495653_0000058 3300046463 Bacteria 98687
107 Ga0495650_0000479 3300046471 Bacteria 61103
108 Ga0495585_0002197 3300046492 Bacteria 14169
109 Ga0495606_0000330 3300046507 Bacteria 81940
110 Ga0495610_0149618 3300046512 Bacteria 997
111 Ga0495643_0061742 3300046522 Bacteria 1986
112 Ga0495648_0007792 3300046524 Bacteria 8519
113 Ga0495648_0039483 3300046524 Bacteria 3003
114 Ga0495654_0003699 3300046530 Bacteria 9288
115 Ga0495654_0261578 3300046530 Bacteria 717
116 Ga0495668_0001402 3300046616 Bacteria 23465
117 Ga0495625_0026728 3300046660 Bacteria 4354
118 Ga0495625_0081677 3300046660 Bacteria 2249
119 Ga0495661_0005764 3300046665 Bacteria 8765
120 Ga0495588_0007915 3300046674 Bacteria 4857
121 Ga0495671_0000001 3300046692 Bacteria 1169494
122 Ga0495671_0004867 3300046692 Bacteria 7944
123 Ga0495589_0285817 3300046794 Bacteria 766
124 Ga0495660_0000024 3300046810 Bacteria 268209
125 Ga0495660_0002098 3300046810 Bacteria 12916
126 Ga0495660_0011717 3300046810 Bacteria 5085
127 Ga0495679_058901 3300047446 Bacteria 1131
128 Ga0495673_0000006 3300047469 Bacteria 908691
129 Ga0495673_0000049 3300047469 Bacteria 265878
130 Ga0495686_0000869 3300047472 Bacteria 38479
131 Ga0496103_0001114 3300048906 Bacteria 18700
132 Ga0496113_0274202 3300048916 Bacteria 1348
133 Ga0496117_0001426 3300048920 Bacteria 34555
134 Ga0496118_0245762 3300048921 Bacteria 1021
135 Ga0496118_0351362 3300048921 Bacteria 785
136 Ga0496119_0000733 3300048922 Bacteria 44239
137 Ga0496119_0005044 3300048922 Bacteria 12833
138 Ga0496119_0134281 3300048922 Bacteria 1344
139 Ga0496120_0000671 3300048923 Bacteria 50340
140 Ga0496120_0069272 3300048923 Bacteria 1943
141 Ga0496121_0001637 3300048924 Bacteria 37035
142 Ga0496122_0000347 3300048925 Bacteria 100062
143 Ga0496122_0001460 3300048925 Bacteria 38119
144 Ga0496122_0003613 3300048925 Bacteria 20138
145 Ga0496122_0020408 3300048925 Bacteria 5987
146 Ga0496122_0047519 3300048925 Bacteria 3313
147 Ga0496122_0187050 3300048925 Bacteria 1227
148 Ga0496123_0000014 3300048926 Bacteria 433465
149 Ga0496123_0000974 3300048926 Bacteria 44176
150 Ga0496123_0006365 3300048926 Bacteria 11461
151 Ga0496123_0010335 3300048926 Bacteria 8269
152 Ga0496123_0056513 3300048926 Bacteria 2564
153 Ga0496124_0000681 3300048927 Bacteria 55817
154 Ga0496125_0000135 3300048928 Bacteria 160987
155 Ga0496125_0011064 3300048928 Bacteria 9055
156 Ga0496126_0026015 3300048929 Bacteria 5618
157 Ga0496126_0393717 3300048929 Bacteria 1125
158 Ga0495678_000002 3300049459 Bacteria 999613
159 Ga0501266_000629 3300049763 Bacteria 4593
160 Ga0501269_000662 3300049766 Bacteria 5904
161 Ga0501035_0035556 3300049822 Bacteria 4520
162 Ga0501035_0633381 3300049822 Bacteria 868
163 Ga0501044_0000943 3300049823 Bacteria 34890
164 nmdc:mga0k408_19237_c1 3300050493 Bacteria 3814
165 Ga0500586_001974 3300053145 Bacteria 4496
166 Ga0500634_0000911 3300053161 Bacteria 10587
167 Ga0466962_0323796 3300061719 Bacteria 765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10291220 Ga0157373_102912201 164
2 3300049763 Ga0501266_000629 Ga0501266_000629_2490_3113 165
3 3300005272 Ga0065703_1000156 Ga0065703_10001566 175
4 3300005335 Ga0070666_10424347 Ga0070666_104243472 175
5 3300005353 Ga0070669_100023222 Ga0070669_1000232223 175
6 3300006051 Ga0075364_10474787 Ga0075364_104747871 175
7 3300009011 Ga0105251_10168691 Ga0105251_101686911 175
8 3300009036 Ga0105244_10157024 Ga0105244_101570242 175
9 3300009036 Ga0105244_10342434 Ga0105244_103424341 175
10 3300009092 Ga0105250_10145746 Ga0105250_101457462 175
11 3300009148 Ga0105243_10000179 Ga0105243_1000017922 175
12 3300025728 Ga0207655_1002997 Ga0207655_10029973 175
13 3300025728 Ga0207655_1003488 Ga0207655_10034883 175
14 3300025735 Ga0207713_1000304 Ga0207713_100030425 175
15 3300025923 Ga0207681_10000677 Ga0207681_1000067718 175
16 3300025935 Ga0207709_10000166 Ga0207709_1000016628 175
17 3300046530 Ga0495654_0261578 Ga0495654_0261578_137_694 176
18 iso_pu_bacteria 2547132181 2547696427 178
19 iso_pu_bacteria 2561511199 2562465796 178
20 iso_pu_bacteria 2600255256 2601533846 178
21 iso_pu_bacteria 2600255257 2601540933 178
22 iso_pu_bacteria 2600255310 2601759426 178
23 iso_pu_bacteria 2600255311 2601762648 178
24 iso_pu_bacteria 2602042046 2603640500 178
25 iso_pu_bacteria 2602042047 2603644012 178
26 iso_pu_bacteria 2602042067 2603704508 178
27 iso_pu_bacteria 2609459761 2609910412 178
28 iso_pu_bacteria 2791355010 2792313214 178
29 iso_pu_bacteria 2811995292 2813730745 178
30 iso_pu_bacteria 2814123068 2814698346 178
31 iso_pu_bacteria 2908669403 2908673886 178
32 iso_pu_bacteria 2937539931 2937543708 178
33 iso_pu_bacteria 2945874760 2945878313 178
34 iso_pu_bacteria 2523231067 2523466129 179
35 iso_pu_bacteria 2537561728 2538427691 179
36 iso_pu_bacteria 2547132103 2547371521 179
37 iso_pu_bacteria 2643221665 2644363131 179
38 iso_pu_bacteria 2671180115 2671585895 179
39 iso_pu_bacteria 2706794495 2707100616 179
40 iso_pu_bacteria 2738541297 2738829519 179
41 iso_pu_bacteria 2738541357 2739153315 179
42 iso_pu_bacteria 2738543003 2739195235 179
43 iso_pu_bacteria 2738543026 2739321711 179
44 iso_pu_bacteria 2738543029 2739339733 179
45 iso_pu_bacteria 2738543031 2739347139 179
46 iso_pu_bacteria 2791354903 2791923503 179
47 iso_pu_bacteria 2808606384 2808972624 179
48 iso_pu_bacteria 2808606390 2809007383 179
49 iso_pu_bacteria 2808606391 2809014591 179
50 iso_pu_bacteria 2821131069 2821131312 179
51 iso_pu_bacteria 2843690924 2843691862 179
52 iso_pu_bacteria 2852684882 2852687907 179
53 iso_pu_bacteria 2854601825 2854604355 179
54 iso_pu_bacteria 2855195626 2855198193 179
55 iso_pu_bacteria 2857553236 2857555349 179
56 iso_pu_bacteria 2857564685 2857565028 179
57 iso_pu_bacteria 2858466076 2858467236 179
58 iso_pu_bacteria 2871272651 2871273074 179
59 iso_pu_bacteria 2871282230 2871283130 179
60 iso_pu_bacteria 2900051742 2900053474 179
61 iso_pu_bacteria 2900051742 2900054951 179
62 iso_pu_bacteria 2904424332 2904430154 179
63 iso_pu_bacteria 2904434214 2904437874 179
64 iso_pu_bacteria 2916699645 2916701703 179
65 iso_pu_bacteria 2919476304 2919477720 179
66 iso_pu_bacteria 2919506607 2919507517 179
67 iso_pu_bacteria 2928515477 2928516461 179
68 iso_pu_bacteria 2984568884 2984570677 179
69 iso_pu_bacteria 639633007 639788682 179
70 iso_pu_bacteria 8002745576 8002749032 179
71 iso_pu_bacteria 8021622325 8021624013 179
72 iso_pu_bacteria 8021626552 8021629834 179
73 iso_pu_bacteria 8021648035 8021648298 179
74 iso_pu_bacteria 2551306352 2552746741 180
75 iso_pu_bacteria 2675903507 2678232281 180
76 iso_pu_bacteria 2773857761 2774391037 180
77 iso_pu_bacteria 2773857770 2774439098 180
78 iso_pu_bacteria 2842718218 2842719180 180
79 iso_pu_bacteria 2919182534 2919185823 180
80 3300041509 Ga0451843_1775924 Ga0451843_1775924_537_1103 181
81 3300045051 Ga0451576_0213185 Ga0451576_0213185_921_1478 181
82 3300045051 Ga0451576_0744945 Ga0451576_0744945_432_986 181
83 2010549000 RicEn_C1453 RicEn_26430 182
84 2162886007 SwRhRL2b_contig_2229698 SwRhRL2b_0218.00001900 182
85 3300002774 JGI25150J39212_1011086 JGI25150J39212_10110861 182
86 3300003187 JGI25151J46595_10004501 JGI25151J46595_100045015 182
87 3300003187 JGI25151J46595_10056500 JGI25151J46595_100565002 182
88 3300003215 JGI25153J46596_10018272 JGI25153J46596_100182724 182
89 3300003856 Ga0058692_1000143 Ga0058692_100014333 182
90 3300003856 Ga0058692_1000220 Ga0058692_10002202 182
91 3300005289 Ga0065704_10076968 Ga0065704_100769685 182
92 3300005289 Ga0065704_10095727 Ga0065704_100957273 182
93 3300005331 Ga0070670_100000555 Ga0070670_10000055518 182
94 3300005347 Ga0070668_100478261 Ga0070668_1004782612 182
95 3300005577 Ga0068857_100186200 Ga0068857_1001862003 182
96 3300006051 Ga0075364_10048728 Ga0075364_100487282 182
97 3300006195 Ga0075366_10020354 Ga0075366_100203543 182
98 3300006946 Ga0079104_1001008 Ga0079104_10010085 182
99 3300006946 Ga0079104_1004309 Ga0079104_10043094 182
100 3300009011 Ga0105251_10000074 Ga0105251_1000007441 182
101 3300009011 Ga0105251_10001560 Ga0105251_1000156018 182
102 3300009011 Ga0105251_10105885 Ga0105251_101058852 182
103 3300009036 Ga0105244_10004605 Ga0105244_100046053 182
104 3300009036 Ga0105244_10010947 Ga0105244_100109472 182
105 3300009036 Ga0105244_10060316 Ga0105244_100603162 182
106 3300009148 Ga0105243_10012229 Ga0105243_100122293 182
107 3300009148 Ga0105243_11106053 Ga0105243_111060532 182
108 3300009553 Ga0105249_10002431 Ga0105249_1000243115 182
109 3300013102 Ga0157371_10006626 Ga0157371_100066262 182
110 3300015679 Ga0183366_1002 Ga0183366_1002297 182
111 3300015680 Ga0183370_1002 Ga0183370_1002297 182
112 3300015685 Ga0183369_1002 Ga0183369_1002297 182
113 3300015687 Ga0183368_1005 Ga0183368_1005297 182
114 3300017792 Ga0163161_10048990 Ga0163161_100489905 182
115 3300021361 Ga0213872_10001458 Ga0213872_100014589 182
116 3300021361 Ga0213872_10001622 Ga0213872_100016225 182
117 3300021361 Ga0213872_10013049 Ga0213872_100130493 182
118 3300021361 Ga0213872_10016954 Ga0213872_100169544 182
119 3300021361 Ga0213872_10021073 Ga0213872_100210733 182
120 3300021361 Ga0213872_10119746 Ga0213872_101197461 182
121 3300021384 Ga0213876_10000030 Ga0213876_10000030180 182
122 3300025245 Ga0207425_1000318 Ga0207425_100031813 182
123 3300025258 Ga0209129_1015482 Ga0209129_10154823 182
124 3300025292 Ga0209676_1003774 Ga0209676_10037748 182
125 3300025294 Ga0209025_1001351 Ga0209025_100135120 182
126 3300025294 Ga0209025_1004142 Ga0209025_10041425 182
127 3300025297 Ga0209758_1000675 Ga0209758_100067518 182
128 3300025298 Ga0209050_1005132 Ga0209050_10051323 182
129 3300025304 Ga0209257_1016861 Ga0209257_10168614 182
130 3300025728 Ga0207655_1001016 Ga0207655_100101614 182
131 3300025728 Ga0207655_1001148 Ga0207655_100114818 182
132 3300025728 Ga0207655_1061245 Ga0207655_10612452 182
133 3300025735 Ga0207713_1000662 Ga0207713_100066232 182
134 3300025735 Ga0207713_1016187 Ga0207713_10161871 182
135 3300025925 Ga0207650_10001422 Ga0207650_100014227 182
136 3300025935 Ga0207709_10006532 Ga0207709_100065326 182
137 3300025961 Ga0207712_10002481 Ga0207712_1000248111 182
138 3300025972 Ga0207668_10327249 Ga0207668_103272492 182
139 3300026116 Ga0207674_10222066 Ga0207674_102220663 182
140 3300027111 Ga0209281_1000050 Ga0209281_1000050276 182
141 3300027312 Ga0209371_1000048 Ga0209371_100004878 182
142 3300027312 Ga0209371_1000054 Ga0209371_1000054207 182
143 3300028379 Ga0268266_10507735 Ga0268266_105077352 182
144 3300028653 Ga0265323_10028467 Ga0265323_100284672 182
145 3300030500 Ga0268256_1000012 Ga0268256_1000012486 182
146 3300030500 Ga0268256_1000049 Ga0268256_1000049190 182
147 3300030744 Ga0316181_1239567 Ga0316181_12395672 182
148 3300031344 Ga0265316_10025231 Ga0265316_100252314 182
149 3300035691 Ga0373931_0027141 Ga0373931_0027141_2183_2737 182
150 3300037068 Ga0373925_0244514 Ga0373925_0244514_142_696 182
151 3300039437 Ga0436365_0368505 Ga0436365_0368505_359449_359997 182
152 3300039447 Ga0436361_0047539 Ga0436361_0047539_2544_3107 182
153 3300039447 Ga0436361_0081531 Ga0436361_0081531_3974_4573 182
154 3300039447 Ga0436361_0082784 Ga0436361_0082784_89_652 182
155 3300039447 Ga0436361_0118848 Ga0436361_0118848_280_840 182
156 3300039447 Ga0436361_0444655 Ga0436361_0444655_1196_1759 182
157 3300039447 Ga0436361_0709381 Ga0436361_0709381_983_1546 182
158 3300039447 Ga0436361_0843401 Ga0436361_0843401_2490_3053 182
159 3300039447 Ga0436361_1055199 Ga0436361_1055199_38_613 182
160 3300041452 Ga0451793_1526223 Ga0451793_1526223_1397_1966 182
161 3300041498 Ga0451841_0811573 Ga0451841_0811573_77_739 182
162 3300042876 Ga0451577_0165977 Ga0451577_0165977_174_728 182
163 3300042876 Ga0451577_1146671 Ga0451577_1146671_50_604 182
164 3300044712 Ga0453684_0016015 Ga0453684_0016015_9042_9596 182
165 3300044712 Ga0453684_0809557 Ga0453684_0809557_432_986 182
166 3300045051 Ga0451576_0153935 Ga0451576_0153935_743_1297 182
167 3300045836 Ga0466958_0054159 Ga0466958_0054159_1585_2139 182
168 3300046452 Ga0495617_000050 Ga0495617_000050_71031_71585 182
169 3300046453 Ga0495627_000001 Ga0495627_000001_205984_206541 182
170 3300046463 Ga0495653_0000058 Ga0495653_0000058_93745_94299 182
171 3300046471 Ga0495650_0000479 Ga0495650_0000479_30515_31069 182
172 3300046492 Ga0495585_0002197 Ga0495585_0002197_6437_6991 182
173 3300046507 Ga0495606_0000330 Ga0495606_0000330_10444_10998 182
174 3300046512 Ga0495610_0149618 Ga0495610_0149618_12_563 182
175 3300046522 Ga0495643_0061742 Ga0495643_0061742_1375_1932 182
176 3300046524 Ga0495648_0007792 Ga0495648_0007792_7175_7729 182
177 3300046524 Ga0495648_0039483 Ga0495648_0039483_1947_2501 182
178 3300046530 Ga0495654_0003699 Ga0495654_0003699_5884_6438 182
179 3300046616 Ga0495668_0001402 Ga0495668_0001402_6669_7223 182
180 3300046660 Ga0495625_0026728 Ga0495625_0026728_159_710 182
181 3300046660 Ga0495625_0081677 Ga0495625_0081677_1053_1610 182
182 3300046665 Ga0495661_0005764 Ga0495661_0005764_1625_2179 182
183 3300046674 Ga0495588_0007915 Ga0495588_0007915_225_854 182
184 3300046692 Ga0495671_0000001 Ga0495671_0000001_420552_421106 182
185 3300046692 Ga0495671_0004867 Ga0495671_0004867_6867_7421 182
186 3300046794 Ga0495589_0285817 Ga0495589_0285817_79_633 182
187 3300046810 Ga0495660_0000024 Ga0495660_0000024_163300_163857 182
188 3300046810 Ga0495660_0002098 Ga0495660_0002098_11990_12547 182
189 3300046810 Ga0495660_0011717 Ga0495660_0011717_1979_2533 182
190 3300047446 Ga0495679_058901 Ga0495679_058901_424_978 182
191 3300047469 Ga0495673_0000006 Ga0495673_0000006_775517_776071 182
192 3300047469 Ga0495673_0000049 Ga0495673_0000049_210279_210833 182
193 3300047472 Ga0495686_0000869 Ga0495686_0000869_4413_4964 182
194 3300048906 Ga0496103_0001114 Ga0496103_0001114_1758_2309 182
195 3300048916 Ga0496113_0274202 Ga0496113_0274202_148_699 182
196 3300048920 Ga0496117_0001426 Ga0496117_0001426_5699_6268 182
197 3300048921 Ga0496118_0245762 Ga0496118_0245762_417_971 182
198 3300048921 Ga0496118_0351362 Ga0496118_0351362_189_758 182
199 3300048922 Ga0496119_0000733 Ga0496119_0000733_14920_15489 182
200 3300048922 Ga0496119_0005044 Ga0496119_0005044_7188_7736 182
201 3300048922 Ga0496119_0134281 Ga0496119_0134281_187_741 182
202 3300048923 Ga0496120_0000671 Ga0496120_0000671_28810_29379 182
203 3300048923 Ga0496120_0069272 Ga0496120_0069272_1202_1756 182
204 3300048924 Ga0496121_0001637 Ga0496121_0001637_9896_10444 182
205 3300048925 Ga0496122_0000347 Ga0496122_0000347_9055_9603 182
206 3300048925 Ga0496122_0001460 Ga0496122_0001460_8360_8929 182
207 3300048925 Ga0496122_0003613 Ga0496122_0003613_170_730 182
208 3300048925 Ga0496122_0020408 Ga0496122_0020408_2217_2765 182
209 3300048925 Ga0496122_0047519 Ga0496122_0047519_1158_1712 182
210 3300048925 Ga0496122_0187050 Ga0496122_0187050_391_945 182
211 3300048926 Ga0496123_0000014 Ga0496123_0000014_423828_424376 182
212 3300048926 Ga0496123_0000974 Ga0496123_0000974_40118_40687 182
213 3300048926 Ga0496123_0006365 Ga0496123_0006365_7595_8149 182
214 3300048926 Ga0496123_0010335 Ga0496123_0010335_4888_5448 182
215 3300048926 Ga0496123_0056513 Ga0496123_0056513_870_1418 182
216 3300048927 Ga0496124_0000681 Ga0496124_0000681_28550_29119 182
217 3300048928 Ga0496125_0000135 Ga0496125_0000135_140523_141083 182
218 3300048928 Ga0496125_0011064 Ga0496125_0011064_4796_5344 182
219 3300048929 Ga0496126_0026015 Ga0496126_0026015_3742_4302 182
220 3300048929 Ga0496126_0393717 Ga0496126_0393717_467_1024 182
221 3300049459 Ga0495678_000002 Ga0495678_000002_351673_352230 182
222 3300049766 Ga0501269_000662 Ga0501269_000662_2840_3391 182
223 3300049822 Ga0501035_0035556 Ga0501035_0035556_3688_4242 182
224 3300049822 Ga0501035_0633381 Ga0501035_0633381_246_800 182
225 3300049823 Ga0501044_0000943 Ga0501044_0000943_34070_34624 182
226 3300050493 nmdc:mga0k408_19237_c1 nmdc:mga0k408_19237_c1_1677_2231 182
227 3300053145 Ga0500586_001974 Ga0500586_001974_3420_3974 182
228 3300053161 Ga0500634_0000911 Ga0500634_0000911_1914_2468 182
229 3300061719 Ga0466962_0323796 Ga0466962_0323796_157_732 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12724

Flavodoxin_5

Flavodoxin domain

30

118

0.86

PF03358

FMN_red

NADPH-dependent FMN reductase

31

157

0.85

PF00258

Flavodoxin_1

Flavodoxin

31

135

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7n-assembly1.cif.gz_A the crystal structure of the flavodoxin, wrba-like protein from agrobacterium tumefaciens 0.985 2 182
3d7n-assembly1.cif.gz_A the crystal structure of the flavodoxin, wrba-like protein from agrobacterium tumefaciens 0.9664 2 182
4laf-assembly1.cif.gz_D crystal structure of pnpb complex with fmn 0.8688 1 181
2a5l-assembly1.cif.gz_A the crystal structure of the trp repressor binding protein wrba from pseudomonas aeruginosa 0.865 2 180
4laf-assembly1.cif.gz_D crystal structure of pnpb complex with fmn 0.8598 1 181
ID Description Score Start End Superfamily
3d7nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9672 2 182 3.40.50.360
3d7nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9486 2 182 3.40.50.360
af_K7MW35_1_136_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9303 44 123 3.40.50.360
2ohhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.846 3 176 3.40.50.360
af_A0A0R0H261_1_202_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8429 1 181 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A2S9K7A6-F1-model_v4 Flavoprotein WrbA 0.9947 2 182 GO:0003955
GO:0009055
GO:0010181
GO:0016020
AF-A0A7X8Z2P4-F1-model_v4 deleted 0.9944 2 181
AF-A0A4V1RIW5-F1-model_v4 Flavodoxin family protein 0.9944 1 181 GO:0003955
GO:0009055
GO:0010181
GO:0016020
AF-A0A0Q0EFX2-F1-model_v4 Flavodoxin/nitric oxide synthase 0.9944 1 180 GO:0003955
GO:0009055
GO:0010181
GO:0016020
AF-Q93CC2-F1-model_v4 NADPH-dependent FMN reductase 0.994 53 182 GO:0003955
GO:0016020

Feature Viewer

pLDDT pTM Quality
96.35 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map