F342136
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 229 | 171 | 224 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300031251|Ga0265327_10000005|Ga0265327_10000005515 |
| Length | 361 |
| Sequence | MQNPSTIQRSSLSVFLQESWYGSALWLQLLRPVSWLFRVLVFVRRSLYLRHRSNNPCSIPVIVVGNISVGGAGKTPLLMALAEELKRRGHRVGIVSRGYGGNAKRFPLRVDRNTSPELCGDEPAMMAQRLNIPVVVDPVRKNAVIEALGCASDYPCDVILSDDGLQHYAMPRDIEILVVDAERGFGNGLCLPAGPLREPLSRLRSVDFLVSNGPDSARKLPKQHTFASMMLKPSACVNVTTGERVSIEKFFRRQLVHAVAGIGNPQRFFQSLKDLGSQVIEHPFPDHYIYVPKDLHFGDALPVLMTEKDAVKCKNIPLRNAWYLEVNAVLPDSFYEAVINRLSSLQVARKIGVQRGLFDGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 2 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 3 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 4 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 127 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 130 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 132 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 138 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 139 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 140 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 141 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 142 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 143 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 148 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 149 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 161 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 167 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 168 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 169 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.94 |
| Metatranscriptomes | 0.87 |
| Isolates | 2.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.42 |
| Nodule | 0 |
| Rhizoplane | 4.37 |
| Rhizosphere | 85.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1001210 | 3300002737 | Bacteria | 15021 |
| 2 | JGI25162J39368_1001215 | 3300002737 | Bacteria | 14973 |
| 3 | JGI25163J39215_1000510 | 3300002771 | Bacteria | 11476 |
| 4 | JGI25164J39214_1000624 | 3300002772 | Bacteria | 14975 |
| 5 | JGI25165J46597_1000467 | 3300003214 | Bacteria | 39971 |
| 6 | Ga0055538_1000088 | 3300003751 | Bacteria | 78763 |
| 7 | Ga0070676_10000409 | 3300005328 | Bacteria | 20112 |
| 8 | Ga0070670_100109653 | 3300005331 | Bacteria | 2378 |
| 9 | Ga0068869_100000798 | 3300005334 | Bacteria | 17966 |
| 10 | Ga0068869_100038775 | 3300005334 | Bacteria | 3399 |
| 11 | Ga0070666_10001270 | 3300005335 | Bacteria | 15257 |
| 12 | Ga0070666_10013074 | 3300005335 | Bacteria | 5258 |
| 13 | Ga0070666_10017801 | 3300005335 | Bacteria | 4559 |
| 14 | Ga0070680_100160648 | 3300005336 | Bacteria | 1888 |
| 15 | Ga0070680_100370071 | 3300005336 | Bacteria | 1219 |
| 16 | Ga0070689_100106287 | 3300005340 | Bacteria | 2227 |
| 17 | Ga0070687_100042256 | 3300005343 | Bacteria | 2309 |
| 18 | Ga0070661_100007995 | 3300005344 | Bacteria | 7304 |
| 19 | Ga0070668_100050779 | 3300005347 | Bacteria | 3194 |
| 20 | Ga0070669_100001002 | 3300005353 | Bacteria | 20558 |
| 21 | Ga0070675_100003433 | 3300005354 | Bacteria | 12004 |
| 22 | Ga0070671_100008388 | 3300005355 | Bacteria | 8281 |
| 23 | Ga0070671_100059140 | 3300005355 | Bacteria | 3189 |
| 24 | Ga0070674_100096673 | 3300005356 | Bacteria | 2143 |
| 25 | Ga0070673_100037989 | 3300005364 | Bacteria | 3673 |
| 26 | Ga0070667_100002050 | 3300005367 | Bacteria | 17841 |
| 27 | Ga0070667_100018398 | 3300005367 | Bacteria | 5795 |
| 28 | Ga0070709_10043287 | 3300005434 | Bacteria | 2784 |
| 29 | Ga0070713_100177900 | 3300005436 | Bacteria | 1910 |
| 30 | Ga0070711_100101051 | 3300005439 | Bacteria | 2098 |
| 31 | Ga0070708_100003166 | 3300005445 | Bacteria | 12831 |
| 32 | Ga0070678_100015251 | 3300005456 | Bacteria | 4879 |
| 33 | Ga0068867_100038368 | 3300005459 | Bacteria | 3487 |
| 34 | Ga0070679_100145083 | 3300005530 | Bacteria | 2352 |
| 35 | Ga0068853_100013178 | 3300005539 | Bacteria | 6748 |
| 36 | Ga0068853_100030264 | 3300005539 | Bacteria | 4572 |
| 37 | Ga0068853_100246869 | 3300005539 | Bacteria | 1637 |
| 38 | Ga0070686_100202971 | 3300005544 | Bacteria | 1422 |
| 39 | Ga0070695_100050148 | 3300005545 | Bacteria | 2674 |
| 40 | Ga0070665_100028902 | 3300005548 | Bacteria | 5581 |
| 41 | Ga0068855_100117883 | 3300005563 | Bacteria | 3041 |
| 42 | Ga0068855_100472680 | 3300005563 | Bacteria | 1365 |
| 43 | Ga0070664_100007865 | 3300005564 | Bacteria | 8612 |
| 44 | Ga0068857_100016796 | 3300005577 | Bacteria | 6412 |
| 45 | Ga0068854_100057304 | 3300005578 | Bacteria | 2810 |
| 46 | Ga0068852_100165387 | 3300005616 | Bacteria | 2069 |
| 47 | Ga0068859_100005483 | 3300005617 | Bacteria | 12916 |
| 48 | Ga0068859_100044030 | 3300005617 | Bacteria | 4486 |
| 49 | Ga0068864_100007975 | 3300005618 | Bacteria | 8728 |
| 50 | Ga0068864_100011776 | 3300005618 | Bacteria | 7224 |
| 51 | Ga0068864_100100071 | 3300005618 | Bacteria | 2569 |
| 52 | Ga0068861_100021470 | 3300005719 | Bacteria | 4640 |
| 53 | Ga0068851_10032997 | 3300005834 | Bacteria | 2578 |
| 54 | Ga0068863_100002766 | 3300005841 | Bacteria | 17379 |
| 55 | Ga0068863_100007862 | 3300005841 | Bacteria | 10425 |
| 56 | Ga0068863_100021028 | 3300005841 | Bacteria | 6233 |
| 57 | Ga0068858_100004446 | 3300005842 | Bacteria | 13740 |
| 58 | Ga0068858_100011251 | 3300005842 | Bacteria | 8455 |
| 59 | Ga0068860_100004132 | 3300005843 | Bacteria | 14876 |
| 60 | Ga0068860_100019813 | 3300005843 | Bacteria | 6522 |
| 61 | Ga0068860_100021377 | 3300005843 | Bacteria | 6266 |
| 62 | Ga0068860_100115450 | 3300005843 | Bacteria | 2568 |
| 63 | Ga0075367_10066316 | 3300006178 | Bacteria | 2163 |
| 64 | Ga0097621_100002004 | 3300006237 | Bacteria | 13901 |
| 65 | Ga0097621_100064761 | 3300006237 | Bacteria | 3007 |
| 66 | Ga0068871_100001493 | 3300006358 | Bacteria | 15681 |
| 67 | Ga0068871_100057763 | 3300006358 | Bacteria | 3157 |
| 68 | Ga0075428_100000729 | 3300006844 | Bacteria | 34167 |
| 69 | Ga0075428_100310847 | 3300006844 | Bacteria | 1694 |
| 70 | Ga0075430_100012906 | 3300006846 | Bacteria | 7120 |
| 71 | Ga0075431_100006916 | 3300006847 | Bacteria | 11276 |
| 72 | Ga0075429_100010098 | 3300006880 | Bacteria | 8181 |
| 73 | Ga0097620_100005484 | 3300006931 | Bacteria | 12916 |
| 74 | Ga0097620_100044029 | 3300006931 | Bacteria | 4486 |
| 75 | Ga0105240_10030417 | 3300009093 | Bacteria | 7018 |
| 76 | Ga0105240_10060715 | 3300009093 | Bacteria | 4712 |
| 77 | Ga0105240_10155188 | 3300009093 | Bacteria | 2723 |
| 78 | Ga0111539_10044489 | 3300009094 | Bacteria | 5319 |
| 79 | Ga0111539_10244958 | 3300009094 | Bacteria | 2087 |
| 80 | Ga0105245_10205744 | 3300009098 | Bacteria | 1892 |
| 81 | Ga0105247_10007270 | 3300009101 | Bacteria | 6802 |
| 82 | Ga0105243_10084846 | 3300009148 | Bacteria | 2595 |
| 83 | Ga0105241_10030001 | 3300009174 | Bacteria | 4061 |
| 84 | Ga0105242_10120681 | 3300009176 | Bacteria | 2249 |
| 85 | Ga0105242_10246733 | 3300009176 | Bacteria | 1607 |
| 86 | Ga0105248_10004264 | 3300009177 | Bacteria | 15827 |
| 87 | Ga0105248_10017821 | 3300009177 | Bacteria | 7837 |
| 88 | Ga0105248_10105239 | 3300009177 | Bacteria | 3181 |
| 89 | Ga0105237_10010061 | 3300009545 | Bacteria | 10089 |
| 90 | Ga0105238_10012110 | 3300009551 | Bacteria | 8692 |
| 91 | Ga0105238_10012954 | 3300009551 | Bacteria | 8418 |
| 92 | Ga0105239_10018292 | 3300010375 | Bacteria | 7746 |
| 93 | Ga0105239_10042897 | 3300010375 | Bacteria | 4956 |
| 94 | Ga0105246_10085165 | 3300011119 | Bacteria | 2263 |
| 95 | Ga0157370_10120929 | 3300013104 | Bacteria | 2445 |
| 96 | Ga0157369_10002721 | 3300013105 | Bacteria | 21107 |
| 97 | Ga0157374_10016651 | 3300013296 | Bacteria | 6466 |
| 98 | Ga0157378_10342704 | 3300013297 | Bacteria | 1458 |
| 99 | Ga0163162_10006034 | 3300013306 | Bacteria | 11728 |
| 100 | Ga0163162_10029935 | 3300013306 | Bacteria | 5391 |
| 101 | Ga0157372_10002373 | 3300013307 | Bacteria | 20377 |
| 102 | Ga0157372_10044225 | 3300013307 | Bacteria | 4934 |
| 103 | Ga0157375_10221933 | 3300013308 | Bacteria | 2048 |
| 104 | Ga0163163_10005082 | 3300014325 | Bacteria | 11337 |
| 105 | Ga0163163_10016778 | 3300014325 | Bacteria | 6815 |
| 106 | Ga0163163_10019235 | 3300014325 | Bacteria | 6411 |
| 107 | Ga0157380_10016332 | 3300014326 | Bacteria | 5473 |
| 108 | Ga0157380_10096199 | 3300014326 | Bacteria | 2454 |
| 109 | Ga0157379_10001305 | 3300014968 | Bacteria | 20314 |
| 110 | Ga0157379_10009035 | 3300014968 | Bacteria | 8682 |
| 111 | Ga0157379_10043631 | 3300014968 | Bacteria | 4004 |
| 112 | Ga0157376_10350121 | 3300014969 | Bacteria | 1413 |
| 113 | Ga0163161_10159301 | 3300017792 | Bacteria | 1721 |
| 114 | Ga0209760_100269 | 3300025207 | Bacteria | 19191 |
| 115 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 116 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 117 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 118 | Ga0207710_10024427 | 3300025900 | Bacteria | 2603 |
| 119 | Ga0207680_10007767 | 3300025903 | Bacteria | 5240 |
| 120 | Ga0207680_10040168 | 3300025903 | Bacteria | 2720 |
| 121 | Ga0207699_10052963 | 3300025906 | Bacteria | 2405 |
| 122 | Ga0207645_10010997 | 3300025907 | Bacteria | 6191 |
| 123 | Ga0207707_10017944 | 3300025912 | Bacteria | 6169 |
| 124 | Ga0207695_10001006 | 3300025913 | Bacteria | 49914 |
| 125 | Ga0207695_10116570 | 3300025913 | Bacteria | 2644 |
| 126 | Ga0207671_10007468 | 3300025914 | Bacteria | 9483 |
| 127 | Ga0207663_10049963 | 3300025916 | Bacteria | 2597 |
| 128 | Ga0207662_10145213 | 3300025918 | Bacteria | 1505 |
| 129 | Ga0207657_10002920 | 3300025919 | Bacteria | 18349 |
| 130 | Ga0207649_10002313 | 3300025920 | Bacteria | 10705 |
| 131 | Ga0207652_10123730 | 3300025921 | Bacteria | 2303 |
| 132 | Ga0207681_10004261 | 3300025923 | Bacteria | 8827 |
| 133 | Ga0207681_10078762 | 3300025923 | Bacteria | 2320 |
| 134 | Ga0207694_10008631 | 3300025924 | Bacteria | 7693 |
| 135 | Ga0207650_10045296 | 3300025925 | Bacteria | 3236 |
| 136 | Ga0207650_10058987 | 3300025925 | Bacteria | 2859 |
| 137 | Ga0207659_10002846 | 3300025926 | Bacteria | 10316 |
| 138 | Ga0207706_10043127 | 3300025933 | Bacteria | 3998 |
| 139 | Ga0207706_10151510 | 3300025933 | Bacteria | 2039 |
| 140 | Ga0207670_10190478 | 3300025936 | Bacteria | 1552 |
| 141 | Ga0207691_10001585 | 3300025940 | Bacteria | 22586 |
| 142 | Ga0207711_10049699 | 3300025941 | Bacteria | 3590 |
| 143 | Ga0207689_10001604 | 3300025942 | Bacteria | 21396 |
| 144 | Ga0207689_10059859 | 3300025942 | Bacteria | 3132 |
| 145 | Ga0207689_10083215 | 3300025942 | Bacteria | 2631 |
| 146 | Ga0207661_10092697 | 3300025944 | Bacteria | 2519 |
| 147 | Ga0207667_10105587 | 3300025949 | Bacteria | 2906 |
| 148 | Ga0207668_10003044 | 3300025972 | Bacteria | 9827 |
| 149 | Ga0207640_10032197 | 3300025981 | Bacteria | 3249 |
| 150 | Ga0207677_10020838 | 3300026023 | Bacteria | 3992 |
| 151 | Ga0207703_10065910 | 3300026035 | Bacteria | 2977 |
| 152 | Ga0207639_10001736 | 3300026041 | Bacteria | 14682 |
| 153 | Ga0207639_10012116 | 3300026041 | Bacteria | 6000 |
| 154 | Ga0207639_10048285 | 3300026041 | Bacteria | 3221 |
| 155 | Ga0207678_10146866 | 3300026067 | Bacteria | 2013 |
| 156 | Ga0207702_10211786 | 3300026078 | Bacteria | 1802 |
| 157 | Ga0207641_10002861 | 3300026088 | Bacteria | 15679 |
| 158 | Ga0207648_10000126 | 3300026089 | Bacteria | 75403 |
| 159 | Ga0207648_10134607 | 3300026089 | Bacteria | 2176 |
| 160 | Ga0207676_10070256 | 3300026095 | Bacteria | 2807 |
| 161 | Ga0207674_10004736 | 3300026116 | Bacteria | 16310 |
| 162 | Ga0207675_100062301 | 3300026118 | Bacteria | 3483 |
| 163 | Ga0207683_10001731 | 3300026121 | Bacteria | 19437 |
| 164 | Ga0207698_10084114 | 3300026142 | Bacteria | 2578 |
| 165 | Ga0207698_10119877 | 3300026142 | Bacteria | 2224 |
| 166 | Ga0268266_10021476 | 3300028379 | Bacteria | 5499 |
| 167 | Ga0268266_10038129 | 3300028379 | Bacteria | 4092 |
| 168 | Ga0268264_10010635 | 3300028381 | Bacteria | 7603 |
| 169 | Ga0268264_10141054 | 3300028381 | Bacteria | 2149 |
| 170 | Ga0265334_10000097 | 3300028573 | Bacteria | 61159 |
| 171 | Ga0265327_10000005 | 3300031251 | Bacteria | 790146 |
| 172 | Ga0307408_100273690 | 3300031548 | Bacteria | 1403 |
| 173 | Ga0316579_10003608 | 3300031691 | Bacteria | 6073 |
| 174 | Ga0316578_10025775 | 3300031728 | Bacteria | 3309 |
| 175 | Ga0307414_10286386 | 3300032004 | Bacteria | 1387 |
| 176 | Ga0316583_10008839 | 3300032133 | Bacteria | 3632 |
| 177 | Ga0316593_10000283 | 3300032168 | Bacteria | 8557 |
| 178 | Ga0307510_10264833 | 3300033180 | Bacteria | 1198 |
| 179 | Ga0316596_1001080 | 3300033541 | Bacteria | 5288 |
| 180 | Ga0373924_0032199 | 3300035410 | Bacteria | 2112 |
| 181 | Ga0373937_0005402 | 3300036401 | Bacteria | 10934 |
| 182 | Ga0373937_0039259 | 3300036401 | Bacteria | 4315 |
| 183 | Ga0316582_0070978 | 3300036647 | Bacteria | 2254 |
| 184 | Ga0395900_0001450 | 3300037418 | Bacteria | 28297 |
| 185 | Ga0316581_0009343 | 3300037588 | Bacteria | 2692 |
| 186 | Ga0436364_1336806 | 3300037853 | Bacteria | 2986 |
| 187 | Ga0400483_105831 | 3300039062 | Bacteria | 8934 |
| 188 | Ga0436361_0265002 | 3300039447 | Bacteria | 2196 |
| 189 | Ga0453684_0002052 | 3300044712 | Bacteria | 51252 |
| 190 | Ga0451576_0093339 | 3300045051 | Bacteria | 3129 |
| 191 | Ga0495640_0203788 | 3300046533 | Bacteria | 1253 |
| 192 | Ga0495604_0238403 | 3300047317 | Bacteria | 1245 |
| 193 | Ga0495673_0121628 | 3300047469 | Bacteria | 1033 |
| 194 | Ga0496104_0001671 | 3300048907 | Bacteria | 19141 |
| 195 | Ga0496104_0049451 | 3300048907 | Bacteria | 3965 |
| 196 | Ga0496105_0000293 | 3300048908 | Bacteria | 32964 |
| 197 | Ga0496107_0037951 | 3300048910 | Bacteria | 3458 |
| 198 | Ga0496107_0070668 | 3300048910 | Bacteria | 2535 |
| 199 | Ga0496109_0152725 | 3300048912 | Bacteria | 2162 |
| 200 | Ga0496112_0012599 | 3300048915 | Bacteria | 7771 |
| 201 | Ga0496114_0000240 | 3300048917 | Bacteria | 39991 |
| 202 | Ga0496115_0001302 | 3300048918 | Bacteria | 17773 |
| 203 | Ga0496115_0197253 | 3300048918 | Bacteria | 1663 |
| 204 | Ga0501034_0176995 | 3300049571 | Bacteria | 2099 |
| 205 | Ga0501036_0329264 | 3300049572 | Bacteria | 1276 |
| 206 | Ga0501046_0081200 | 3300049580 | Bacteria | 2504 |
| 207 | Ga0501047_0462572 | 3300049581 | Bacteria | 1097 |
| 208 | Ga0501067_0124952 | 3300049583 | Bacteria | 1432 |
| 209 | Ga0501080_0127271 | 3300049742 | Bacteria | 2358 |
| 210 | Ga0501044_0000112 | 3300049823 | Bacteria | 98748 |
| 211 | nmdc:mga03683_61668_c1 | 3300050489 | Bacteria | 1586 |
| 212 | nmdc:mga09592_31385_c1 | 3300050508 | Bacteria | 4427 |
| 213 | nmdc:mga0qj67_71655_c1 | 3300050509 | Bacteria | 2766 |
| 214 | nmdc:mga06r32_18886_c1 | 3300050510 | Bacteria | 6320 |
| 215 | nmdc:mga08y16_29234_c1 | 3300050511 | Bacteria | 5808 |
| 216 | nmdc:mga08y16_78786_c1 | 3300050511 | Bacteria | 3435 |
| 217 | Ga0495601_0009294 | 3300053077 | Bacteria | 5812 |
| 218 | Ga0500556_0002389 | 3300053104 | Bacteria | 6064 |
| 219 | Ga0500568_0009284 | 3300053139 | Bacteria | 4685 |
| 220 | Ga0500568_0066804 | 3300053139 | Bacteria | 1382 |
| 221 | Ga0500622_0021842 | 3300053156 | Bacteria | 3395 |
| 222 | Ga0500622_0062581 | 3300053156 | Bacteria | 1895 |
| 223 | Ga0501084_0075350 | 3300054114 | Bacteria | 2827 |
| 224 | Ga0501082_0395228 | 3300060353 | Bacteria | 1206 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0462572 | Ga0501047_0462572_206_1072 | 262 |
| 2 | 3300049580 | Ga0501046_0081200 | Ga0501046_0081200_19_888 | 263 |
| 3 | 3300047317 | Ga0495604_0238403 | Ga0495604_0238403_352_1224 | 271 |
| 4 | 3300060353 | Ga0501082_0395228 | Ga0501082_0395228_311_1195 | 277 |
| 5 | 3300047469 | Ga0495673_0121628 | Ga0495673_0121628_23_937 | 288 |
| 6 | 3300050489 | nmdc:mga03683_61668_c1 | nmdc:mga03683_61668_c1_646_1560 | 288 |
| 7 | 3300005617 | Ga0068859_100005483 | Ga0068859_1000054835 | 289 |
| 8 | 3300005618 | Ga0068864_100011776 | Ga0068864_1000117767 | 289 |
| 9 | 3300005719 | Ga0068861_100021470 | Ga0068861_1000214706 | 289 |
| 10 | 3300005841 | Ga0068863_100007862 | Ga0068863_1000078625 | 289 |
| 11 | 3300005843 | Ga0068860_100019813 | Ga0068860_1000198136 | 289 |
| 12 | 3300006237 | Ga0097621_100002004 | Ga0097621_10000200412 | 289 |
| 13 | 3300006358 | Ga0068871_100001493 | Ga0068871_1000014937 | 289 |
| 14 | 3300006931 | Ga0097620_100005484 | Ga0097620_10000548410 | 289 |
| 15 | 3300025907 | Ga0207645_10010997 | Ga0207645_100109976 | 289 |
| 16 | 3300025923 | Ga0207681_10004261 | Ga0207681_100042616 | 289 |
| 17 | 3300025925 | Ga0207650_10058987 | Ga0207650_100589873 | 289 |
| 18 | 3300025926 | Ga0207659_10002846 | Ga0207659_100028461 | 289 |
| 19 | 3300025940 | Ga0207691_10001585 | Ga0207691_1000158513 | 289 |
| 20 | 3300025942 | Ga0207689_10001604 | Ga0207689_1000160410 | 289 |
| 21 | 3300025972 | Ga0207668_10003044 | Ga0207668_100030447 | 289 |
| 22 | 3300026023 | Ga0207677_10020838 | Ga0207677_100208383 | 289 |
| 23 | 3300026035 | Ga0207703_10065910 | Ga0207703_100659103 | 289 |
| 24 | 3300026041 | Ga0207639_10048285 | Ga0207639_100482853 | 289 |
| 25 | 3300026067 | Ga0207678_10146866 | Ga0207678_101468663 | 289 |
| 26 | 3300026088 | Ga0207641_10002861 | Ga0207641_1000286114 | 289 |
| 27 | 3300026089 | Ga0207648_10000126 | Ga0207648_1000012645 | 289 |
| 28 | 3300026121 | Ga0207683_10001731 | Ga0207683_100017316 | 289 |
| 29 | 3300028379 | Ga0268266_10038129 | Ga0268266_100381293 | 289 |
| 30 | 3300044712 | Ga0453684_0002052 | Ga0453684_0002052_37207_38295 | 293 |
| 31 | 3300049823 | Ga0501044_0000112 | Ga0501044_0000112_77062_78081 | 293 |
| 32 | 3300031548 | Ga0307408_100273690 | Ga0307408_1002736902 | 294 |
| 33 | 3300039062 | Ga0400483_105831 | Ga0400483_105831_323_1270 | 296 |
| 34 | iso_pu_bacteria | 2842837860 | 2842841996 | 298 |
| 35 | iso_pu_bacteria | 2744054655 | 2745160189 | 300 |
| 36 | iso_pu_bacteria | 8033232454 | 8033232743 | 302 |
| 37 | iso_pu_bacteria | 2919506607 | 2919507817 | 303 |
| 38 | 3300028573 | Ga0265334_10000097 | Ga0265334_1000009717 | 306 |
| 39 | 3300037418 | Ga0395900_0001450 | Ga0395900_0001450_7426_8406 | 306 |
| 40 | 3300037853 | Ga0436364_1336806 | Ga0436364_1336806_129_1151 | 307 |
| 41 | 3300005331 | Ga0070670_100109653 | Ga0070670_1001096533 | 308 |
| 42 | 3300006846 | Ga0075430_100012906 | Ga0075430_1000129065 | 308 |
| 43 | 3300006847 | Ga0075431_100006916 | Ga0075431_1000069165 | 308 |
| 44 | 3300025923 | Ga0207681_10078762 | Ga0207681_100787623 | 308 |
| 45 | 3300025925 | Ga0207650_10045296 | Ga0207650_100452963 | 308 |
| 46 | 3300050508 | nmdc:mga09592_31385_c1 | nmdc:mga09592_31385_c1_3372_4358 | 308 |
| 47 | 3300050510 | nmdc:mga06r32_18886_c1 | nmdc:mga06r32_18886_c1_3242_4228 | 308 |
| 48 | 3300006178 | Ga0075367_10066316 | Ga0075367_100663162 | 309 |
| 49 | 3300032004 | Ga0307414_10286386 | Ga0307414_102863862 | 309 |
| 50 | 3300053104 | Ga0500556_0002389 | Ga0500556_0002389_58_1032 | 309 |
| 51 | 3300046533 | Ga0495640_0203788 | Ga0495640_0203788_71_1093 | 312 |
| 52 | 3300005344 | Ga0070661_100007995 | Ga0070661_1000079952 | 313 |
| 53 | 3300005539 | Ga0068853_100013178 | Ga0068853_1000131786 | 313 |
| 54 | 3300005578 | Ga0068854_100057304 | Ga0068854_1000573043 | 313 |
| 55 | 3300005843 | Ga0068860_100115450 | Ga0068860_1001154502 | 313 |
| 56 | 3300009093 | Ga0105240_10030417 | Ga0105240_100304172 | 313 |
| 57 | 3300009093 | Ga0105240_10155188 | Ga0105240_101551883 | 313 |
| 58 | 3300009174 | Ga0105241_10030001 | Ga0105241_100300012 | 313 |
| 59 | 3300009177 | Ga0105248_10004264 | Ga0105248_1000426411 | 313 |
| 60 | 3300009545 | Ga0105237_10010061 | Ga0105237_100100613 | 313 |
| 61 | 3300009551 | Ga0105238_10012110 | Ga0105238_100121105 | 313 |
| 62 | 3300013105 | Ga0157369_10002721 | Ga0157369_1000272112 | 313 |
| 63 | 3300013307 | Ga0157372_10002373 | Ga0157372_100023735 | 313 |
| 64 | 3300013308 | Ga0157375_10221933 | Ga0157375_102219332 | 313 |
| 65 | 3300025913 | Ga0207695_10001006 | Ga0207695_1000100643 | 313 |
| 66 | 3300025913 | Ga0207695_10116570 | Ga0207695_101165703 | 313 |
| 67 | 3300025914 | Ga0207671_10007468 | Ga0207671_100074683 | 313 |
| 68 | 3300025920 | Ga0207649_10002313 | Ga0207649_100023132 | 313 |
| 69 | 3300025924 | Ga0207694_10008631 | Ga0207694_100086313 | 313 |
| 70 | 3300025942 | Ga0207689_10083215 | Ga0207689_100832152 | 313 |
| 71 | 3300025981 | Ga0207640_10032197 | Ga0207640_100321973 | 313 |
| 72 | 3300026041 | Ga0207639_10001736 | Ga0207639_100017367 | 313 |
| 73 | 3300026142 | Ga0207698_10119877 | Ga0207698_101198772 | 313 |
| 74 | 3300028381 | Ga0268264_10010635 | Ga0268264_100106352 | 313 |
| 75 | 3300032168 | Ga0316593_10000283 | Ga0316593_100002835 | 313 |
| 76 | 3300033541 | Ga0316596_1001080 | Ga0316596_10010803 | 313 |
| 77 | 3300049583 | Ga0501067_0124952 | Ga0501067_0124952_268_1260 | 313 |
| 78 | 3300053139 | Ga0500568_0009284 | Ga0500568_0009284_2657_3682 | 313 |
| 79 | 3300053139 | Ga0500568_0066804 | Ga0500568_0066804_164_1189 | 313 |
| 80 | 3300053156 | Ga0500622_0021842 | Ga0500622_0021842_131_1156 | 313 |
| 81 | 3300053156 | Ga0500622_0062581 | Ga0500622_0062581_416_1441 | 313 |
| 82 | 3300005328 | Ga0070676_10000409 | Ga0070676_1000040917 | 314 |
| 83 | 3300005334 | Ga0068869_100000798 | Ga0068869_1000007987 | 314 |
| 84 | 3300005335 | Ga0070666_10001270 | Ga0070666_1000127013 | 314 |
| 85 | 3300005335 | Ga0070666_10013074 | Ga0070666_100130742 | 314 |
| 86 | 3300005347 | Ga0070668_100050779 | Ga0070668_1000507792 | 314 |
| 87 | 3300005353 | Ga0070669_100001002 | Ga0070669_10000100218 | 314 |
| 88 | 3300005354 | Ga0070675_100003433 | Ga0070675_10000343310 | 314 |
| 89 | 3300005355 | Ga0070671_100008388 | Ga0070671_1000083888 | 314 |
| 90 | 3300005356 | Ga0070674_100096673 | Ga0070674_1000966732 | 314 |
| 91 | 3300005367 | Ga0070667_100002050 | Ga0070667_10000205012 | 314 |
| 92 | 3300005445 | Ga0070708_100003166 | Ga0070708_1000031663 | 314 |
| 93 | 3300005456 | Ga0070678_100015251 | Ga0070678_1000152514 | 314 |
| 94 | 3300005459 | Ga0068867_100038368 | Ga0068867_1000383684 | 314 |
| 95 | 3300005539 | Ga0068853_100030264 | Ga0068853_1000302642 | 314 |
| 96 | 3300005539 | Ga0068853_100246869 | Ga0068853_1002468692 | 314 |
| 97 | 3300005563 | Ga0068855_100472680 | Ga0068855_1004726801 | 314 |
| 98 | 3300005577 | Ga0068857_100016796 | Ga0068857_1000167966 | 314 |
| 99 | 3300005616 | Ga0068852_100165387 | Ga0068852_1001653872 | 314 |
| 100 | 3300005618 | Ga0068864_100100071 | Ga0068864_1001000712 | 314 |
| 101 | 3300005841 | Ga0068863_100002766 | Ga0068863_1000027668 | 314 |
| 102 | 3300005842 | Ga0068858_100011251 | Ga0068858_1000112518 | 314 |
| 103 | 3300005843 | Ga0068860_100004132 | Ga0068860_1000041326 | 314 |
| 104 | 3300009176 | Ga0105242_10120681 | Ga0105242_101206813 | 314 |
| 105 | 3300009177 | Ga0105248_10017821 | Ga0105248_100178215 | 314 |
| 106 | 3300010375 | Ga0105239_10018292 | Ga0105239_100182924 | 314 |
| 107 | 3300011119 | Ga0105246_10085165 | Ga0105246_100851652 | 314 |
| 108 | 3300013104 | Ga0157370_10120929 | Ga0157370_101209292 | 314 |
| 109 | 3300013296 | Ga0157374_10016651 | Ga0157374_100166513 | 314 |
| 110 | 3300013306 | Ga0163162_10029935 | Ga0163162_100299353 | 314 |
| 111 | 3300013307 | Ga0157372_10044225 | Ga0157372_100442252 | 314 |
| 112 | 3300014325 | Ga0163163_10005082 | Ga0163163_100050823 | 314 |
| 113 | 3300014325 | Ga0163163_10016778 | Ga0163163_100167782 | 314 |
| 114 | 3300014968 | Ga0157379_10001305 | Ga0157379_1000130518 | 314 |
| 115 | 3300014968 | Ga0157379_10009035 | Ga0157379_100090352 | 314 |
| 116 | 3300017792 | Ga0163161_10159301 | Ga0163161_101593013 | 314 |
| 117 | 3300025903 | Ga0207680_10007767 | Ga0207680_100077675 | 314 |
| 118 | 3300025919 | Ga0207657_10002920 | Ga0207657_100029205 | 314 |
| 119 | 3300025933 | Ga0207706_10043127 | Ga0207706_100431274 | 314 |
| 120 | 3300026041 | Ga0207639_10012116 | Ga0207639_100121164 | 314 |
| 121 | 3300026116 | Ga0207674_10004736 | Ga0207674_100047366 | 314 |
| 122 | 3300026118 | Ga0207675_100062301 | Ga0207675_1000623012 | 314 |
| 123 | 3300028381 | Ga0268264_10141054 | Ga0268264_101410543 | 314 |
| 124 | 3300048910 | Ga0496107_0037951 | Ga0496107_0037951_700_1719 | 314 |
| 125 | 3300049742 | Ga0501080_0127271 | Ga0501080_0127271_858_1853 | 314 |
| 126 | 3300054114 | Ga0501084_0075350 | Ga0501084_0075350_64_1059 | 314 |
| 127 | 3300005434 | Ga0070709_10043287 | Ga0070709_100432872 | 315 |
| 128 | 3300005545 | Ga0070695_100050148 | Ga0070695_1000501482 | 315 |
| 129 | 3300009094 | Ga0111539_10244958 | Ga0111539_102449582 | 315 |
| 130 | 3300025906 | Ga0207699_10052963 | Ga0207699_100529634 | 315 |
| 131 | 3300031691 | Ga0316579_10003608 | Ga0316579_100036086 | 315 |
| 132 | 3300031728 | Ga0316578_10025775 | Ga0316578_100257755 | 315 |
| 133 | 3300032133 | Ga0316583_10008839 | Ga0316583_100088395 | 315 |
| 134 | 3300036647 | Ga0316582_0070978 | Ga0316582_0070978_1001_2005 | 315 |
| 135 | 3300037588 | Ga0316581_0009343 | Ga0316581_0009343_1399_2403 | 315 |
| 136 | 3300039447 | Ga0436361_0265002 | Ga0436361_0265002_133_1158 | 315 |
| 137 | 3300050511 | nmdc:mga08y16_29234_c1 | nmdc:mga08y16_29234_c1_920_1921 | 315 |
| 138 | 3300005334 | Ga0068869_100038775 | Ga0068869_1000387751 | 316 |
| 139 | 3300005336 | Ga0070680_100370071 | Ga0070680_1003700711 | 316 |
| 140 | 3300006844 | Ga0075428_100000729 | Ga0075428_10000072931 | 316 |
| 141 | 3300006880 | Ga0075429_100010098 | Ga0075429_1000100985 | 316 |
| 142 | 3300009094 | Ga0111539_10044489 | Ga0111539_100444894 | 316 |
| 143 | 3300009148 | Ga0105243_10084846 | Ga0105243_100848462 | 316 |
| 144 | 3300014326 | Ga0157380_10096199 | Ga0157380_100961993 | 316 |
| 145 | 3300025942 | Ga0207689_10059859 | Ga0207689_100598593 | 316 |
| 146 | 3300026089 | Ga0207648_10134607 | Ga0207648_101346072 | 316 |
| 147 | 3300049572 | Ga0501036_0329264 | Ga0501036_0329264_71_1075 | 316 |
| 148 | 3300050509 | nmdc:mga0qj67_71655_c1 | nmdc:mga0qj67_71655_c1_361_1365 | 316 |
| 149 | 3300050511 | nmdc:mga08y16_78786_c1 | nmdc:mga08y16_78786_c1_218_1222 | 316 |
| 150 | iso_pu_bacteria | 2597489888 | 2597864493 | 316 |
| 151 | 3300005335 | Ga0070666_10017801 | Ga0070666_100178013 | 317 |
| 152 | 3300005340 | Ga0070689_100106287 | Ga0070689_1001062872 | 317 |
| 153 | 3300005343 | Ga0070687_100042256 | Ga0070687_1000422562 | 317 |
| 154 | 3300005355 | Ga0070671_100059140 | Ga0070671_1000591402 | 317 |
| 155 | 3300005364 | Ga0070673_100037989 | Ga0070673_1000379892 | 317 |
| 156 | 3300005367 | Ga0070667_100018398 | Ga0070667_1000183983 | 317 |
| 157 | 3300005436 | Ga0070713_100177900 | Ga0070713_1001779002 | 317 |
| 158 | 3300005439 | Ga0070711_100101051 | Ga0070711_1001010512 | 317 |
| 159 | 3300005544 | Ga0070686_100202971 | Ga0070686_1002029712 | 317 |
| 160 | 3300005548 | Ga0070665_100028902 | Ga0070665_1000289024 | 317 |
| 161 | 3300005563 | Ga0068855_100117883 | Ga0068855_1001178833 | 317 |
| 162 | 3300005564 | Ga0070664_100007865 | Ga0070664_1000078656 | 317 |
| 163 | 3300005617 | Ga0068859_100044030 | Ga0068859_1000440304 | 317 |
| 164 | 3300005618 | Ga0068864_100007975 | Ga0068864_1000079757 | 317 |
| 165 | 3300005834 | Ga0068851_10032997 | Ga0068851_100329972 | 317 |
| 166 | 3300005841 | Ga0068863_100021028 | Ga0068863_1000210283 | 317 |
| 167 | 3300005842 | Ga0068858_100004446 | Ga0068858_1000044469 | 317 |
| 168 | 3300005843 | Ga0068860_100021377 | Ga0068860_1000213774 | 317 |
| 169 | 3300006237 | Ga0097621_100064761 | Ga0097621_1000647613 | 317 |
| 170 | 3300006358 | Ga0068871_100057763 | Ga0068871_1000577632 | 317 |
| 171 | 3300006844 | Ga0075428_100310847 | Ga0075428_1003108472 | 317 |
| 172 | 3300006931 | Ga0097620_100044029 | Ga0097620_1000440294 | 317 |
| 173 | 3300009093 | Ga0105240_10060715 | Ga0105240_100607151 | 317 |
| 174 | 3300009098 | Ga0105245_10205744 | Ga0105245_102057442 | 317 |
| 175 | 3300009101 | Ga0105247_10007270 | Ga0105247_100072706 | 317 |
| 176 | 3300009176 | Ga0105242_10246733 | Ga0105242_102467332 | 317 |
| 177 | 3300009177 | Ga0105248_10105239 | Ga0105248_101052392 | 317 |
| 178 | 3300009551 | Ga0105238_10012954 | Ga0105238_100129546 | 317 |
| 179 | 3300010375 | Ga0105239_10042897 | Ga0105239_100428975 | 317 |
| 180 | 3300013297 | Ga0157378_10342704 | Ga0157378_103427042 | 317 |
| 181 | 3300013306 | Ga0163162_10006034 | Ga0163162_100060343 | 317 |
| 182 | 3300014325 | Ga0163163_10019235 | Ga0163163_100192352 | 317 |
| 183 | 3300014326 | Ga0157380_10016332 | Ga0157380_100163325 | 317 |
| 184 | 3300014968 | Ga0157379_10043631 | Ga0157379_100436312 | 317 |
| 185 | 3300014969 | Ga0157376_10350121 | Ga0157376_103501212 | 317 |
| 186 | 3300025900 | Ga0207710_10024427 | Ga0207710_100244273 | 317 |
| 187 | 3300025903 | Ga0207680_10040168 | Ga0207680_100401683 | 317 |
| 188 | 3300025912 | Ga0207707_10017944 | Ga0207707_100179445 | 317 |
| 189 | 3300025916 | Ga0207663_10049963 | Ga0207663_100499632 | 317 |
| 190 | 3300025918 | Ga0207662_10145213 | Ga0207662_101452132 | 317 |
| 191 | 3300025933 | Ga0207706_10151510 | Ga0207706_101515102 | 317 |
| 192 | 3300025936 | Ga0207670_10190478 | Ga0207670_101904782 | 317 |
| 193 | 3300025941 | Ga0207711_10049699 | Ga0207711_100496994 | 317 |
| 194 | 3300025944 | Ga0207661_10092697 | Ga0207661_100926972 | 317 |
| 195 | 3300025949 | Ga0207667_10105587 | Ga0207667_101055872 | 317 |
| 196 | 3300026078 | Ga0207702_10211786 | Ga0207702_102117862 | 317 |
| 197 | 3300026095 | Ga0207676_10070256 | Ga0207676_100702562 | 317 |
| 198 | 3300026142 | Ga0207698_10084114 | Ga0207698_100841142 | 317 |
| 199 | 3300028379 | Ga0268266_10021476 | Ga0268266_100214764 | 317 |
| 200 | 3300033180 | Ga0307510_10264833 | Ga0307510_102648332 | 317 |
| 201 | 3300035410 | Ga0373924_0032199 | Ga0373924_0032199_711_1715 | 317 |
| 202 | 3300036401 | Ga0373937_0005402 | Ga0373937_0005402_8463_9482 | 317 |
| 203 | 3300036401 | Ga0373937_0039259 | Ga0373937_0039259_1963_2982 | 317 |
| 204 | 3300045051 | Ga0451576_0093339 | Ga0451576_0093339_73_1092 | 317 |
| 205 | 3300048907 | Ga0496104_0001671 | Ga0496104_0001671_6279_7283 | 317 |
| 206 | 3300048907 | Ga0496104_0049451 | Ga0496104_0049451_2184_3203 | 317 |
| 207 | 3300048908 | Ga0496105_0000293 | Ga0496105_0000293_25356_26360 | 317 |
| 208 | 3300048910 | Ga0496107_0070668 | Ga0496107_0070668_558_1562 | 317 |
| 209 | 3300048912 | Ga0496109_0152725 | Ga0496109_0152725_775_1794 | 317 |
| 210 | 3300048915 | Ga0496112_0012599 | Ga0496112_0012599_1600_2619 | 317 |
| 211 | 3300048917 | Ga0496114_0000240 | Ga0496114_0000240_23871_24875 | 317 |
| 212 | 3300048918 | Ga0496115_0001302 | Ga0496115_0001302_4315_5319 | 317 |
| 213 | 3300048918 | Ga0496115_0197253 | Ga0496115_0197253_117_1136 | 317 |
| 214 | 3300053077 | Ga0495601_0009294 | Ga0495601_0009294_1899_2918 | 317 |
| 215 | 3300005336 | Ga0070680_100160648 | Ga0070680_1001606483 | 318 |
| 216 | 3300005530 | Ga0070679_100145083 | Ga0070679_1001450832 | 318 |
| 217 | 3300025921 | Ga0207652_10123730 | Ga0207652_101237302 | 318 |
| 218 | 3300049571 | Ga0501034_0176995 | Ga0501034_0176995_540_1571 | 318 |
| 219 | 3300031251 | Ga0265327_10000005 | Ga0265327_10000005515 | 319 |
| 220 | 3300002737 | JGI25162J39368_1001210 | JGI25162J39368_10012109 | 320 |
| 221 | 3300002737 | JGI25162J39368_1001215 | JGI25162J39368_10012159 | 320 |
| 222 | 3300002771 | JGI25163J39215_1000510 | JGI25163J39215_10005108 | 320 |
| 223 | 3300002772 | JGI25164J39214_1000624 | JGI25164J39214_10006249 | 320 |
| 224 | 3300003214 | JGI25165J46597_1000467 | JGI25165J46597_100046735 | 320 |
| 225 | 3300003751 | Ga0055538_1000088 | Ga0055538_100008812 | 320 |
| 226 | 3300025207 | Ga0209760_100269 | Ga0209760_10026912 | 320 |
| 227 | 3300025231 | Ga0207427_100008 | Ga0207427_100008403 | 320 |
| 228 | 3300025233 | Ga0209437_100014 | Ga0209437_100014308 | 320 |
| 229 | 3300025261 | Ga0209233_1000008 | Ga0209233_1000008308 | 320 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4itm-assembly1.cif.gz_A | "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" | 0.7927 | 17 | 315 |
| 8elf-assembly1.cif.gz_A | structure of get3d, a homolog of get3, from arabidopsis thaliana | 0.7851 | 51 | 91 |
| 4itm-assembly1.cif.gz_A | "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" | 0.7539 | 17 | 315 |
| 4hi0-assembly1.cif.gz_F | crystal structure of helicobacter pylori urease accessory protein uref/h/g complex | 0.7105 | 51 | 186 |
| 2j37-assembly1.cif.gz_W | model of mammalian srp bound to 80s rncs | 0.6877 | 44 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P27300_12_322_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.912 | 18 | 310 | 3.40.50.300 |
| af_I1KYA1_28_391_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8889 | 18 | 310 | 3.40.50.300 |
| af_A0A0P0X1P5_1_135_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8702 | 85 | 187 | 3.40.50.300 |
| af_P27300_12_322_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8597 | 18 | 310 | 3.40.50.300 |
| af_I1KYA1_28_391_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8153 | 18 | 310 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M5X691-F1-model_v4 | Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) | 0.9948 | 111 | 315 |
GO:0005524
GO:0005886 GO:0009029 GO:0009244 GO:0009245 |
| AF-A0A3M5X691-F1-model_v4 | Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) | 0.99 | 111 | 315 |
GO:0005524
GO:0005886 GO:0009029 GO:0009244 GO:0009245 |
| AF-V7D6J7-F1-model_v4 | Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) | 0.9855 | 167 | 313 |
GO:0005524
GO:0005886 GO:0009029 GO:0009244 GO:0009245 |
| AF-Q02PE4-F1-model_v4 | Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) | 0.9845 | 1 | 313 |
GO:0005524
GO:0005886 GO:0009029 GO:0009244 GO:0009245 |
| AF-A0A2R7T0N3-F1-model_v4 | deleted | 0.9831 | 145 | 320 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar