F342026

General Info

Members Datasets Scaffolds Average Seq Length
229 194 458 118

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10941114|Ga0157369_109411142
Length 126
Sequence MTKSITIYGIKNCDTMKKARTWLDSHGVAYDFHDYKTAGIAKDKLKGWSDELGWETLLNRAGTTFRKLPDGDKEGLNERKALALMMEQPSMIKRPVLDLGGKLLVGFKPELYASEVAPSRASGSAR

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
44 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
95 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
101 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
105 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
129 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
130 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
131 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
132 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
133 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
134 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
135 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
139 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
140 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
141 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
142 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
143 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
144 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
145 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
146 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
147 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
148 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
149 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
150 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
151 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
152 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
153 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
154 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
155 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
158 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
159 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
160 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
161 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
162 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
163 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
164 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
167 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
168 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
169 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
170 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
171 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
172 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
173 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
174 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
175 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
176 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
177 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
178 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
179 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
180 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
181 2738541293 Rhizobium sp. GV031 Isolate Unclassified
182 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
183 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
184 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
185 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
186 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
187 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
188 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
189 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
190 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
191 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
192 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
193 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
194 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.39
Metatranscriptomes 0
Isolates 9.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.23
Nodule 2.62
Rhizoplane 6.99
Rhizosphere 64.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10941114 3300013105 Bacteria 885
2 JGI25165J46597_1000444 3300003214 Bacteria 41650
3 rootH1_10179805 3300003323 Bacteria 4314
4 JGI25405J52794_10014753 3300003911 Bacteria 1530
5 Ga0070670_100160757 3300005331 Bacteria 1946
6 Ga0068868_100013309 3300005338 Bacteria 6030
7 Ga0070661_100086046 3300005344 Bacteria 2324
8 Ga0070667_100306772 3300005367 Bacteria 1430
9 Ga0070678_100036307 3300005456 Bacteria 3448
10 Ga0070684_101530718 3300005535 Bacteria 629
11 Ga0068853_100011395 3300005539 Bacteria 7221
12 Ga0070693_100296283 3300005547 Bacteria 1088
13 Ga0070665_100776819 3300005548 Bacteria 971
14 Ga0068855_101370731 3300005563 Bacteria 730
15 Ga0068856_101187209 3300005614 Bacteria 780
16 Ga0070702_100335678 3300005615 Bacteria 1059
17 Ga0068859_100279202 3300005617 Bacteria 1763
18 Ga0068863_101436523 3300005841 Bacteria 698
19 Ga0068860_100004563 3300005843 Bacteria 14131
20 Ga0081455_10001796 3300005937 Bacteria 25915
21 Ga0081455_10019440 3300005937 Bacteria 6426
22 Ga0081455_10029199 3300005937 Bacteria 5030
23 Ga0081540_1002120 3300005983 Bacteria 16520
24 Ga0081540_1018318 3300005983 Bacteria 4301
25 Ga0081540_1103943 3300005983 Bacteria 1217
26 Ga0081539_10001888 3300005985 Bacteria 32580
27 Ga0081539_10100177 3300005985 Bacteria 1478
28 Ga0075365_10042082 3300006038 Bacteria 2985
29 Ga0075365_10207488 3300006038 Bacteria 1373
30 Ga0097621_100114285 3300006237 Bacteria 2284
31 Ga0068871_100280445 3300006358 Bacteria 1458
32 Ga0075431_101266445 3300006847 Bacteria 699
33 Ga0097620_100279219 3300006931 Bacteria 1763
34 Ga0105245_10062889 3300009098 Bacteria 3350
35 Ga0105245_10166424 3300009098 Bacteria 2096
36 Ga0105243_11228298 3300009148 Bacteria 764
37 Ga0105242_10500083 3300009176 Bacteria 1156
38 Ga0105238_11624648 3300009551 Bacteria 676
39 Ga0105239_10124572 3300010375 Bacteria 2863
40 Ga0157373_10000212 3300013100 Bacteria 47705
41 Ga0163162_10094306 3300013306 Bacteria 3079
42 Ga0157375_10016380 3300013308 Bacteria 6657
43 Ga0163163_10056052 3300014325 Bacteria 3895
44 Ga0163163_11521886 3300014325 Bacteria 730
45 Ga0157376_10119391 3300014969 Bacteria 2334
46 Ga0163161_10875320 3300017792 Bacteria 759
47 Ga0163161_11438428 3300017792 Bacteria 603
48 Ga0213872_10031167 3300021361 Bacteria 2443
49 Ga0213876_10220951 3300021384 Bacteria 1007
50 Ga0209437_100050 3300025233 Bacteria 394010
51 Ga0209148_1003232 3300025254 Bacteria 4641
52 Ga0209233_1000037 3300025261 Bacteria 554620
53 Ga0209455_1008802 3300025272 Bacteria 2707
54 Ga0207656_10043162 3300025321 Bacteria 1922
55 Ga0207688_10028564 3300025901 Bacteria 3068
56 Ga0207693_10820718 3300025915 Bacteria 716
57 Ga0207694_11154927 3300025924 Bacteria 655
58 Ga0207687_10175138 3300025927 Bacteria 1658
59 Ga0207687_10790679 3300025927 Bacteria 809
60 Ga0207644_10368746 3300025931 Bacteria 1169
61 Ga0207686_10201657 3300025934 Bacteria 1425
62 Ga0207709_10175476 3300025935 Bacteria 1508
63 Ga0207709_10241959 3300025935 Bacteria 1313
64 Ga0207704_11799378 3300025938 Bacteria 527
65 Ga0207679_11393293 3300025945 Bacteria 643
66 Ga0207651_10799158 3300025960 Bacteria 836
67 Ga0207712_11318792 3300025961 Bacteria 645
68 Ga0207658_10270255 3300025986 Bacteria 1453
69 Ga0207677_10007817 3300026023 Bacteria 5937
70 Ga0207703_10127527 3300026035 Bacteria 2193
71 Ga0207639_10090597 3300026041 Bacteria 2446
72 Ga0207678_10048392 3300026067 Bacteria 3675
73 Ga0207641_11304615 3300026088 Bacteria 726
74 Ga0207683_10308824 3300026121 Bacteria 1447
75 Ga0207683_11970906 3300026121 Bacteria 532
76 Ga0207698_10452404 3300026142 Bacteria 1240
77 Ga0268266_10140104 3300028379 Bacteria 2170
78 Ga0268265_10395273 3300028380 Bacteria 1276
79 Ga0268264_10000149 3300028381 Bacteria 163972
80 Ga0265338_10529254 3300028800 Bacteria 827
81 Ga0307511_10078687 3300030521 Bacteria 2336
82 Ga0307509_10006266 3300031507 Bacteria 16079
83 Ga0307509_10494020 3300031507 Bacteria 909
84 Ga0307509_10703253 3300031507 Bacteria 677
85 Ga0307508_10009580 3300031616 Bacteria 8900
86 Ga0307516_10049960 3300031730 Bacteria 4105
87 Ga0307516_10187797 3300031730 Bacteria 1795
88 Ga0307412_11847348 3300031911 Bacteria 556
89 Ga0307416_102385372 3300032002 Bacteria 629
90 Ga0373931_0561866 3300035691 Bacteria 742
91 Ga0373931_1092708 3300035691 Bacteria 543
92 Ga0373935_0255068 3300035692 Bacteria 1228
93 Ga0373935_0301709 3300035692 Bacteria 1132
94 Ga0373927_0245695 3300035695 Bacteria 1176
95 Ga0373927_0358800 3300035695 Bacteria 961
96 Ga0373925_0173785 3300037068 Bacteria 1702
97 Ga0373925_0911429 3300037068 Bacteria 724
98 Ga0395899_0094698 3300037312 Bacteria 2160
99 Ga0395900_0092312 3300037418 Bacteria 3110
100 Ga0395898_0012916 3300037466 Bacteria 8613
101 Ga0395898_0041224 3300037466 Bacteria 4561
102 Ga0436364_0771246 3300037853 Bacteria 1345
103 Ga0395901_0093085 3300038443 Bacteria 3155
104 Ga0395901_0368854 3300038443 Bacteria 1479
105 Ga0395901_1999946 3300038443 Bacteria 526
106 Ga0237819_02012 3300038705 Bacteria 4528
107 Ga0436365_1745436 3300039437 Bacteria 2601
108 Ga0436361_0359530 3300039447 Bacteria 18918
109 Ga0436361_1128142 3300039447 Bacteria 1143
110 Ga0436363_0823739 3300039450 Bacteria 542
111 Ga0451800_0965341 3300041459 Bacteria 590
112 Ga0466966_0138986 3300044684 Bacteria 1485
113 Ga0466957_1428441 3300044842 Bacteria 504
114 Ga0466959_1221067 3300045049 Bacteria 500
115 Ga0451576_2405985 3300045051 Bacteria 539
116 Ga0495603_0020734 3300046455 Bacteria 3980
117 Ga0495605_0095897 3300046474 Bacteria 1369
118 Ga0495596_0216309 3300046500 Bacteria 744
119 Ga0495606_0636813 3300046507 Bacteria 518
120 Ga0495608_0296160 3300046511 Bacteria 1002
121 Ga0495666_0290784 3300046526 Bacteria 740
122 Ga0495668_0222668 3300046616 Bacteria 1033
123 Ga0495588_0300304 3300046674 Bacteria 845
124 Ga0495669_0603346 3300046684 Bacteria 534
125 Ga0495613_0001087 3300046689 Bacteria 20759
126 Ga0495670_0010890 3300046691 Bacteria 4468
127 Ga0495589_0151571 3300046794 Bacteria 1107
128 Ga0495681_0281414 3300047470 Bacteria 648
129 Ga0495686_0408983 3300047472 Bacteria 727
130 Ga0495593_0554382 3300047673 Bacteria 577
131 Ga0496102_0014728 3300048905 Bacteria 6798
132 Ga0496102_0998215 3300048905 Bacteria 758
133 Ga0496104_0045337 3300048907 Bacteria 4134
134 Ga0496105_0199245 3300048908 Bacteria 1634
135 Ga0496106_0116713 3300048909 Bacteria 2082
136 Ga0496107_0050354 3300048910 Bacteria 3003
137 Ga0496108_0061574 3300048911 Bacteria 3158
138 Ga0496109_0070654 3300048912 Bacteria 3204
139 Ga0496110_0022908 3300048913 Bacteria 5307
140 Ga0496111_0017849 3300048914 Bacteria 4908
141 Ga0496112_0128515 3300048915 Bacteria 2504
142 Ga0496113_0659425 3300048916 Bacteria 836
143 Ga0496114_0025073 3300048917 Bacteria 4871
144 Ga0496115_0002254 3300048918 Bacteria 13806
145 Ga0496117_0186049 3300048920 Bacteria 1188
146 Ga0496119_0301952 3300048922 Bacteria 789
147 Ga0496120_0160374 3300048923 Bacteria 1122
148 Ga0496120_0179896 3300048923 Bacteria 1039
149 Ga0496121_0665507 3300048924 Bacteria 632
150 Ga0496122_0116825 3300048925 Bacteria 1733
151 Ga0496125_0005748 3300048928 Bacteria 13643
152 Ga0496125_0022513 3300048928 Bacteria 5849
153 Ga0496125_0104259 3300048928 Bacteria 2078
154 Ga0496126_0000542 3300048929 Bacteria 73066
155 Ga0496126_0146387 3300048929 Bacteria 2028
156 Ga0501290_000091 3300049513 Bacteria 13104
157 Ga0501292_000377 3300049515 Bacteria 6005
158 Ga0501293_004325 3300049516 Bacteria 1117
159 Ga0501294_000363 3300049517 Bacteria 5496
160 Ga0501297_006539 3300049520 Bacteria 1246
161 Ga0501300_007754 3300049523 Bacteria 1573
162 Ga0501301_000699 3300049524 Bacteria 2074
163 Ga0501302_028755 3300049525 Bacteria 518
164 Ga0501031_0379399 3300049568 Bacteria 915
165 Ga0501046_1266667 3300049580 Bacteria 505
166 Ga0501202_003852 3300049652 Bacteria 2592
167 Ga0501206_024481 3300049653 Bacteria 874
168 Ga0501207_011310 3300049654 Bacteria 1328
169 Ga0501222_000639 3300049662 Bacteria 5132
170 Ga0501223_001036 3300049663 Bacteria 6560
171 Ga0501223_072336 3300049663 Bacteria 682
172 Ga0501233_006695 3300049668 Bacteria 2172
173 Ga0501235_008912 3300049669 Bacteria 2188
174 Ga0501236_005155 3300049670 Bacteria 1574
175 Ga0501259_015290 3300049688 Bacteria 1309
176 Ga0501261_000051 3300049690 Bacteria 22280
177 Ga0501225_0038858 3300049705 Bacteria 1311
178 Ga0501245_010130 3300049708 Bacteria 1359
179 Ga0501264_004756 3300049761 Bacteria 1230
180 Ga0501279_000364 3300049775 Bacteria 6061
181 Ga0501280_000100 3300049776 Bacteria 22874
182 Ga0501281_00885 3300049777 Bacteria 2529
183 Ga0501282_000903 3300049778 Bacteria 3363
184 Ga0501283_018272 3300049779 Bacteria 1102
185 Ga0495601_0136060 3300053077 Bacteria 1602
186 Ga0495601_0559063 3300053077 Bacteria 736
187 Ga0500643_003845 3300053087 Bacteria 6989
188 Ga0500651_0107827 3300053093 Bacteria 1702
189 Ga0500566_0274458 3300053094 Bacteria 807
190 Ga0500641_0004741 3300053096 Bacteria 4810
191 Ga0500554_049971 3300053102 Bacteria 1313
192 Ga0500555_052432 3300053103 Bacteria 1114
193 Ga0500608_258058 3300053122 Bacteria 675
194 Ga0500652_070295 3300053131 Bacteria 1450
195 Ga0500559_0514361 3300053136 Bacteria 549
196 Ga0500573_0157678 3300053140 Bacteria 1237
197 Ga0500573_0539478 3300053140 Bacteria 519
198 Ga0500603_000554 3300053150 Bacteria 9409
199 Ga0500603_003570 3300053150 Bacteria 3331
200 Ga0500624_038835 3300053157 Bacteria 848
201 Ga0500636_0180237 3300053177 Bacteria 1135
202 Ga0500636_0221327 3300053177 Bacteria 986
203 Ga0500636_0337856 3300053177 Bacteria 724
204 Ga0500637_0004167 3300053178 Bacteria 6814
205 Ga0500637_0232800 3300053178 Bacteria 1036
206 Ga0500567_201760 3300053723 Bacteria 662
207 Ga0500657_175825 3300053728 Bacteria 751
208 2524457992 2524023209 Bacteria 6679728
209 2585223349 2582581298 Bacteria 7315509
210 2585326359 2582581315 Bacteria 7318924
211 2585330514 2582581316 Bacteria 7774528
212 2585546055 2585427529 Bacteria 7395659
213 2616556182 2615840698 Bacteria 7319877
214 2643778635 2643221552 Bacteria 5708754
215 2671114028 2667528174 Bacteria 6435400
216 2738800878 2738541293 Bacteria 7065685
217 2819608774 2818991448 Bacteria 6772224
218 2842299827 2842298080 Bacteria 6123127
219 2842359651 2842357229 Bacteria 6485165
220 2842485991 2842482326 Bacteria 7212537
221 2885388680 2885383462 Bacteria 9473874
222 2909399556 2909399089 Bacteria 3922598
223 2919408430 2919408235 Bacteria 6149349
224 3005423194 3005416602 Bacteria 7064308
225 8005315521 8005314921 Bacteria 7072929
226 8005649268 8005645114 Bacteria 6950293
227 8005685497 8005682033 Bacteria 6726518
228 8046769666 8046767195 Bacteria 7547379
229 8057582336 8057575449 Bacteria 7367519
230 Ga0157369_10941114
231 JGI25165J46597_1000444
232 rootH1_10179805
233 JGI25405J52794_10014753
234 Ga0070670_100160757
235 Ga0068868_100013309
236 Ga0070661_100086046
237 Ga0070667_100306772
238 Ga0070678_100036307
239 Ga0070684_101530718
240 Ga0068853_100011395
241 Ga0070693_100296283
242 Ga0070665_100776819
243 Ga0068855_101370731
244 Ga0068856_101187209
245 Ga0070702_100335678
246 Ga0068859_100279202
247 Ga0068863_101436523
248 Ga0068860_100004563
249 Ga0081455_10001796
250 Ga0081455_10019440
251 Ga0081455_10029199
252 Ga0081540_1002120
253 Ga0081540_1018318
254 Ga0081540_1103943
255 Ga0081539_10001888
256 Ga0081539_10100177
257 Ga0075365_10042082
258 Ga0075365_10207488
259 Ga0097621_100114285
260 Ga0068871_100280445
261 Ga0075431_101266445
262 Ga0097620_100279219
263 Ga0105245_10062889
264 Ga0105245_10166424
265 Ga0105243_11228298
266 Ga0105242_10500083
267 Ga0105238_11624648
268 Ga0105239_10124572
269 Ga0157373_10000212
270 Ga0163162_10094306
271 Ga0157375_10016380
272 Ga0163163_10056052
273 Ga0163163_11521886
274 Ga0157376_10119391
275 Ga0163161_10875320
276 Ga0163161_11438428
277 Ga0213872_10031167
278 Ga0213876_10220951
279 Ga0209437_100050
280 Ga0209148_1003232
281 Ga0209233_1000037
282 Ga0209455_1008802
283 Ga0207656_10043162
284 Ga0207688_10028564
285 Ga0207693_10820718
286 Ga0207694_11154927
287 Ga0207687_10175138
288 Ga0207687_10790679
289 Ga0207644_10368746
290 Ga0207686_10201657
291 Ga0207709_10175476
292 Ga0207709_10241959
293 Ga0207704_11799378
294 Ga0207679_11393293
295 Ga0207651_10799158
296 Ga0207712_11318792
297 Ga0207658_10270255
298 Ga0207677_10007817
299 Ga0207703_10127527
300 Ga0207639_10090597
301 Ga0207678_10048392
302 Ga0207641_11304615
303 Ga0207683_10308824
304 Ga0207683_11970906
305 Ga0207698_10452404
306 Ga0268266_10140104
307 Ga0268265_10395273
308 Ga0268264_10000149
309 Ga0265338_10529254
310 Ga0307511_10078687
311 Ga0307509_10006266
312 Ga0307509_10494020
313 Ga0307509_10703253
314 Ga0307508_10009580
315 Ga0307516_10049960
316 Ga0307516_10187797
317 Ga0307412_11847348
318 Ga0307416_102385372
319 Ga0373931_0561866
320 Ga0373931_1092708
321 Ga0373935_0255068
322 Ga0373935_0301709
323 Ga0373927_0245695
324 Ga0373927_0358800
325 Ga0373925_0173785
326 Ga0373925_0911429
327 Ga0395899_0094698
328 Ga0395900_0092312
329 Ga0395898_0012916
330 Ga0395898_0041224
331 Ga0436364_0771246
332 Ga0395901_0093085
333 Ga0395901_0368854
334 Ga0395901_1999946
335 Ga0237819_02012
336 Ga0436365_1745436
337 Ga0436361_0359530
338 Ga0436361_1128142
339 Ga0436363_0823739
340 Ga0451800_0965341
341 Ga0466966_0138986
342 Ga0466957_1428441
343 Ga0466959_1221067
344 Ga0451576_2405985
345 Ga0495603_0020734
346 Ga0495605_0095897
347 Ga0495596_0216309
348 Ga0495606_0636813
349 Ga0495608_0296160
350 Ga0495666_0290784
351 Ga0495668_0222668
352 Ga0495588_0300304
353 Ga0495669_0603346
354 Ga0495613_0001087
355 Ga0495670_0010890
356 Ga0495589_0151571
357 Ga0495681_0281414
358 Ga0495686_0408983
359 Ga0495593_0554382
360 Ga0496102_0014728
361 Ga0496102_0998215
362 Ga0496104_0045337
363 Ga0496105_0199245
364 Ga0496106_0116713
365 Ga0496107_0050354
366 Ga0496108_0061574
367 Ga0496109_0070654
368 Ga0496110_0022908
369 Ga0496111_0017849
370 Ga0496112_0128515
371 Ga0496113_0659425
372 Ga0496114_0025073
373 Ga0496115_0002254
374 Ga0496117_0186049
375 Ga0496119_0301952
376 Ga0496120_0160374
377 Ga0496120_0179896
378 Ga0496121_0665507
379 Ga0496122_0116825
380 Ga0496125_0005748
381 Ga0496125_0022513
382 Ga0496125_0104259
383 Ga0496126_0000542
384 Ga0496126_0146387
385 Ga0501290_000091
386 Ga0501292_000377
387 Ga0501293_004325
388 Ga0501294_000363
389 Ga0501297_006539
390 Ga0501300_007754
391 Ga0501301_000699
392 Ga0501302_028755
393 Ga0501031_0379399
394 Ga0501046_1266667
395 Ga0501202_003852
396 Ga0501206_024481
397 Ga0501207_011310
398 Ga0501222_000639
399 Ga0501223_001036
400 Ga0501223_072336
401 Ga0501233_006695
402 Ga0501235_008912
403 Ga0501236_005155
404 Ga0501259_015290
405 Ga0501261_000051
406 Ga0501225_0038858
407 Ga0501245_010130
408 Ga0501264_004756
409 Ga0501279_000364
410 Ga0501280_000100
411 Ga0501281_00885
412 Ga0501282_000903
413 Ga0501283_018272
414 Ga0495601_0136060
415 Ga0495601_0559063
416 Ga0500643_003845
417 Ga0500651_0107827
418 Ga0500566_0274458
419 Ga0500641_0004741
420 Ga0500554_049971
421 Ga0500555_052432
422 Ga0500608_258058
423 Ga0500652_070295
424 Ga0500559_0514361
425 Ga0500573_0157678
426 Ga0500573_0539478
427 Ga0500603_000554
428 Ga0500603_003570
429 Ga0500624_038835
430 Ga0500636_0180237
431 Ga0500636_0221327
432 Ga0500636_0337856
433 Ga0500637_0004167
434 Ga0500637_0232800
435 Ga0500567_201760
436 Ga0500657_175825
437 2524457992
438 2585223349
439 2585326359
440 2585330514
441 2585546055
442 2616556182
443 2643778635
444 2671114028
445 2738800878
446 2819608774
447 2842299827
448 2842359651
449 2842485991
450 2885388680
451 2909399556
452 2919408430
453 3005423194
454 8005315521
455 8005649268
456 8005685497
457 8046769666
458 8057582336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

8

114

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9786 3 113
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9452 3 113
6uih-assembly1.cif.gz_A crystal structure of the core domain from the gst-like protein gdap1 0.9185 1 32
8a4j-assembly1.cif.gz_A human gdap1, a247v mutant 0.9034 2 32
7ywd-assembly2.cif.gz_C human gdap1 core domain, trigonal crystal form 0.9031 2 32
ID Description Score Start End Superfamily
1rw1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9778 3 113 3.40.30.10
af_P24178_1_117_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.947 3 116 3.40.30.10
1rw1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9435 3 113 3.40.30.10
3cbuB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9378 4 31 3.40.30.10
af_P24178_1_117_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9162 3 116 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1W9JND3-F1-model_v4 deleted 0.9965 3 114
AF-A0A387FND1-F1-model_v4 ArsC family reductase 0.9943 1 118
AF-A0A0N1CB80-F1-model_v4 ArsC family transcriptional regulator 0.9935 14 114
AF-A0A353XZM6-F1-model_v4 ArsC family reductase 0.9932 4 94
AF-A0A7V9MYQ8-F1-model_v4 ArsC family reductase 0.9928 3 114

Map