F342136

General Info

Members Datasets Scaffolds Average Seq Length
229 171 224 333

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000005|Ga0265327_10000005515
Length 361
Sequence MQNPSTIQRSSLSVFLQESWYGSALWLQLLRPVSWLFRVLVFVRRSLYLRHRSNNPCSIPVIVVGNISVGGAGKTPLLMALAEELKRRGHRVGIVSRGYGGNAKRFPLRVDRNTSPELCGDEPAMMAQRLNIPVVVDPVRKNAVIEALGCASDYPCDVILSDDGLQHYAMPRDIEILVVDAERGFGNGLCLPAGPLREPLSRLRSVDFLVSNGPDSARKLPKQHTFASMMLKPSACVNVTTGERVSIEKFFRRQLVHAVAGIGNPQRFFQSLKDLGSQVIEHPFPDHYIYVPKDLHFGDALPVLMTEKDAVKCKNIPLRNAWYLEVNAVLPDSFYEAVINRLSSLQVARKIGVQRGLFDGH

Samples

Sample ID Description Type Environment
1 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
2 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
3 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
4 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
130 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 0.87
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.42
Nodule 0
Rhizoplane 4.37
Rhizosphere 85.15
Stem 0
Stem Tuber 0
Unclassified 3.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001210 3300002737 Bacteria 15021
2 JGI25162J39368_1001215 3300002737 Bacteria 14973
3 JGI25163J39215_1000510 3300002771 Bacteria 11476
4 JGI25164J39214_1000624 3300002772 Bacteria 14975
5 JGI25165J46597_1000467 3300003214 Bacteria 39971
6 Ga0055538_1000088 3300003751 Bacteria 78763
7 Ga0070676_10000409 3300005328 Bacteria 20112
8 Ga0070670_100109653 3300005331 Bacteria 2378
9 Ga0068869_100000798 3300005334 Bacteria 17966
10 Ga0068869_100038775 3300005334 Bacteria 3399
11 Ga0070666_10001270 3300005335 Bacteria 15257
12 Ga0070666_10013074 3300005335 Bacteria 5258
13 Ga0070666_10017801 3300005335 Bacteria 4559
14 Ga0070680_100160648 3300005336 Bacteria 1888
15 Ga0070680_100370071 3300005336 Bacteria 1219
16 Ga0070689_100106287 3300005340 Bacteria 2227
17 Ga0070687_100042256 3300005343 Bacteria 2309
18 Ga0070661_100007995 3300005344 Bacteria 7304
19 Ga0070668_100050779 3300005347 Bacteria 3194
20 Ga0070669_100001002 3300005353 Bacteria 20558
21 Ga0070675_100003433 3300005354 Bacteria 12004
22 Ga0070671_100008388 3300005355 Bacteria 8281
23 Ga0070671_100059140 3300005355 Bacteria 3189
24 Ga0070674_100096673 3300005356 Bacteria 2143
25 Ga0070673_100037989 3300005364 Bacteria 3673
26 Ga0070667_100002050 3300005367 Bacteria 17841
27 Ga0070667_100018398 3300005367 Bacteria 5795
28 Ga0070709_10043287 3300005434 Bacteria 2784
29 Ga0070713_100177900 3300005436 Bacteria 1910
30 Ga0070711_100101051 3300005439 Bacteria 2098
31 Ga0070708_100003166 3300005445 Bacteria 12831
32 Ga0070678_100015251 3300005456 Bacteria 4879
33 Ga0068867_100038368 3300005459 Bacteria 3487
34 Ga0070679_100145083 3300005530 Bacteria 2352
35 Ga0068853_100013178 3300005539 Bacteria 6748
36 Ga0068853_100030264 3300005539 Bacteria 4572
37 Ga0068853_100246869 3300005539 Bacteria 1637
38 Ga0070686_100202971 3300005544 Bacteria 1422
39 Ga0070695_100050148 3300005545 Bacteria 2674
40 Ga0070665_100028902 3300005548 Bacteria 5581
41 Ga0068855_100117883 3300005563 Bacteria 3041
42 Ga0068855_100472680 3300005563 Bacteria 1365
43 Ga0070664_100007865 3300005564 Bacteria 8612
44 Ga0068857_100016796 3300005577 Bacteria 6412
45 Ga0068854_100057304 3300005578 Bacteria 2810
46 Ga0068852_100165387 3300005616 Bacteria 2069
47 Ga0068859_100005483 3300005617 Bacteria 12916
48 Ga0068859_100044030 3300005617 Bacteria 4486
49 Ga0068864_100007975 3300005618 Bacteria 8728
50 Ga0068864_100011776 3300005618 Bacteria 7224
51 Ga0068864_100100071 3300005618 Bacteria 2569
52 Ga0068861_100021470 3300005719 Bacteria 4640
53 Ga0068851_10032997 3300005834 Bacteria 2578
54 Ga0068863_100002766 3300005841 Bacteria 17379
55 Ga0068863_100007862 3300005841 Bacteria 10425
56 Ga0068863_100021028 3300005841 Bacteria 6233
57 Ga0068858_100004446 3300005842 Bacteria 13740
58 Ga0068858_100011251 3300005842 Bacteria 8455
59 Ga0068860_100004132 3300005843 Bacteria 14876
60 Ga0068860_100019813 3300005843 Bacteria 6522
61 Ga0068860_100021377 3300005843 Bacteria 6266
62 Ga0068860_100115450 3300005843 Bacteria 2568
63 Ga0075367_10066316 3300006178 Bacteria 2163
64 Ga0097621_100002004 3300006237 Bacteria 13901
65 Ga0097621_100064761 3300006237 Bacteria 3007
66 Ga0068871_100001493 3300006358 Bacteria 15681
67 Ga0068871_100057763 3300006358 Bacteria 3157
68 Ga0075428_100000729 3300006844 Bacteria 34167
69 Ga0075428_100310847 3300006844 Bacteria 1694
70 Ga0075430_100012906 3300006846 Bacteria 7120
71 Ga0075431_100006916 3300006847 Bacteria 11276
72 Ga0075429_100010098 3300006880 Bacteria 8181
73 Ga0097620_100005484 3300006931 Bacteria 12916
74 Ga0097620_100044029 3300006931 Bacteria 4486
75 Ga0105240_10030417 3300009093 Bacteria 7018
76 Ga0105240_10060715 3300009093 Bacteria 4712
77 Ga0105240_10155188 3300009093 Bacteria 2723
78 Ga0111539_10044489 3300009094 Bacteria 5319
79 Ga0111539_10244958 3300009094 Bacteria 2087
80 Ga0105245_10205744 3300009098 Bacteria 1892
81 Ga0105247_10007270 3300009101 Bacteria 6802
82 Ga0105243_10084846 3300009148 Bacteria 2595
83 Ga0105241_10030001 3300009174 Bacteria 4061
84 Ga0105242_10120681 3300009176 Bacteria 2249
85 Ga0105242_10246733 3300009176 Bacteria 1607
86 Ga0105248_10004264 3300009177 Bacteria 15827
87 Ga0105248_10017821 3300009177 Bacteria 7837
88 Ga0105248_10105239 3300009177 Bacteria 3181
89 Ga0105237_10010061 3300009545 Bacteria 10089
90 Ga0105238_10012110 3300009551 Bacteria 8692
91 Ga0105238_10012954 3300009551 Bacteria 8418
92 Ga0105239_10018292 3300010375 Bacteria 7746
93 Ga0105239_10042897 3300010375 Bacteria 4956
94 Ga0105246_10085165 3300011119 Bacteria 2263
95 Ga0157370_10120929 3300013104 Bacteria 2445
96 Ga0157369_10002721 3300013105 Bacteria 21107
97 Ga0157374_10016651 3300013296 Bacteria 6466
98 Ga0157378_10342704 3300013297 Bacteria 1458
99 Ga0163162_10006034 3300013306 Bacteria 11728
100 Ga0163162_10029935 3300013306 Bacteria 5391
101 Ga0157372_10002373 3300013307 Bacteria 20377
102 Ga0157372_10044225 3300013307 Bacteria 4934
103 Ga0157375_10221933 3300013308 Bacteria 2048
104 Ga0163163_10005082 3300014325 Bacteria 11337
105 Ga0163163_10016778 3300014325 Bacteria 6815
106 Ga0163163_10019235 3300014325 Bacteria 6411
107 Ga0157380_10016332 3300014326 Bacteria 5473
108 Ga0157380_10096199 3300014326 Bacteria 2454
109 Ga0157379_10001305 3300014968 Bacteria 20314
110 Ga0157379_10009035 3300014968 Bacteria 8682
111 Ga0157379_10043631 3300014968 Bacteria 4004
112 Ga0157376_10350121 3300014969 Bacteria 1413
113 Ga0163161_10159301 3300017792 Bacteria 1721
114 Ga0209760_100269 3300025207 Bacteria 19191
115 Ga0207427_100008 3300025231 Bacteria 740731
116 Ga0209437_100014 3300025233 Bacteria 740714
117 Ga0209233_1000008 3300025261 Bacteria 1356712
118 Ga0207710_10024427 3300025900 Bacteria 2603
119 Ga0207680_10007767 3300025903 Bacteria 5240
120 Ga0207680_10040168 3300025903 Bacteria 2720
121 Ga0207699_10052963 3300025906 Bacteria 2405
122 Ga0207645_10010997 3300025907 Bacteria 6191
123 Ga0207707_10017944 3300025912 Bacteria 6169
124 Ga0207695_10001006 3300025913 Bacteria 49914
125 Ga0207695_10116570 3300025913 Bacteria 2644
126 Ga0207671_10007468 3300025914 Bacteria 9483
127 Ga0207663_10049963 3300025916 Bacteria 2597
128 Ga0207662_10145213 3300025918 Bacteria 1505
129 Ga0207657_10002920 3300025919 Bacteria 18349
130 Ga0207649_10002313 3300025920 Bacteria 10705
131 Ga0207652_10123730 3300025921 Bacteria 2303
132 Ga0207681_10004261 3300025923 Bacteria 8827
133 Ga0207681_10078762 3300025923 Bacteria 2320
134 Ga0207694_10008631 3300025924 Bacteria 7693
135 Ga0207650_10045296 3300025925 Bacteria 3236
136 Ga0207650_10058987 3300025925 Bacteria 2859
137 Ga0207659_10002846 3300025926 Bacteria 10316
138 Ga0207706_10043127 3300025933 Bacteria 3998
139 Ga0207706_10151510 3300025933 Bacteria 2039
140 Ga0207670_10190478 3300025936 Bacteria 1552
141 Ga0207691_10001585 3300025940 Bacteria 22586
142 Ga0207711_10049699 3300025941 Bacteria 3590
143 Ga0207689_10001604 3300025942 Bacteria 21396
144 Ga0207689_10059859 3300025942 Bacteria 3132
145 Ga0207689_10083215 3300025942 Bacteria 2631
146 Ga0207661_10092697 3300025944 Bacteria 2519
147 Ga0207667_10105587 3300025949 Bacteria 2906
148 Ga0207668_10003044 3300025972 Bacteria 9827
149 Ga0207640_10032197 3300025981 Bacteria 3249
150 Ga0207677_10020838 3300026023 Bacteria 3992
151 Ga0207703_10065910 3300026035 Bacteria 2977
152 Ga0207639_10001736 3300026041 Bacteria 14682
153 Ga0207639_10012116 3300026041 Bacteria 6000
154 Ga0207639_10048285 3300026041 Bacteria 3221
155 Ga0207678_10146866 3300026067 Bacteria 2013
156 Ga0207702_10211786 3300026078 Bacteria 1802
157 Ga0207641_10002861 3300026088 Bacteria 15679
158 Ga0207648_10000126 3300026089 Bacteria 75403
159 Ga0207648_10134607 3300026089 Bacteria 2176
160 Ga0207676_10070256 3300026095 Bacteria 2807
161 Ga0207674_10004736 3300026116 Bacteria 16310
162 Ga0207675_100062301 3300026118 Bacteria 3483
163 Ga0207683_10001731 3300026121 Bacteria 19437
164 Ga0207698_10084114 3300026142 Bacteria 2578
165 Ga0207698_10119877 3300026142 Bacteria 2224
166 Ga0268266_10021476 3300028379 Bacteria 5499
167 Ga0268266_10038129 3300028379 Bacteria 4092
168 Ga0268264_10010635 3300028381 Bacteria 7603
169 Ga0268264_10141054 3300028381 Bacteria 2149
170 Ga0265334_10000097 3300028573 Bacteria 61159
171 Ga0265327_10000005 3300031251 Bacteria 790146
172 Ga0307408_100273690 3300031548 Bacteria 1403
173 Ga0316579_10003608 3300031691 Bacteria 6073
174 Ga0316578_10025775 3300031728 Bacteria 3309
175 Ga0307414_10286386 3300032004 Bacteria 1387
176 Ga0316583_10008839 3300032133 Bacteria 3632
177 Ga0316593_10000283 3300032168 Bacteria 8557
178 Ga0307510_10264833 3300033180 Bacteria 1198
179 Ga0316596_1001080 3300033541 Bacteria 5288
180 Ga0373924_0032199 3300035410 Bacteria 2112
181 Ga0373937_0005402 3300036401 Bacteria 10934
182 Ga0373937_0039259 3300036401 Bacteria 4315
183 Ga0316582_0070978 3300036647 Bacteria 2254
184 Ga0395900_0001450 3300037418 Bacteria 28297
185 Ga0316581_0009343 3300037588 Bacteria 2692
186 Ga0436364_1336806 3300037853 Bacteria 2986
187 Ga0400483_105831 3300039062 Bacteria 8934
188 Ga0436361_0265002 3300039447 Bacteria 2196
189 Ga0453684_0002052 3300044712 Bacteria 51252
190 Ga0451576_0093339 3300045051 Bacteria 3129
191 Ga0495640_0203788 3300046533 Bacteria 1253
192 Ga0495604_0238403 3300047317 Bacteria 1245
193 Ga0495673_0121628 3300047469 Bacteria 1033
194 Ga0496104_0001671 3300048907 Bacteria 19141
195 Ga0496104_0049451 3300048907 Bacteria 3965
196 Ga0496105_0000293 3300048908 Bacteria 32964
197 Ga0496107_0037951 3300048910 Bacteria 3458
198 Ga0496107_0070668 3300048910 Bacteria 2535
199 Ga0496109_0152725 3300048912 Bacteria 2162
200 Ga0496112_0012599 3300048915 Bacteria 7771
201 Ga0496114_0000240 3300048917 Bacteria 39991
202 Ga0496115_0001302 3300048918 Bacteria 17773
203 Ga0496115_0197253 3300048918 Bacteria 1663
204 Ga0501034_0176995 3300049571 Bacteria 2099
205 Ga0501036_0329264 3300049572 Bacteria 1276
206 Ga0501046_0081200 3300049580 Bacteria 2504
207 Ga0501047_0462572 3300049581 Bacteria 1097
208 Ga0501067_0124952 3300049583 Bacteria 1432
209 Ga0501080_0127271 3300049742 Bacteria 2358
210 Ga0501044_0000112 3300049823 Bacteria 98748
211 nmdc:mga03683_61668_c1 3300050489 Bacteria 1586
212 nmdc:mga09592_31385_c1 3300050508 Bacteria 4427
213 nmdc:mga0qj67_71655_c1 3300050509 Bacteria 2766
214 nmdc:mga06r32_18886_c1 3300050510 Bacteria 6320
215 nmdc:mga08y16_29234_c1 3300050511 Bacteria 5808
216 nmdc:mga08y16_78786_c1 3300050511 Bacteria 3435
217 Ga0495601_0009294 3300053077 Bacteria 5812
218 Ga0500556_0002389 3300053104 Bacteria 6064
219 Ga0500568_0009284 3300053139 Bacteria 4685
220 Ga0500568_0066804 3300053139 Bacteria 1382
221 Ga0500622_0021842 3300053156 Bacteria 3395
222 Ga0500622_0062581 3300053156 Bacteria 1895
223 Ga0501084_0075350 3300054114 Bacteria 2827
224 Ga0501082_0395228 3300060353 Bacteria 1206

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0462572 Ga0501047_0462572_206_1072 262
2 3300049580 Ga0501046_0081200 Ga0501046_0081200_19_888 263
3 3300047317 Ga0495604_0238403 Ga0495604_0238403_352_1224 271
4 3300060353 Ga0501082_0395228 Ga0501082_0395228_311_1195 277
5 3300047469 Ga0495673_0121628 Ga0495673_0121628_23_937 288
6 3300050489 nmdc:mga03683_61668_c1 nmdc:mga03683_61668_c1_646_1560 288
7 3300005617 Ga0068859_100005483 Ga0068859_1000054835 289
8 3300005618 Ga0068864_100011776 Ga0068864_1000117767 289
9 3300005719 Ga0068861_100021470 Ga0068861_1000214706 289
10 3300005841 Ga0068863_100007862 Ga0068863_1000078625 289
11 3300005843 Ga0068860_100019813 Ga0068860_1000198136 289
12 3300006237 Ga0097621_100002004 Ga0097621_10000200412 289
13 3300006358 Ga0068871_100001493 Ga0068871_1000014937 289
14 3300006931 Ga0097620_100005484 Ga0097620_10000548410 289
15 3300025907 Ga0207645_10010997 Ga0207645_100109976 289
16 3300025923 Ga0207681_10004261 Ga0207681_100042616 289
17 3300025925 Ga0207650_10058987 Ga0207650_100589873 289
18 3300025926 Ga0207659_10002846 Ga0207659_100028461 289
19 3300025940 Ga0207691_10001585 Ga0207691_1000158513 289
20 3300025942 Ga0207689_10001604 Ga0207689_1000160410 289
21 3300025972 Ga0207668_10003044 Ga0207668_100030447 289
22 3300026023 Ga0207677_10020838 Ga0207677_100208383 289
23 3300026035 Ga0207703_10065910 Ga0207703_100659103 289
24 3300026041 Ga0207639_10048285 Ga0207639_100482853 289
25 3300026067 Ga0207678_10146866 Ga0207678_101468663 289
26 3300026088 Ga0207641_10002861 Ga0207641_1000286114 289
27 3300026089 Ga0207648_10000126 Ga0207648_1000012645 289
28 3300026121 Ga0207683_10001731 Ga0207683_100017316 289
29 3300028379 Ga0268266_10038129 Ga0268266_100381293 289
30 3300044712 Ga0453684_0002052 Ga0453684_0002052_37207_38295 293
31 3300049823 Ga0501044_0000112 Ga0501044_0000112_77062_78081 293
32 3300031548 Ga0307408_100273690 Ga0307408_1002736902 294
33 3300039062 Ga0400483_105831 Ga0400483_105831_323_1270 296
34 iso_pu_bacteria 2842837860 2842841996 298
35 iso_pu_bacteria 2744054655 2745160189 300
36 iso_pu_bacteria 8033232454 8033232743 302
37 iso_pu_bacteria 2919506607 2919507817 303
38 3300028573 Ga0265334_10000097 Ga0265334_1000009717 306
39 3300037418 Ga0395900_0001450 Ga0395900_0001450_7426_8406 306
40 3300037853 Ga0436364_1336806 Ga0436364_1336806_129_1151 307
41 3300005331 Ga0070670_100109653 Ga0070670_1001096533 308
42 3300006846 Ga0075430_100012906 Ga0075430_1000129065 308
43 3300006847 Ga0075431_100006916 Ga0075431_1000069165 308
44 3300025923 Ga0207681_10078762 Ga0207681_100787623 308
45 3300025925 Ga0207650_10045296 Ga0207650_100452963 308
46 3300050508 nmdc:mga09592_31385_c1 nmdc:mga09592_31385_c1_3372_4358 308
47 3300050510 nmdc:mga06r32_18886_c1 nmdc:mga06r32_18886_c1_3242_4228 308
48 3300006178 Ga0075367_10066316 Ga0075367_100663162 309
49 3300032004 Ga0307414_10286386 Ga0307414_102863862 309
50 3300053104 Ga0500556_0002389 Ga0500556_0002389_58_1032 309
51 3300046533 Ga0495640_0203788 Ga0495640_0203788_71_1093 312
52 3300005344 Ga0070661_100007995 Ga0070661_1000079952 313
53 3300005539 Ga0068853_100013178 Ga0068853_1000131786 313
54 3300005578 Ga0068854_100057304 Ga0068854_1000573043 313
55 3300005843 Ga0068860_100115450 Ga0068860_1001154502 313
56 3300009093 Ga0105240_10030417 Ga0105240_100304172 313
57 3300009093 Ga0105240_10155188 Ga0105240_101551883 313
58 3300009174 Ga0105241_10030001 Ga0105241_100300012 313
59 3300009177 Ga0105248_10004264 Ga0105248_1000426411 313
60 3300009545 Ga0105237_10010061 Ga0105237_100100613 313
61 3300009551 Ga0105238_10012110 Ga0105238_100121105 313
62 3300013105 Ga0157369_10002721 Ga0157369_1000272112 313
63 3300013307 Ga0157372_10002373 Ga0157372_100023735 313
64 3300013308 Ga0157375_10221933 Ga0157375_102219332 313
65 3300025913 Ga0207695_10001006 Ga0207695_1000100643 313
66 3300025913 Ga0207695_10116570 Ga0207695_101165703 313
67 3300025914 Ga0207671_10007468 Ga0207671_100074683 313
68 3300025920 Ga0207649_10002313 Ga0207649_100023132 313
69 3300025924 Ga0207694_10008631 Ga0207694_100086313 313
70 3300025942 Ga0207689_10083215 Ga0207689_100832152 313
71 3300025981 Ga0207640_10032197 Ga0207640_100321973 313
72 3300026041 Ga0207639_10001736 Ga0207639_100017367 313
73 3300026142 Ga0207698_10119877 Ga0207698_101198772 313
74 3300028381 Ga0268264_10010635 Ga0268264_100106352 313
75 3300032168 Ga0316593_10000283 Ga0316593_100002835 313
76 3300033541 Ga0316596_1001080 Ga0316596_10010803 313
77 3300049583 Ga0501067_0124952 Ga0501067_0124952_268_1260 313
78 3300053139 Ga0500568_0009284 Ga0500568_0009284_2657_3682 313
79 3300053139 Ga0500568_0066804 Ga0500568_0066804_164_1189 313
80 3300053156 Ga0500622_0021842 Ga0500622_0021842_131_1156 313
81 3300053156 Ga0500622_0062581 Ga0500622_0062581_416_1441 313
82 3300005328 Ga0070676_10000409 Ga0070676_1000040917 314
83 3300005334 Ga0068869_100000798 Ga0068869_1000007987 314
84 3300005335 Ga0070666_10001270 Ga0070666_1000127013 314
85 3300005335 Ga0070666_10013074 Ga0070666_100130742 314
86 3300005347 Ga0070668_100050779 Ga0070668_1000507792 314
87 3300005353 Ga0070669_100001002 Ga0070669_10000100218 314
88 3300005354 Ga0070675_100003433 Ga0070675_10000343310 314
89 3300005355 Ga0070671_100008388 Ga0070671_1000083888 314
90 3300005356 Ga0070674_100096673 Ga0070674_1000966732 314
91 3300005367 Ga0070667_100002050 Ga0070667_10000205012 314
92 3300005445 Ga0070708_100003166 Ga0070708_1000031663 314
93 3300005456 Ga0070678_100015251 Ga0070678_1000152514 314
94 3300005459 Ga0068867_100038368 Ga0068867_1000383684 314
95 3300005539 Ga0068853_100030264 Ga0068853_1000302642 314
96 3300005539 Ga0068853_100246869 Ga0068853_1002468692 314
97 3300005563 Ga0068855_100472680 Ga0068855_1004726801 314
98 3300005577 Ga0068857_100016796 Ga0068857_1000167966 314
99 3300005616 Ga0068852_100165387 Ga0068852_1001653872 314
100 3300005618 Ga0068864_100100071 Ga0068864_1001000712 314
101 3300005841 Ga0068863_100002766 Ga0068863_1000027668 314
102 3300005842 Ga0068858_100011251 Ga0068858_1000112518 314
103 3300005843 Ga0068860_100004132 Ga0068860_1000041326 314
104 3300009176 Ga0105242_10120681 Ga0105242_101206813 314
105 3300009177 Ga0105248_10017821 Ga0105248_100178215 314
106 3300010375 Ga0105239_10018292 Ga0105239_100182924 314
107 3300011119 Ga0105246_10085165 Ga0105246_100851652 314
108 3300013104 Ga0157370_10120929 Ga0157370_101209292 314
109 3300013296 Ga0157374_10016651 Ga0157374_100166513 314
110 3300013306 Ga0163162_10029935 Ga0163162_100299353 314
111 3300013307 Ga0157372_10044225 Ga0157372_100442252 314
112 3300014325 Ga0163163_10005082 Ga0163163_100050823 314
113 3300014325 Ga0163163_10016778 Ga0163163_100167782 314
114 3300014968 Ga0157379_10001305 Ga0157379_1000130518 314
115 3300014968 Ga0157379_10009035 Ga0157379_100090352 314
116 3300017792 Ga0163161_10159301 Ga0163161_101593013 314
117 3300025903 Ga0207680_10007767 Ga0207680_100077675 314
118 3300025919 Ga0207657_10002920 Ga0207657_100029205 314
119 3300025933 Ga0207706_10043127 Ga0207706_100431274 314
120 3300026041 Ga0207639_10012116 Ga0207639_100121164 314
121 3300026116 Ga0207674_10004736 Ga0207674_100047366 314
122 3300026118 Ga0207675_100062301 Ga0207675_1000623012 314
123 3300028381 Ga0268264_10141054 Ga0268264_101410543 314
124 3300048910 Ga0496107_0037951 Ga0496107_0037951_700_1719 314
125 3300049742 Ga0501080_0127271 Ga0501080_0127271_858_1853 314
126 3300054114 Ga0501084_0075350 Ga0501084_0075350_64_1059 314
127 3300005434 Ga0070709_10043287 Ga0070709_100432872 315
128 3300005545 Ga0070695_100050148 Ga0070695_1000501482 315
129 3300009094 Ga0111539_10244958 Ga0111539_102449582 315
130 3300025906 Ga0207699_10052963 Ga0207699_100529634 315
131 3300031691 Ga0316579_10003608 Ga0316579_100036086 315
132 3300031728 Ga0316578_10025775 Ga0316578_100257755 315
133 3300032133 Ga0316583_10008839 Ga0316583_100088395 315
134 3300036647 Ga0316582_0070978 Ga0316582_0070978_1001_2005 315
135 3300037588 Ga0316581_0009343 Ga0316581_0009343_1399_2403 315
136 3300039447 Ga0436361_0265002 Ga0436361_0265002_133_1158 315
137 3300050511 nmdc:mga08y16_29234_c1 nmdc:mga08y16_29234_c1_920_1921 315
138 3300005334 Ga0068869_100038775 Ga0068869_1000387751 316
139 3300005336 Ga0070680_100370071 Ga0070680_1003700711 316
140 3300006844 Ga0075428_100000729 Ga0075428_10000072931 316
141 3300006880 Ga0075429_100010098 Ga0075429_1000100985 316
142 3300009094 Ga0111539_10044489 Ga0111539_100444894 316
143 3300009148 Ga0105243_10084846 Ga0105243_100848462 316
144 3300014326 Ga0157380_10096199 Ga0157380_100961993 316
145 3300025942 Ga0207689_10059859 Ga0207689_100598593 316
146 3300026089 Ga0207648_10134607 Ga0207648_101346072 316
147 3300049572 Ga0501036_0329264 Ga0501036_0329264_71_1075 316
148 3300050509 nmdc:mga0qj67_71655_c1 nmdc:mga0qj67_71655_c1_361_1365 316
149 3300050511 nmdc:mga08y16_78786_c1 nmdc:mga08y16_78786_c1_218_1222 316
150 iso_pu_bacteria 2597489888 2597864493 316
151 3300005335 Ga0070666_10017801 Ga0070666_100178013 317
152 3300005340 Ga0070689_100106287 Ga0070689_1001062872 317
153 3300005343 Ga0070687_100042256 Ga0070687_1000422562 317
154 3300005355 Ga0070671_100059140 Ga0070671_1000591402 317
155 3300005364 Ga0070673_100037989 Ga0070673_1000379892 317
156 3300005367 Ga0070667_100018398 Ga0070667_1000183983 317
157 3300005436 Ga0070713_100177900 Ga0070713_1001779002 317
158 3300005439 Ga0070711_100101051 Ga0070711_1001010512 317
159 3300005544 Ga0070686_100202971 Ga0070686_1002029712 317
160 3300005548 Ga0070665_100028902 Ga0070665_1000289024 317
161 3300005563 Ga0068855_100117883 Ga0068855_1001178833 317
162 3300005564 Ga0070664_100007865 Ga0070664_1000078656 317
163 3300005617 Ga0068859_100044030 Ga0068859_1000440304 317
164 3300005618 Ga0068864_100007975 Ga0068864_1000079757 317
165 3300005834 Ga0068851_10032997 Ga0068851_100329972 317
166 3300005841 Ga0068863_100021028 Ga0068863_1000210283 317
167 3300005842 Ga0068858_100004446 Ga0068858_1000044469 317
168 3300005843 Ga0068860_100021377 Ga0068860_1000213774 317
169 3300006237 Ga0097621_100064761 Ga0097621_1000647613 317
170 3300006358 Ga0068871_100057763 Ga0068871_1000577632 317
171 3300006844 Ga0075428_100310847 Ga0075428_1003108472 317
172 3300006931 Ga0097620_100044029 Ga0097620_1000440294 317
173 3300009093 Ga0105240_10060715 Ga0105240_100607151 317
174 3300009098 Ga0105245_10205744 Ga0105245_102057442 317
175 3300009101 Ga0105247_10007270 Ga0105247_100072706 317
176 3300009176 Ga0105242_10246733 Ga0105242_102467332 317
177 3300009177 Ga0105248_10105239 Ga0105248_101052392 317
178 3300009551 Ga0105238_10012954 Ga0105238_100129546 317
179 3300010375 Ga0105239_10042897 Ga0105239_100428975 317
180 3300013297 Ga0157378_10342704 Ga0157378_103427042 317
181 3300013306 Ga0163162_10006034 Ga0163162_100060343 317
182 3300014325 Ga0163163_10019235 Ga0163163_100192352 317
183 3300014326 Ga0157380_10016332 Ga0157380_100163325 317
184 3300014968 Ga0157379_10043631 Ga0157379_100436312 317
185 3300014969 Ga0157376_10350121 Ga0157376_103501212 317
186 3300025900 Ga0207710_10024427 Ga0207710_100244273 317
187 3300025903 Ga0207680_10040168 Ga0207680_100401683 317
188 3300025912 Ga0207707_10017944 Ga0207707_100179445 317
189 3300025916 Ga0207663_10049963 Ga0207663_100499632 317
190 3300025918 Ga0207662_10145213 Ga0207662_101452132 317
191 3300025933 Ga0207706_10151510 Ga0207706_101515102 317
192 3300025936 Ga0207670_10190478 Ga0207670_101904782 317
193 3300025941 Ga0207711_10049699 Ga0207711_100496994 317
194 3300025944 Ga0207661_10092697 Ga0207661_100926972 317
195 3300025949 Ga0207667_10105587 Ga0207667_101055872 317
196 3300026078 Ga0207702_10211786 Ga0207702_102117862 317
197 3300026095 Ga0207676_10070256 Ga0207676_100702562 317
198 3300026142 Ga0207698_10084114 Ga0207698_100841142 317
199 3300028379 Ga0268266_10021476 Ga0268266_100214764 317
200 3300033180 Ga0307510_10264833 Ga0307510_102648332 317
201 3300035410 Ga0373924_0032199 Ga0373924_0032199_711_1715 317
202 3300036401 Ga0373937_0005402 Ga0373937_0005402_8463_9482 317
203 3300036401 Ga0373937_0039259 Ga0373937_0039259_1963_2982 317
204 3300045051 Ga0451576_0093339 Ga0451576_0093339_73_1092 317
205 3300048907 Ga0496104_0001671 Ga0496104_0001671_6279_7283 317
206 3300048907 Ga0496104_0049451 Ga0496104_0049451_2184_3203 317
207 3300048908 Ga0496105_0000293 Ga0496105_0000293_25356_26360 317
208 3300048910 Ga0496107_0070668 Ga0496107_0070668_558_1562 317
209 3300048912 Ga0496109_0152725 Ga0496109_0152725_775_1794 317
210 3300048915 Ga0496112_0012599 Ga0496112_0012599_1600_2619 317
211 3300048917 Ga0496114_0000240 Ga0496114_0000240_23871_24875 317
212 3300048918 Ga0496115_0001302 Ga0496115_0001302_4315_5319 317
213 3300048918 Ga0496115_0197253 Ga0496115_0197253_117_1136 317
214 3300053077 Ga0495601_0009294 Ga0495601_0009294_1899_2918 317
215 3300005336 Ga0070680_100160648 Ga0070680_1001606483 318
216 3300005530 Ga0070679_100145083 Ga0070679_1001450832 318
217 3300025921 Ga0207652_10123730 Ga0207652_101237302 318
218 3300049571 Ga0501034_0176995 Ga0501034_0176995_540_1571 318
219 3300031251 Ga0265327_10000005 Ga0265327_10000005515 319
220 3300002737 JGI25162J39368_1001210 JGI25162J39368_10012109 320
221 3300002737 JGI25162J39368_1001215 JGI25162J39368_10012159 320
222 3300002771 JGI25163J39215_1000510 JGI25163J39215_10005108 320
223 3300002772 JGI25164J39214_1000624 JGI25164J39214_10006249 320
224 3300003214 JGI25165J46597_1000467 JGI25165J46597_100046735 320
225 3300003751 Ga0055538_1000088 Ga0055538_100008812 320
226 3300025207 Ga0209760_100269 Ga0209760_10026912 320
227 3300025231 Ga0207427_100008 Ga0207427_100008403 320
228 3300025233 Ga0209437_100014 Ga0209437_100014308 320
229 3300025261 Ga0209233_1000008 Ga0209233_1000008308 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02606

LpxK

Tetraacyldisaccharide-1-P 4'-kinase

26

343

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.7927 17 315
8elf-assembly1.cif.gz_A structure of get3d, a homolog of get3, from arabidopsis thaliana 0.7851 51 91
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.7539 17 315
4hi0-assembly1.cif.gz_F crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.7105 51 186
2j37-assembly1.cif.gz_W model of mammalian srp bound to 80s rncs 0.6877 44 185
ID Description Score Start End Superfamily
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.912 18 310 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8889 18 310 3.40.50.300
af_A0A0P0X1P5_1_135_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8702 85 187 3.40.50.300
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8597 18 310 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8153 18 310 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3M5X691-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) 0.9948 111 315 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A3M5X691-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) 0.99 111 315 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-V7D6J7-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9855 167 313 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-Q02PE4-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9845 1 313 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A2R7T0N3-F1-model_v4 deleted 0.9831 145 320

Feature Viewer

pLDDT pTM Quality
87.1 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map