F342270

General Info

Members Datasets Scaffolds Average Seq Length
229 91 229 255

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0039050|Ga0453684_0039050_4560_5393
Length 277
Sequence MAWDRQITIKSPAEIEIMRAAGRINAEALAAAAALVRPGVSTADLNAAAEDVLKKYGAYSPFKNYPGSYPYPASTCVSINEELVHGIPDKKRKLKEGDIVSMDCGTVFEGFVADSAFTAGVGEVSPVARKLLETTEKALYAGIAKMVPGNHVGDISAAVQQVVESRGLYVTREYTGHGVGRAMHEGPQVPNYGIPGRGMLLRTGMTIALEPMVLVGTAVTRVMQDEWTVCSADRSYTCHFEHSVAITENGPQILTLLADGSAPAQIGGPGQLKKEIV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
46 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
47 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
48 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
49 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
50 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
54 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
55 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
61 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
62 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
65 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
74 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
80 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
81 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
82 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
85 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
86 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
87 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
88 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
91 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 3.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002232 3300003203 Bacteria 9136
2 Ga0065704_10070890 3300005289 Bacteria 14917
3 Ga0065704_10102819 3300005289 Bacteria 2192
4 Ga0065704_10123953 3300005289 Bacteria 1725
5 Ga0065707_10082110 3300005295 Bacteria 21594
6 Ga0065707_10083718 3300005295 Bacteria 8386
7 Ga0065707_10122843 3300005295 Bacteria 2079
8 Ga0065707_10245975 3300005295 Bacteria 1121
9 Ga0070689_100007346 3300005340 Bacteria 7694
10 Ga0070689_100192364 3300005340 Bacteria 1662
11 Ga0070691_10132091 3300005341 Bacteria 1266
12 Ga0070713_100110140 3300005436 Unclassified 2400
13 Ga0070705_100320393 3300005440 Bacteria 1119
14 Ga0070700_100014148 3300005441 Bacteria 4503
15 Ga0070707_100082099 3300005468 Bacteria 3113
16 Ga0070698_100026205 3300005471 Bacteria 6070
17 Ga0070698_100044535 3300005471 Bacteria 4543
18 Ga0070698_100184782 3300005471 Unclassified 2022
19 Ga0070699_100002160 3300005518 Bacteria 17784
20 Ga0070699_100048913 3300005518 Bacteria 3659
21 Ga0070699_100134553 3300005518 Bacteria 2180
22 Ga0070695_100038518 3300005545 Bacteria 3017
23 Ga0070695_100276394 3300005545 Bacteria 1232
24 Ga0070696_100126385 3300005546 Bacteria 1856
25 Ga0070696_100309268 3300005546 Bacteria 1213
26 Ga0068857_100493186 3300005577 Bacteria 1149
27 Ga0068859_100017341 3300005617 Bacteria 7232
28 Ga0068861_100159237 3300005719 Bacteria 1861
29 Ga0068860_100416031 3300005843 Bacteria 1332
30 Ga0068862_100041868 3300005844 Bacteria 3899
31 Ga0068862_100144333 3300005844 Bacteria 2114
32 Ga0081539_10003413 3300005985 Bacteria 19564
33 Ga0075427_10000132 3300006194 Bacteria 6729
34 Ga0075428_100004783 3300006844 Bacteria 15000
35 Ga0075428_100006904 3300006844 Bacteria 12609
36 Ga0075430_100084328 3300006846 Unclassified 2661
37 Ga0075430_100251938 3300006846 Bacteria 1463
38 Ga0075430_100350117 3300006846 Bacteria 1220
39 Ga0075431_100003767 3300006847 Bacteria 14739
40 Ga0075431_100260968 3300006847 Bacteria 1758
41 Ga0075431_100506634 3300006847 Bacteria 1198
42 Ga0075433_10031573 3300006852 Bacteria 4528
43 Ga0075434_100065414 3300006871 Bacteria 3621
44 Ga0075429_100020300 3300006880 Bacteria 5763
45 Ga0075429_100087873 3300006880 Bacteria 2709
46 Ga0075429_100117869 3300006880 Bacteria 2320
47 Ga0075429_100187646 3300006880 Bacteria 1812
48 Ga0075429_100261893 3300006880 Bacteria 1514
49 Ga0097620_100017341 3300006931 Bacteria 7232
50 Ga0111539_10024178 3300009094 Bacteria 7460
51 Ga0114129_10002710 3300009147 Bacteria 24665
52 Ga0114129_10011857 3300009147 Bacteria 12398
53 Ga0114129_10017603 3300009147 Bacteria 10172
54 Ga0114129_10031086 3300009147 Bacteria 7552
55 Ga0114129_10031948 3300009147 Bacteria 7443
56 Ga0114129_10101811 3300009147 Bacteria 3973
57 Ga0114129_10371324 3300009147 Bacteria 1891
58 Ga0105243_10003080 3300009148 Bacteria 13726
59 Ga0105243_10717467 3300009148 Bacteria 976
60 Ga0105249_10103658 3300009553 Bacteria 2680
61 Ga0105249_10531912 3300009553 Bacteria 1224
62 Ga0105246_10398079 3300011119 Bacteria 1143
63 Ga0207653_10023629 3300025885 Bacteria 1959
64 Ga0207646_10675038 3300025922 Bacteria 925
65 Ga0207709_10010390 3300025935 Bacteria 5125
66 Ga0207712_10444588 3300025961 Bacteria 1098
67 Ga0207708_10081324 3300026075 Bacteria 2490
68 Ga0207676_10111075 3300026095 Bacteria 2294
69 Ga0207674_10069620 3300026116 Bacteria 3539
70 Ga0207674_10627949 3300026116 Bacteria 1037
71 Ga0207675_100027775 3300026118 Bacteria 5271
72 Ga0268265_10022120 3300028380 Bacteria 4463
73 Ga0268265_10352616 3300028380 Bacteria 1344
74 Ga0268264_10483824 3300028381 Bacteria 1204
75 Ga0265323_10027288 3300028653 Bacteria 2145
76 Ga0265327_10024494 3300031251 Unclassified 3545
77 Ga0316575_10002023 3300031665 Bacteria 6736
78 Ga0316575_10002441 3300031665 Bacteria 6237
79 Ga0316575_10019988 3300031665 Bacteria 2565
80 Ga0316579_10000962 3300031691 Bacteria 10086
81 Ga0316579_10024481 3300031691 Bacteria 2719
82 Ga0316579_10179753 3300031691 Bacteria 1023
83 Ga0316576_10029728 3300031727 Bacteria 3865
84 Ga0316576_10082520 3300031727 Bacteria 2387
85 Ga0316576_10205552 3300031727 Bacteria 1483
86 Ga0316578_10005622 3300031728 Bacteria 6102
87 Ga0316578_10024751 3300031728 Bacteria 3370
88 Ga0316578_10038029 3300031728 Bacteria 2774
89 Ga0316578_10088198 3300031728 Bacteria 1851
90 Ga0316577_10000311 3300031733 Bacteria 17784
91 Ga0316577_10003396 3300031733 Bacteria 8034
92 Ga0316577_10008722 3300031733 Bacteria 5435
93 Ga0316577_10011365 3300031733 Bacteria 4822
94 Ga0316577_10136940 3300031733 Bacteria 1379
95 Ga0316577_10242806 3300031733 Bacteria 1019
96 Ga0307410_10071579 3300031852 Bacteria 2405
97 Ga0307410_10136975 3300031852 Bacteria 1806
98 Ga0307409_100079865 3300031995 Bacteria 2638
99 Ga0307409_100409907 3300031995 Bacteria 1297
100 Ga0307414_10106960 3300032004 Bacteria 2119
101 Ga0307415_100377281 3300032126 Bacteria 1203
102 Ga0316585_10017309 3300032137 Bacteria 2179
103 Ga0316593_10000039 3300032168 Bacteria 14170
104 Ga0316593_10000857 3300032168 Bacteria 6157
105 Ga0316593_10004022 3300032168 Bacteria 3720
106 Ga0316593_10071245 3300032168 Bacteria 1202
107 Ga0316592_1003188 3300033524 Bacteria 2928
108 Ga0316592_1004409 3300033524 Bacteria 2614
109 Ga0316596_1021741 3300033541 Bacteria 1637
110 Ga0316574_0000425 3300035398 Bacteria 16756
111 Ga0316574_0014265 3300035398 Unclassified 4586
112 Ga0316574_0019937 3300035398 Bacteria 3964
113 Ga0373933_0027218 3300035724 Bacteria 3290
114 Ga0316582_0014423 3300036647 Bacteria 4483
115 Ga0316582_0019782 3300036647 Bacteria 3947
116 Ga0316582_0067521 3300036647 Bacteria 2307
117 Ga0316582_0216713 3300036647 Unclassified 1308
118 Ga0316582_0258162 3300036647 Bacteria 1195
119 Ga0316584_0004995 3300036712 Bacteria 8838
120 Ga0316584_0030879 3300036712 Bacteria 3960
121 Ga0316584_0078486 3300036712 Bacteria 2473
122 Ga0316584_0217443 3300036712 Unclassified 1405
123 Ga0316584_0222723 3300036712 Bacteria 1385
124 Ga0316584_0290142 3300036712 Bacteria 1187
125 Ga0316584_0581414 3300036712 Unclassified 779
126 Ga0316581_0006337 3300037588 Bacteria 3125
127 Ga0316581_0135797 3300037588 Bacteria 758
128 Ga0451577_0011670 3300042876 Bacteria 8296
129 Ga0451577_0012554 3300042876 Bacteria 7954
130 Ga0451577_0034462 3300042876 Bacteria 4563
131 Ga0451577_0047798 3300042876 Bacteria 3824
132 Ga0451577_0067585 3300042876 Bacteria 3188
133 Ga0451577_0111113 3300042876 Bacteria 2452
134 Ga0451577_0118808 3300042876 Bacteria 2368
135 Ga0451577_0179384 3300042876 Bacteria 1909
136 Ga0451577_0250154 3300042876 Bacteria 1604
137 Ga0451577_0294731 3300042876 Unclassified 1470
138 Ga0466969_0000290 3300044656 Bacteria 27417
139 Ga0453683_0003998 3300044673 Bacteria 10656
140 Ga0453683_0022033 3300044673 Bacteria 4064
141 Ga0453683_0040096 3300044673 Bacteria 2941
142 Ga0453683_0046261 3300044673 Bacteria 2728
143 Ga0453683_0060281 3300044673 Bacteria 2373
144 Ga0453683_0147546 3300044673 Bacteria 1485
145 Ga0466966_0088492 3300044684 Bacteria 1924
146 Ga0466964_0003615 3300044706 Bacteria 5650
147 Ga0453684_0000055 3300044712 Bacteria 532014
148 Ga0453684_0000171 3300044712 Bacteria 286600
149 Ga0453684_0000420 3300044712 Bacteria 172995
150 Ga0453684_0000588 3300044712 Bacteria 135201
151 Ga0453684_0001812 3300044712 Bacteria 56542
152 Ga0453684_0001835 3300044712 Bacteria 55524
153 Ga0453684_0006496 3300044712 Bacteria 22177
154 Ga0453684_0009135 3300044712 Bacteria 17453
155 Ga0453684_0009163 3300044712 Bacteria 17409
156 Ga0453684_0016436 3300044712 Bacteria 11569
157 Ga0453684_0020668 3300044712 Bacteria 9906
158 Ga0453684_0025508 3300044712 Bacteria 8578
159 Ga0453684_0029003 3300044712 Bacteria 7874
160 Ga0453684_0029664 3300044712 Bacteria 7756
161 Ga0453684_0035054 3300044712 Bacteria 6947
162 Ga0453684_0039050 3300044712 Bacteria 6474
163 Ga0453684_0056610 3300044712 Bacteria 5084
164 Ga0453684_0087420 3300044712 Bacteria 3863
165 Ga0453684_0095425 3300044712 Bacteria 3655
166 Ga0453684_0099395 3300044712 Bacteria 3564
167 Ga0453684_0109000 3300044712 Bacteria 3369
168 Ga0453684_0111974 3300044712 Bacteria 3314
169 Ga0453684_0117054 3300044712 Bacteria 3225
170 Ga0453684_0118329 3300044712 Bacteria 3204
171 Ga0453684_0141210 3300044712 Bacteria 2876
172 Ga0453684_0149789 3300044712 Bacteria 2774
173 Ga0453684_0193205 3300044712 Bacteria 2379
174 Ga0453684_0227762 3300044712 Bacteria 2154
175 Ga0453684_0230148 3300044712 Unclassified 2140
176 Ga0453684_0251974 3300044712 Bacteria 2027
177 Ga0453684_0288302 3300044712 Bacteria 1870
178 Ga0453684_0312693 3300044712 Bacteria 1782
179 Ga0453684_0338632 3300044712 Bacteria 1699
180 Ga0453684_0376061 3300044712 Bacteria 1596
181 Ga0453684_0377789 3300044712 Bacteria 1592
182 Ga0453684_0412012 3300044712 Bacteria 1511
183 Ga0453684_0437333 3300044712 Unclassified 1458
184 Ga0453684_0486268 3300044712 Bacteria 1369
185 Ga0453684_1097546 3300044712 Bacteria 841
186 Ga0466968_0000119 3300044735 Bacteria 23238
187 Ga0466970_0012029 3300044765 Bacteria 4419
188 Ga0466959_0037134 3300045049 Bacteria 3599
189 Ga0451576_0000454 3300045051 Bacteria 93047
190 Ga0451576_0016407 3300045051 Bacteria 8175
191 Ga0451576_0021771 3300045051 Bacteria 6959
192 Ga0451576_0029700 3300045051 Bacteria 5848
193 Ga0451576_0484285 3300045051 Bacteria 1299
194 Ga0451576_0800817 3300045051 Bacteria 989
195 Ga0501298_006681 3300049521 Bacteria 1893
196 Ga0501034_0433787 3300049571 Unclassified 1233
197 Ga0501036_0307045 3300049572 Bacteria 1327
198 Ga0501037_0025077 3300049573 Bacteria 4406
199 Ga0501038_0069858 3300049574 Bacteria 2983
200 Ga0501042_0190663 3300049578 Bacteria 1479
201 Ga0501073_0272348 3300049589 Bacteria 1168
202 Ga0501073_0283449 3300049589 Bacteria 1143
203 Ga0501074_0194028 3300049590 Unclassified 1448
204 Ga0501075_0342757 3300049591 Bacteria 1139
205 Ga0501075_0414310 3300049591 Bacteria 1027
206 Ga0501076_0393321 3300049592 Bacteria 1140
207 Ga0501076_0426631 3300049592 Bacteria 1091
208 Ga0501076_0451010 3300049592 Bacteria 1059
209 Ga0501080_0061189 3300049742 Bacteria 3506
210 Ga0501283_002324 3300049779 Bacteria 2470
211 Ga0501044_0004173 3300049823 Bacteria 16242
212 nmdc:mga05p37_101412_c1 3300050507 Bacteria 3545
213 nmdc:mga05p37_284897_c1 3300050507 Bacteria 1969
214 nmdc:mga05p37_384731_c1 3300050507 Bacteria 1643
215 nmdc:mga05p37_4654_c1 3300050507 Bacteria 16043
216 nmdc:mga05p37_734893_c1 3300050507 Bacteria 1091
217 nmdc:mga05p37_9621_c1 3300050507 Bacteria 11450
218 nmdc:mga09592_44597_c1 3300050508 Bacteria 3734
219 nmdc:mga09592_52871_c1 3300050508 Bacteria 3428
220 nmdc:mga09592_56363_c1 3300050508 Bacteria 3321
221 nmdc:mga09592_75234_c1 3300050508 Bacteria 2870
222 nmdc:mga0qj67_191663_c1 3300050509 Bacteria 1661
223 nmdc:mga0qj67_424177_c1 3300050509 Unclassified 1072
224 nmdc:mga0qj67_424703_c1 3300050509 Bacteria 1071
225 nmdc:mga0n895_43422_c1 3300050512 Bacteria 4380
226 nmdc:mga0a205_51988_c1 3300050515 Bacteria 3955
227 nmdc:mga0a205_73408_c1 3300050515 Bacteria 3305
228 Ga0501084_0002468 3300054114 Bacteria 14896
229 Ga0501084_0426226 3300054114 Bacteria 1121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0258162 Ga0316582_0258162_509_1147 211
2 3300037588 Ga0316581_0135797 Ga0316581_0135797_45_746 225
3 3300005518 Ga0070699_100002160 Ga0070699_10000216010 226
4 3300031727 Ga0316576_10205552 Ga0316576_102055522 229
5 3300031728 Ga0316578_10038029 Ga0316578_100380293 236
6 3300031733 Ga0316577_10011365 Ga0316577_100113653 236
7 3300031733 Ga0316577_10003396 Ga0316577_1000339611 238
8 3300036712 Ga0316584_0581414 Ga0316584_0581414_33_752 238
9 3300005289 Ga0065704_10102819 Ga0065704_101028192 239
10 3300005468 Ga0070707_100082099 Ga0070707_1000820993 239
11 3300005518 Ga0070699_100134553 Ga0070699_1001345533 239
12 3300005546 Ga0070696_100309268 Ga0070696_1003092681 239
13 3300005843 Ga0068860_100416031 Ga0068860_1004160312 239
14 3300006847 Ga0075431_100260968 Ga0075431_1002609683 239
15 3300009094 Ga0111539_10024178 Ga0111539_100241782 239
16 3300011119 Ga0105246_10398079 Ga0105246_103980792 239
17 3300028381 Ga0268264_10483824 Ga0268264_104838242 239
18 3300044712 Ga0453684_0109000 Ga0453684_0109000_2620_3339 239
19 3300044712 Ga0453684_0437333 Ga0453684_0437333_727_1446 239
20 3300045051 Ga0451576_0484285 Ga0451576_0484285_548_1267 239
21 3300049521 Ga0501298_006681 Ga0501298_006681_1135_1854 239
22 3300050509 nmdc:mga0qj67_424703_c1 nmdc:mga0qj67_424703_c1_44_763 239
23 3300036712 Ga0316584_0217443 Ga0316584_0217443_510_1283 241
24 3300031665 Ga0316575_10019988 Ga0316575_100199882 243
25 3300031691 Ga0316579_10000962 Ga0316579_100009623 243
26 3300031728 Ga0316578_10024751 Ga0316578_100247516 243
27 3300031733 Ga0316577_10000311 Ga0316577_1000031122 243
28 3300032137 Ga0316585_10017309 Ga0316585_100173093 243
29 3300035398 Ga0316574_0019937 Ga0316574_0019937_2228_3004 244
30 3300036647 Ga0316582_0014423 Ga0316582_0014423_1979_2755 244
31 3300036712 Ga0316584_0004995 Ga0316584_0004995_1498_2274 244
32 3300042876 Ga0451577_0067585 Ga0451577_0067585_1494_2294 245
33 3300042876 Ga0451577_0111113 Ga0451577_0111113_1079_1891 245
34 3300044712 Ga0453684_0001812 Ga0453684_0001812_4687_5499 245
35 3300044712 Ga0453684_0095425 Ga0453684_0095425_2446_3258 245
36 3300044712 Ga0453684_0377789 Ga0453684_0377789_231_1043 245
37 3300045051 Ga0451576_0021771 Ga0451576_0021771_5028_5828 245
38 3300036647 Ga0316582_0019782 Ga0316582_0019782_2385_3152 246
39 3300042876 Ga0451577_0179384 Ga0451577_0179384_224_1057 246
40 3300044712 Ga0453684_0016436 Ga0453684_0016436_1400_2233 246
41 3300031733 Ga0316577_10008722 Ga0316577_100087227 248
42 3300036647 Ga0316582_0067521 Ga0316582_0067521_80_853 248
43 3300042876 Ga0451577_0294731 Ga0451577_0294731_59_880 248
44 3300044712 Ga0453684_0009163 Ga0453684_0009163_4894_5715 248
45 3300005436 Ga0070713_100110140 Ga0070713_1001101403 250
46 3300032126 Ga0307415_100377281 Ga0307415_1003772811 250
47 3300049571 Ga0501034_0433787 Ga0501034_0433787_104_895 250
48 3300049573 Ga0501037_0025077 Ga0501037_0025077_1739_2530 250
49 3300049574 Ga0501038_0069858 Ga0501038_0069858_444_1235 250
50 3300049823 Ga0501044_0004173 Ga0501044_0004173_9485_10276 250
51 3300006852 Ga0075433_10031573 Ga0075433_100315733 251
52 3300006871 Ga0075434_100065414 Ga0075434_1000654143 251
53 3300044656 Ga0466969_0000290 Ga0466969_0000290_26495_27292 251
54 3300044684 Ga0466966_0088492 Ga0466966_0088492_112_909 251
55 3300044706 Ga0466964_0003615 Ga0466964_0003615_110_907 251
56 3300044712 Ga0453684_0486268 Ga0453684_0486268_397_1221 251
57 3300044735 Ga0466968_0000119 Ga0466968_0000119_22331_23128 251
58 3300044765 Ga0466970_0012029 Ga0466970_0012029_1017_1814 251
59 3300045049 Ga0466959_0037134 Ga0466959_0037134_103_900 251
60 3300050512 nmdc:mga0n895_43422_c1 nmdc:mga0n895_43422_c1_1761_2531 251
61 3300050515 nmdc:mga0a205_51988_c1 nmdc:mga0a205_51988_c1_2271_3041 251
62 3300035724 Ga0373933_0027218 Ga0373933_0027218_2298_3107 252
63 3300049589 Ga0501073_0272348 Ga0501073_0272348_250_1017 254
64 3300054114 Ga0501084_0002468 Ga0501084_0002468_2196_2963 254
65 3300028653 Ga0265323_10027288 Ga0265323_100272884 255
66 3300031665 Ga0316575_10002023 Ga0316575_100020237 255
67 3300031665 Ga0316575_10002441 Ga0316575_100024412 255
68 3300031727 Ga0316576_10029728 Ga0316576_100297284 255
69 3300031727 Ga0316576_10082520 Ga0316576_100825202 255
70 3300031728 Ga0316578_10088198 Ga0316578_100881983 255
71 3300031733 Ga0316577_10136940 Ga0316577_101369402 255
72 3300031733 Ga0316577_10242806 Ga0316577_102428061 255
73 3300032168 Ga0316593_10004022 Ga0316593_100040225 255
74 3300032168 Ga0316593_10071245 Ga0316593_100712451 255
75 3300033524 Ga0316592_1003188 Ga0316592_10031885 255
76 3300035398 Ga0316574_0000425 Ga0316574_0000425_12029_12802 255
77 3300035398 Ga0316574_0014265 Ga0316574_0014265_2847_3617 255
78 3300036712 Ga0316584_0078486 Ga0316584_0078486_351_1118 255
79 3300036712 Ga0316584_0222723 Ga0316584_0222723_42_812 255
80 3300036712 Ga0316584_0290142 Ga0316584_0290142_119_892 255
81 3300044673 Ga0453683_0147546 Ga0453683_0147546_330_1136 255
82 3300044712 Ga0453684_0029003 Ga0453684_0029003_6149_6961 255
83 3300044712 Ga0453684_0035054 Ga0453684_0035054_5312_6079 255
84 3300044712 Ga0453684_0312693 Ga0453684_0312693_672_1478 255
85 3300003203 JGI25406J46586_10002232 JGI25406J46586_1000223211 256
86 3300005289 Ga0065704_10070890 Ga0065704_100708905 256
87 3300005289 Ga0065704_10123953 Ga0065704_101239532 256
88 3300005295 Ga0065707_10082110 Ga0065707_1008211021 256
89 3300005295 Ga0065707_10083718 Ga0065707_100837182 256
90 3300005295 Ga0065707_10122843 Ga0065707_101228433 256
91 3300005295 Ga0065707_10245975 Ga0065707_102459751 256
92 3300005340 Ga0070689_100007346 Ga0070689_1000073466 256
93 3300005340 Ga0070689_100192364 Ga0070689_1001923642 256
94 3300005341 Ga0070691_10132091 Ga0070691_101320911 256
95 3300005440 Ga0070705_100320393 Ga0070705_1003203932 256
96 3300005441 Ga0070700_100014148 Ga0070700_1000141484 256
97 3300005471 Ga0070698_100026205 Ga0070698_10002620510 256
98 3300005471 Ga0070698_100044535 Ga0070698_1000445353 256
99 3300005471 Ga0070698_100184782 Ga0070698_1001847823 256
100 3300005518 Ga0070699_100048913 Ga0070699_1000489133 256
101 3300005545 Ga0070695_100038518 Ga0070695_1000385185 256
102 3300005545 Ga0070695_100276394 Ga0070695_1002763942 256
103 3300005546 Ga0070696_100126385 Ga0070696_1001263852 256
104 3300005577 Ga0068857_100493186 Ga0068857_1004931862 256
105 3300005617 Ga0068859_100017341 Ga0068859_1000173419 256
106 3300005719 Ga0068861_100159237 Ga0068861_1001592373 256
107 3300005844 Ga0068862_100041868 Ga0068862_1000418684 256
108 3300005844 Ga0068862_100144333 Ga0068862_1001443333 256
109 3300005985 Ga0081539_10003413 Ga0081539_1000341313 256
110 3300006194 Ga0075427_10000132 Ga0075427_100001326 256
111 3300006844 Ga0075428_100004783 Ga0075428_10000478310 256
112 3300006844 Ga0075428_100006904 Ga0075428_10000690425 256
113 3300006846 Ga0075430_100084328 Ga0075430_1000843282 256
114 3300006846 Ga0075430_100251938 Ga0075430_1002519382 256
115 3300006846 Ga0075430_100350117 Ga0075430_1003501172 256
116 3300006847 Ga0075431_100003767 Ga0075431_10000376716 256
117 3300006847 Ga0075431_100506634 Ga0075431_1005066342 256
118 3300006880 Ga0075429_100020300 Ga0075429_1000203009 256
119 3300006880 Ga0075429_100087873 Ga0075429_1000878731 256
120 3300006880 Ga0075429_100117869 Ga0075429_1001178694 256
121 3300006880 Ga0075429_100187646 Ga0075429_1001876462 256
122 3300006880 Ga0075429_100261893 Ga0075429_1002618932 256
123 3300006931 Ga0097620_100017341 Ga0097620_1000173419 256
124 3300009147 Ga0114129_10002710 Ga0114129_1000271016 256
125 3300009147 Ga0114129_10011857 Ga0114129_1001185725 256
126 3300009147 Ga0114129_10017603 Ga0114129_1001760312 256
127 3300009147 Ga0114129_10031086 Ga0114129_100310864 256
128 3300009147 Ga0114129_10031948 Ga0114129_1003194810 256
129 3300009147 Ga0114129_10101811 Ga0114129_101018116 256
130 3300009147 Ga0114129_10371324 Ga0114129_103713243 256
131 3300009148 Ga0105243_10003080 Ga0105243_100030805 256
132 3300009148 Ga0105243_10717467 Ga0105243_107174672 256
133 3300009553 Ga0105249_10103658 Ga0105249_101036584 256
134 3300009553 Ga0105249_10531912 Ga0105249_105319122 256
135 3300025885 Ga0207653_10023629 Ga0207653_100236293 256
136 3300025922 Ga0207646_10675038 Ga0207646_106750382 256
137 3300025935 Ga0207709_10010390 Ga0207709_100103903 256
138 3300025961 Ga0207712_10444588 Ga0207712_104445882 256
139 3300026075 Ga0207708_10081324 Ga0207708_100813243 256
140 3300026095 Ga0207676_10111075 Ga0207676_101110753 256
141 3300026116 Ga0207674_10069620 Ga0207674_100696202 256
142 3300026116 Ga0207674_10627949 Ga0207674_106279492 256
143 3300026118 Ga0207675_100027775 Ga0207675_1000277753 256
144 3300028380 Ga0268265_10022120 Ga0268265_100221205 256
145 3300028380 Ga0268265_10352616 Ga0268265_103526162 256
146 3300031251 Ga0265327_10024494 Ga0265327_100244944 256
147 3300031691 Ga0316579_10024481 Ga0316579_100244814 256
148 3300031691 Ga0316579_10179753 Ga0316579_101797532 256
149 3300031728 Ga0316578_10005622 Ga0316578_100056227 256
150 3300031852 Ga0307410_10071579 Ga0307410_100715793 256
151 3300031852 Ga0307410_10136975 Ga0307410_101369752 256
152 3300031995 Ga0307409_100079865 Ga0307409_1000798652 256
153 3300031995 Ga0307409_100409907 Ga0307409_1004099072 256
154 3300032004 Ga0307414_10106960 Ga0307414_101069602 256
155 3300032168 Ga0316593_10000039 Ga0316593_100000398 256
156 3300032168 Ga0316593_10000857 Ga0316593_100008577 256
157 3300033524 Ga0316592_1004409 Ga0316592_10044094 256
158 3300033541 Ga0316596_1021741 Ga0316596_10217412 256
159 3300036647 Ga0316582_0216713 Ga0316582_0216713_381_1151 256
160 3300036712 Ga0316584_0030879 Ga0316584_0030879_3136_3906 256
161 3300037588 Ga0316581_0006337 Ga0316581_0006337_670_1440 256
162 3300042876 Ga0451577_0011670 Ga0451577_0011670_2724_3494 256
163 3300042876 Ga0451577_0012554 Ga0451577_0012554_5253_6068 256
164 3300042876 Ga0451577_0034462 Ga0451577_0034462_1010_1780 256
165 3300042876 Ga0451577_0047798 Ga0451577_0047798_2215_2985 256
166 3300042876 Ga0451577_0118808 Ga0451577_0118808_571_1341 256
167 3300042876 Ga0451577_0250154 Ga0451577_0250154_50_820 256
168 3300044673 Ga0453683_0003998 Ga0453683_0003998_1360_2130 256
169 3300044673 Ga0453683_0022033 Ga0453683_0022033_1552_2322 256
170 3300044673 Ga0453683_0040096 Ga0453683_0040096_281_1072 256
171 3300044673 Ga0453683_0046261 Ga0453683_0046261_1509_2279 256
172 3300044673 Ga0453683_0060281 Ga0453683_0060281_892_1662 256
173 3300044712 Ga0453684_0000055 Ga0453684_0000055_519652_520422 256
174 3300044712 Ga0453684_0000171 Ga0453684_0000171_11635_12405 256
175 3300044712 Ga0453684_0000420 Ga0453684_0000420_160586_161356 256
176 3300044712 Ga0453684_0000588 Ga0453684_0000588_11649_12419 256
177 3300044712 Ga0453684_0001835 Ga0453684_0001835_36631_37401 256
178 3300044712 Ga0453684_0006496 Ga0453684_0006496_20282_21109 256
179 3300044712 Ga0453684_0009135 Ga0453684_0009135_5047_5817 256
180 3300044712 Ga0453684_0020668 Ga0453684_0020668_5780_6550 256
181 3300044712 Ga0453684_0025508 Ga0453684_0025508_2599_3369 256
182 3300044712 Ga0453684_0029664 Ga0453684_0029664_5514_6284 256
183 3300044712 Ga0453684_0039050 Ga0453684_0039050_4560_5393 256
184 3300044712 Ga0453684_0056610 Ga0453684_0056610_757_1590 256
185 3300044712 Ga0453684_0087420 Ga0453684_0087420_2406_3176 256
186 3300044712 Ga0453684_0099395 Ga0453684_0099395_1678_2448 256
187 3300044712 Ga0453684_0111974 Ga0453684_0111974_683_1453 256
188 3300044712 Ga0453684_0117054 Ga0453684_0117054_1706_2476 256
189 3300044712 Ga0453684_0118329 Ga0453684_0118329_1419_2234 256
190 3300044712 Ga0453684_0141210 Ga0453684_0141210_697_1467 256
191 3300044712 Ga0453684_0149789 Ga0453684_0149789_67_837 256
192 3300044712 Ga0453684_0193205 Ga0453684_0193205_1451_2221 256
193 3300044712 Ga0453684_0227762 Ga0453684_0227762_1364_2137 256
194 3300044712 Ga0453684_0230148 Ga0453684_0230148_133_903 256
195 3300044712 Ga0453684_0251974 Ga0453684_0251974_206_976 256
196 3300044712 Ga0453684_0288302 Ga0453684_0288302_111_881 256
197 3300044712 Ga0453684_0338632 Ga0453684_0338632_588_1358 256
198 3300044712 Ga0453684_0376061 Ga0453684_0376061_325_1095 256
199 3300044712 Ga0453684_0412012 Ga0453684_0412012_368_1138 256
200 3300044712 Ga0453684_1097546 Ga0453684_1097546_17_787 256
201 3300045051 Ga0451576_0000454 Ga0451576_0000454_80078_80848 256
202 3300045051 Ga0451576_0016407 Ga0451576_0016407_4558_5328 256
203 3300045051 Ga0451576_0029700 Ga0451576_0029700_2685_3455 256
204 3300045051 Ga0451576_0800817 Ga0451576_0800817_132_902 256
205 3300049572 Ga0501036_0307045 Ga0501036_0307045_349_1119 256
206 3300049578 Ga0501042_0190663 Ga0501042_0190663_533_1303 256
207 3300049589 Ga0501073_0283449 Ga0501073_0283449_316_1086 256
208 3300049590 Ga0501074_0194028 Ga0501074_0194028_121_891 256
209 3300049591 Ga0501075_0342757 Ga0501075_0342757_11_781 256
210 3300049591 Ga0501075_0414310 Ga0501075_0414310_184_954 256
211 3300049592 Ga0501076_0393321 Ga0501076_0393321_122_892 256
212 3300049592 Ga0501076_0426631 Ga0501076_0426631_155_925 256
213 3300049592 Ga0501076_0451010 Ga0501076_0451010_89_859 256
214 3300049742 Ga0501080_0061189 Ga0501080_0061189_1593_2363 256
215 3300049779 Ga0501283_002324 Ga0501283_002324_499_1269 256
216 3300050507 nmdc:mga05p37_101412_c1 nmdc:mga05p37_101412_c1_362_1132 256
217 3300050507 nmdc:mga05p37_284897_c1 nmdc:mga05p37_284897_c1_1050_1820 256
218 3300050507 nmdc:mga05p37_384731_c1 nmdc:mga05p37_384731_c1_827_1597 256
219 3300050507 nmdc:mga05p37_4654_c1 nmdc:mga05p37_4654_c1_8356_9126 256
220 3300050507 nmdc:mga05p37_734893_c1 nmdc:mga05p37_734893_c1_166_936 256
221 3300050507 nmdc:mga05p37_9621_c1 nmdc:mga05p37_9621_c1_7765_8535 256
222 3300050508 nmdc:mga09592_44597_c1 nmdc:mga09592_44597_c1_2644_3414 256
223 3300050508 nmdc:mga09592_52871_c1 nmdc:mga09592_52871_c1_463_1233 256
224 3300050508 nmdc:mga09592_56363_c1 nmdc:mga09592_56363_c1_675_1445 256
225 3300050508 nmdc:mga09592_75234_c1 nmdc:mga09592_75234_c1_1335_2105 256
226 3300050509 nmdc:mga0qj67_191663_c1 nmdc:mga0qj67_191663_c1_128_898 256
227 3300050509 nmdc:mga0qj67_424177_c1 nmdc:mga0qj67_424177_c1_166_936 256
228 3300050515 nmdc:mga0a205_73408_c1 nmdc:mga0a205_73408_c1_1670_2440 256
229 3300054114 Ga0501084_0426226 Ga0501084_0426226_271_1041 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

16

248

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9863 6 256
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9824 6 256
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9727 6 255
3tav-assembly1.cif.gz_A crystal structure of a methionine aminopeptidase from mycobacterium abscessus 0.9717 7 255
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9692 6 255
ID Description Score Start End Superfamily
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9863 6 256 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9824 6 256 3.90.230.10
af_P9WK21_10_265_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9756 7 255 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9705 6 255 3.90.230.10
af_Q4VBS4_53_336_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9686 6 256 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A7C7DIY6-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9939 6 256 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A6F8M0A1-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9939 19 256 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A250IPK0-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9931 6 256 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A7C6TDM5-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9931 6 254 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A7Y6XSP4-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9929 6 254 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Feature Viewer

pLDDT pTM Quality
96.84 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map