F341952
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 229 | 163 | 229 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300009011|Ga0105251_10184366|Ga0105251_101843662 |
| Length | 182 |
| Sequence | MTLLTAEELLAGAALTHRVRLPSHLAPSSPVPDGVRPVDDAAAAEVVVRPLVLADIVRLNRAAGDDGDLAGAFMVHQALVEPRLSLEEVHRLPAGLVEFLLGEVNRVSGLSVHEDDLHEAVHAPLARACFVLAREFGWTPQRCAELTVGQLLLYLEMLGRGDVQAGAGATSPAGESLVGMGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 77 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 78 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 79 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 80 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 121 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 123 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 124 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 126 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 138 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 139 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 140 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 141 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 142 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 143 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 149 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 152 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 153 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 154 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 161 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.25 |
| Metatranscriptomes | 1.75 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.31 |
| Nodule | 0 |
| Rhizoplane | 1.75 |
| Rhizosphere | 92.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10213091 | 3300003323 | Bacteria | 1181 |
| 2 | Ga0065715_10091404 | 3300005293 | Bacteria | 5798 |
| 3 | Ga0070676_10065863 | 3300005328 | Bacteria | 2164 |
| 4 | Ga0070670_100421263 | 3300005331 | Bacteria | 1180 |
| 5 | Ga0070677_10182789 | 3300005333 | Bacteria | 1000 |
| 6 | Ga0068869_100002690 | 3300005334 | Bacteria | 10751 |
| 7 | Ga0068869_100117535 | 3300005334 | Bacteria | 2030 |
| 8 | Ga0068869_100329427 | 3300005334 | Bacteria | 1240 |
| 9 | Ga0068869_101185689 | 3300005334 | Unclassified | 671 |
| 10 | Ga0070666_10241169 | 3300005335 | Bacteria | 1278 |
| 11 | Ga0070666_10448393 | 3300005335 | Unclassified | 931 |
| 12 | Ga0068868_100060838 | 3300005338 | Bacteria | 2991 |
| 13 | Ga0068868_100623382 | 3300005338 | Unclassified | 958 |
| 14 | Ga0070687_100158838 | 3300005343 | Bacteria | 1334 |
| 15 | Ga0070687_100233222 | 3300005343 | Unclassified | 1134 |
| 16 | Ga0070687_100511250 | 3300005343 | Bacteria | 810 |
| 17 | Ga0070692_10203482 | 3300005345 | Bacteria | 1161 |
| 18 | Ga0070668_100077814 | 3300005347 | Bacteria | 2593 |
| 19 | Ga0070675_100011432 | 3300005354 | Bacteria | 6948 |
| 20 | Ga0070675_100118562 | 3300005354 | Bacteria | 2247 |
| 21 | Ga0070671_100968597 | 3300005355 | Bacteria | 745 |
| 22 | Ga0070671_101472945 | 3300005355 | Unclassified | 602 |
| 23 | Ga0070674_100101676 | 3300005356 | Bacteria | 2095 |
| 24 | Ga0070674_100168572 | 3300005356 | Bacteria | 1667 |
| 25 | Ga0070673_100399829 | 3300005364 | Bacteria | 1228 |
| 26 | Ga0070688_100390607 | 3300005365 | Bacteria | 1028 |
| 27 | Ga0070659_100951260 | 3300005366 | Bacteria | 752 |
| 28 | Ga0070667_100049666 | 3300005367 | Bacteria | 3534 |
| 29 | Ga0070713_100007687 | 3300005436 | Bacteria | 7587 |
| 30 | Ga0070710_10077291 | 3300005437 | Bacteria | 1934 |
| 31 | Ga0070710_10167409 | 3300005437 | Bacteria | 1367 |
| 32 | Ga0070701_10005875 | 3300005438 | Bacteria | 5120 |
| 33 | Ga0070701_11140502 | 3300005438 | Unclassified | 550 |
| 34 | Ga0070711_100134706 | 3300005439 | Bacteria | 1845 |
| 35 | Ga0070711_101722286 | 3300005439 | Unclassified | 549 |
| 36 | Ga0070705_100024425 | 3300005440 | Unclassified | 3262 |
| 37 | Ga0070705_100145336 | 3300005440 | Bacteria | 1566 |
| 38 | Ga0070705_100257565 | 3300005440 | Bacteria | 1228 |
| 39 | Ga0070700_100054115 | 3300005441 | Unclassified | 2507 |
| 40 | Ga0070700_100570012 | 3300005441 | Bacteria | 882 |
| 41 | Ga0070694_100042721 | 3300005444 | Bacteria | 3029 |
| 42 | Ga0070694_100190066 | 3300005444 | Bacteria | 1524 |
| 43 | Ga0070663_100182178 | 3300005455 | Bacteria | 1630 |
| 44 | Ga0070678_100017963 | 3300005456 | Bacteria | 4571 |
| 45 | Ga0070678_100070066 | 3300005456 | Bacteria | 2620 |
| 46 | Ga0070681_10084039 | 3300005458 | Unclassified | 3136 |
| 47 | Ga0068867_100039469 | 3300005459 | Unclassified | 3442 |
| 48 | Ga0068867_100065027 | 3300005459 | Bacteria | 2713 |
| 49 | Ga0068867_100120495 | 3300005459 | Bacteria | 2027 |
| 50 | Ga0068867_100208206 | 3300005459 | Bacteria | 1569 |
| 51 | Ga0070685_10764635 | 3300005466 | Bacteria | 709 |
| 52 | Ga0070707_100005468 | 3300005468 | Bacteria | 11877 |
| 53 | Ga0070684_100774337 | 3300005535 | Bacteria | 896 |
| 54 | Ga0070672_100313410 | 3300005543 | Bacteria | 1332 |
| 55 | Ga0070686_100073183 | 3300005544 | Bacteria | 2249 |
| 56 | Ga0070695_100210915 | 3300005545 | Bacteria | 1394 |
| 57 | Ga0070695_101241966 | 3300005545 | Bacteria | 614 |
| 58 | Ga0070696_100271655 | 3300005546 | Unclassified | 1289 |
| 59 | Ga0070696_100451544 | 3300005546 | Bacteria | 1014 |
| 60 | Ga0070693_100007417 | 3300005547 | Bacteria | 5361 |
| 61 | Ga0070665_100309148 | 3300005548 | Bacteria | 1584 |
| 62 | Ga0070665_100779169 | 3300005548 | Bacteria | 969 |
| 63 | Ga0070704_100073773 | 3300005549 | Bacteria | 2487 |
| 64 | Ga0068857_100193968 | 3300005577 | Bacteria | 1850 |
| 65 | Ga0068856_100039023 | 3300005614 | Unclassified | 4663 |
| 66 | Ga0070702_100013246 | 3300005615 | Bacteria | 4159 |
| 67 | Ga0070702_100035794 | 3300005615 | Unclassified | 2745 |
| 68 | Ga0070702_100385582 | 3300005615 | Bacteria | 998 |
| 69 | Ga0068859_100058282 | 3300005617 | Bacteria | 3890 |
| 70 | Ga0068864_100283274 | 3300005618 | Bacteria | 1548 |
| 71 | Ga0068861_100755973 | 3300005719 | Bacteria | 908 |
| 72 | Ga0068870_10045399 | 3300005840 | Bacteria | 2300 |
| 73 | Ga0068858_100318544 | 3300005842 | Bacteria | 1486 |
| 74 | Ga0068860_100000419 | 3300005843 | Bacteria | 54802 |
| 75 | Ga0068860_100185957 | 3300005843 | Bacteria | 2009 |
| 76 | Ga0068862_100051405 | 3300005844 | Bacteria | 3525 |
| 77 | Ga0068862_100232097 | 3300005844 | Bacteria | 1674 |
| 78 | Ga0068862_100439122 | 3300005844 | Unclassified | 1228 |
| 79 | Ga0068862_100532687 | 3300005844 | Bacteria | 1119 |
| 80 | Ga0081455_10089521 | 3300005937 | Unclassified | 2497 |
| 81 | Ga0070717_10056304 | 3300006028 | Bacteria | 3248 |
| 82 | Ga0075364_10019934 | 3300006051 | Bacteria | 4214 |
| 83 | Ga0097621_100061156 | 3300006237 | Bacteria | 3088 |
| 84 | Ga0097621_100072670 | 3300006237 | Bacteria | 2845 |
| 85 | Ga0068871_100044641 | 3300006358 | Bacteria | 3565 |
| 86 | Ga0068871_100090138 | 3300006358 | Bacteria | 2553 |
| 87 | Ga0075428_100034297 | 3300006844 | Bacteria | 5599 |
| 88 | Ga0075430_100112037 | 3300006846 | Bacteria | 2275 |
| 89 | Ga0075431_100402251 | 3300006847 | Bacteria | 1370 |
| 90 | Ga0075434_100169952 | 3300006871 | Bacteria | 2200 |
| 91 | Ga0068865_100011735 | 3300006881 | Bacteria | 5488 |
| 92 | Ga0068865_100056366 | 3300006881 | Bacteria | 2737 |
| 93 | Ga0068865_100144732 | 3300006881 | Bacteria | 1796 |
| 94 | Ga0097620_100058282 | 3300006931 | Bacteria | 3890 |
| 95 | Ga0075435_100362566 | 3300007076 | Bacteria | 1243 |
| 96 | Ga0075435_101274774 | 3300007076 | Unclassified | 643 |
| 97 | Ga0099794_10052288 | 3300007265 | Unclassified | 1969 |
| 98 | Ga0105251_10184366 | 3300009011 | Bacteria | 940 |
| 99 | Ga0105245_10698749 | 3300009098 | Bacteria | 1047 |
| 100 | Ga0105247_10000037 | 3300009101 | Bacteria | 165929 |
| 101 | Ga0105242_10002070 | 3300009176 | Bacteria | 15822 |
| 102 | Ga0105242_10049058 | 3300009176 | Bacteria | 3434 |
| 103 | Ga0105248_10008194 | 3300009177 | Bacteria | 11478 |
| 104 | Ga0105248_10372454 | 3300009177 | Bacteria | 1608 |
| 105 | Ga0105248_10795523 | 3300009177 | Unclassified | 1067 |
| 106 | Ga0105249_11615933 | 3300009553 | Bacteria | 721 |
| 107 | Ga0157369_11632837 | 3300013105 | Unclassified | 655 |
| 108 | Ga0157378_10181838 | 3300013297 | Unclassified | 1978 |
| 109 | Ga0157378_10420788 | 3300013297 | Bacteria | 1320 |
| 110 | Ga0163162_10072595 | 3300013306 | Bacteria | 3497 |
| 111 | Ga0163162_10203455 | 3300013306 | Bacteria | 2109 |
| 112 | Ga0157375_10955596 | 3300013308 | Unclassified | 998 |
| 113 | Ga0157380_10276026 | 3300014326 | Bacteria | 1535 |
| 114 | Ga0157380_10283207 | 3300014326 | Bacteria | 1518 |
| 115 | Ga0157380_12396351 | 3300014326 | Unclassified | 593 |
| 116 | Ga0157379_10101627 | 3300014968 | Bacteria | 2580 |
| 117 | Ga0157379_10227421 | 3300014968 | Bacteria | 1691 |
| 118 | Ga0157376_10021270 | 3300014969 | Bacteria | 5038 |
| 119 | Ga0157376_10423351 | 3300014969 | Bacteria | 1293 |
| 120 | Ga0213872_10029960 | 3300021361 | Bacteria | 2496 |
| 121 | Ga0213874_10027527 | 3300021377 | Bacteria | 1618 |
| 122 | Ga0213876_10037244 | 3300021384 | Bacteria | 2566 |
| 123 | Ga0213871_10000892 | 3300021441 | Bacteria | 4558 |
| 124 | Ga0209257_1011176 | 3300025304 | Bacteria | 4371 |
| 125 | Ga0207697_10205850 | 3300025315 | Bacteria | 866 |
| 126 | Ga0207713_1124849 | 3300025735 | Bacteria | 859 |
| 127 | Ga0207682_10123077 | 3300025893 | Bacteria | 1152 |
| 128 | Ga0207710_10000059 | 3300025900 | Bacteria | 171838 |
| 129 | Ga0207680_10081190 | 3300025903 | Bacteria | 2038 |
| 130 | Ga0207680_10125098 | 3300025903 | Bacteria | 1687 |
| 131 | Ga0207645_10088069 | 3300025907 | Bacteria | 1995 |
| 132 | Ga0207643_10001865 | 3300025908 | Bacteria | 11656 |
| 133 | Ga0207707_10104757 | 3300025912 | Unclassified | 2472 |
| 134 | Ga0207663_10158576 | 3300025916 | Bacteria | 1595 |
| 135 | Ga0207662_10017491 | 3300025918 | Bacteria | 4057 |
| 136 | Ga0207652_10096413 | 3300025921 | Unclassified | 2606 |
| 137 | Ga0207646_10006258 | 3300025922 | Bacteria | 12353 |
| 138 | Ga0207659_10115422 | 3300025926 | Bacteria | 2048 |
| 139 | Ga0207687_10383705 | 3300025927 | Bacteria | 1152 |
| 140 | Ga0207700_10190409 | 3300025928 | Bacteria | 1723 |
| 141 | Ga0207664_10007711 | 3300025929 | Bacteria | 7471 |
| 142 | Ga0207644_10734893 | 3300025931 | Unclassified | 824 |
| 143 | Ga0207644_10773994 | 3300025931 | Bacteria | 802 |
| 144 | Ga0207706_11497178 | 3300025933 | Unclassified | 551 |
| 145 | Ga0207686_10003081 | 3300025934 | Bacteria | 8978 |
| 146 | Ga0207686_10119785 | 3300025934 | Bacteria | 1789 |
| 147 | Ga0207670_10043058 | 3300025936 | Bacteria | 2980 |
| 148 | Ga0207670_10350757 | 3300025936 | Unclassified | 1168 |
| 149 | Ga0207669_10035917 | 3300025937 | Bacteria | 2826 |
| 150 | Ga0207704_10022673 | 3300025938 | Bacteria | 3370 |
| 151 | Ga0207704_10129914 | 3300025938 | Bacteria | 1742 |
| 152 | Ga0207704_10182475 | 3300025938 | Bacteria | 1518 |
| 153 | Ga0207704_10748481 | 3300025938 | Bacteria | 813 |
| 154 | Ga0207691_10005394 | 3300025940 | Bacteria | 12347 |
| 155 | Ga0207691_10221616 | 3300025940 | Bacteria | 1640 |
| 156 | Ga0207711_10055548 | 3300025941 | Bacteria | 3399 |
| 157 | Ga0207711_11194073 | 3300025941 | Unclassified | 702 |
| 158 | Ga0207689_10033622 | 3300025942 | Unclassified | 4260 |
| 159 | Ga0207689_10107674 | 3300025942 | Bacteria | 2290 |
| 160 | Ga0207651_10161517 | 3300025960 | Bacteria | 1757 |
| 161 | Ga0207651_10259020 | 3300025960 | Bacteria | 1427 |
| 162 | Ga0207658_10136945 | 3300025986 | Bacteria | 1976 |
| 163 | Ga0207677_10222914 | 3300026023 | Bacteria | 1513 |
| 164 | Ga0207677_10634241 | 3300026023 | Unclassified | 941 |
| 165 | Ga0207678_10274124 | 3300026067 | Bacteria | 1447 |
| 166 | Ga0207708_10005886 | 3300026075 | Bacteria | 9069 |
| 167 | Ga0207702_10372084 | 3300026078 | Unclassified | 1372 |
| 168 | Ga0207641_10194203 | 3300026088 | Bacteria | 1867 |
| 169 | Ga0207648_10039075 | 3300026089 | Bacteria | 4173 |
| 170 | Ga0207648_10148930 | 3300026089 | Bacteria | 2065 |
| 171 | Ga0207648_10441026 | 3300026089 | Bacteria | 1184 |
| 172 | Ga0207676_10073371 | 3300026095 | Unclassified | 2754 |
| 173 | Ga0207674_10005757 | 3300026116 | Bacteria | 14703 |
| 174 | Ga0207675_100012762 | 3300026118 | Bacteria | 7849 |
| 175 | Ga0207683_10049484 | 3300026121 | Bacteria | 3680 |
| 176 | Ga0207683_10091640 | 3300026121 | Bacteria | 2708 |
| 177 | Ga0268265_10035869 | 3300028380 | Bacteria | 3628 |
| 178 | Ga0268265_10196329 | 3300028380 | Bacteria | 1747 |
| 179 | Ga0268265_10876254 | 3300028380 | Unclassified | 880 |
| 180 | Ga0268265_11594982 | 3300028380 | Unclassified | 657 |
| 181 | Ga0268264_10001500 | 3300028381 | Bacteria | 21760 |
| 182 | Ga0268264_10114691 | 3300028381 | Bacteria | 2366 |
| 183 | Ga0265318_10160944 | 3300028577 | Bacteria | 823 |
| 184 | Ga0265324_10000052 | 3300029957 | Bacteria | 97159 |
| 185 | Ga0307508_10144262 | 3300031616 | Unclassified | 1985 |
| 186 | Ga0316579_10160225 | 3300031691 | Unclassified | 1087 |
| 187 | Ga0265314_10006121 | 3300031711 | Bacteria | 10690 |
| 188 | Ga0307516_10011796 | 3300031730 | Bacteria | 9474 |
| 189 | Ga0316577_10043784 | 3300031733 | Unclassified | 2504 |
| 190 | Ga0307416_101711588 | 3300032002 | Bacteria | 733 |
| 191 | Ga0316593_10000174 | 3300032168 | Bacteria | 9549 |
| 192 | Ga0316593_10105112 | 3300032168 | Bacteria | 1005 |
| 193 | Ga0316596_1045038 | 3300033541 | Bacteria | 1163 |
| 194 | Ga0373927_0843027 | 3300035695 | Unclassified | 605 |
| 195 | Ga0373937_1169615 | 3300036401 | Bacteria | 718 |
| 196 | Ga0373937_1271060 | 3300036401 | Bacteria | 684 |
| 197 | Ga0395899_0010847 | 3300037312 | Bacteria | 6984 |
| 198 | Ga0395900_0047902 | 3300037418 | Bacteria | 4403 |
| 199 | Ga0395900_0790914 | 3300037418 | Bacteria | 877 |
| 200 | Ga0395898_0080896 | 3300037466 | Bacteria | 3133 |
| 201 | Ga0436364_0000349 | 3300037853 | Bacteria | 3592 |
| 202 | Ga0395901_0002479 | 3300038443 | Bacteria | 18725 |
| 203 | Ga0436365_0329556 | 3300039437 | Bacteria | 3776 |
| 204 | Ga0436360_1315499 | 3300039438 | Bacteria | 12430 |
| 205 | Ga0436361_0051447 | 3300039447 | Bacteria | 11059 |
| 206 | Ga0436363_0616384 | 3300039450 | Bacteria | 1512 |
| 207 | Ga0436362_0765386 | 3300039453 | Bacteria | 3191 |
| 208 | Ga0453684_1276296 | 3300044712 | Unclassified | 767 |
| 209 | Ga0495638_0006915 | 3300046460 | Bacteria | 8183 |
| 210 | Ga0495650_0005218 | 3300046471 | Bacteria | 8526 |
| 211 | Ga0495594_0298776 | 3300046499 | Bacteria | 917 |
| 212 | Ga0495649_0172164 | 3300046694 | Unclassified | 1132 |
| 213 | Ga0495636_0213802 | 3300047318 | Bacteria | 883 |
| 214 | Ga0496104_0538982 | 3300048907 | Bacteria | 1078 |
| 215 | Ga0496106_0687367 | 3300048909 | Bacteria | 816 |
| 216 | Ga0496109_1331985 | 3300048912 | Unclassified | 654 |
| 217 | Ga0496114_0212630 | 3300048917 | Bacteria | 1696 |
| 218 | Ga0496119_0002078 | 3300048922 | Bacteria | 22645 |
| 219 | Ga0496120_0002824 | 3300048923 | Bacteria | 16752 |
| 220 | Ga0501039_0118390 | 3300049575 | Bacteria | 2075 |
| 221 | Ga0501047_0257012 | 3300049581 | Bacteria | 1595 |
| 222 | Ga0501048_0531792 | 3300049582 | Bacteria | 843 |
| 223 | Ga0501079_0407107 | 3300049741 | Bacteria | 1067 |
| 224 | Ga0501081_0293447 | 3300049743 | Bacteria | 1192 |
| 225 | Ga0501035_0001086 | 3300049822 | Bacteria | 28527 |
| 226 | nmdc:mga00v17_17204_c1 | 3300050491 | Bacteria | 4087 |
| 227 | nmdc:mga0qj67_127284_c1 | 3300050509 | Bacteria | 2061 |
| 228 | nmdc:mga06r32_389688_c1 | 3300050510 | Bacteria | 1376 |
| 229 | Ga0587076_074189 | 3300059645 | Unclassified | 713 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021361 | Ga0213872_10029960 | Ga0213872_100299603 | 147 |
| 2 | 3300021441 | Ga0213871_10000892 | Ga0213871_100008926 | 147 |
| 3 | 3300039438 | Ga0436360_1315499 | Ga0436360_1315499_469_918 | 147 |
| 4 | 3300039447 | Ga0436361_0051447 | Ga0436361_0051447_9417_9866 | 147 |
| 5 | 3300039453 | Ga0436362_0765386 | Ga0436362_0765386_2258_2707 | 147 |
| 6 | 3300007265 | Ga0099794_10052288 | Ga0099794_100522882 | 148 |
| 7 | 3300005438 | Ga0070701_11140502 | Ga0070701_111405021 | 151 |
| 8 | 3300025918 | Ga0207662_10017491 | Ga0207662_100174915 | 151 |
| 9 | 3300014326 | Ga0157380_10283207 | Ga0157380_102832072 | 152 |
| 10 | 3300031691 | Ga0316579_10160225 | Ga0316579_101602252 | 152 |
| 11 | 3300031733 | Ga0316577_10043784 | Ga0316577_100437842 | 152 |
| 12 | 3300032168 | Ga0316593_10000174 | Ga0316593_100001744 | 152 |
| 13 | 3300033541 | Ga0316596_1045038 | Ga0316596_10450382 | 152 |
| 14 | 3300005459 | Ga0068867_100120495 | Ga0068867_1001204953 | 153 |
| 15 | 3300005844 | Ga0068862_100051405 | Ga0068862_1000514054 | 153 |
| 16 | 3300006871 | Ga0075434_100169952 | Ga0075434_1001699521 | 153 |
| 17 | 3300014326 | Ga0157380_12396351 | Ga0157380_123963512 | 153 |
| 18 | 3300021384 | Ga0213876_10037244 | Ga0213876_100372442 | 153 |
| 19 | 3300025304 | Ga0209257_1011176 | Ga0209257_10111763 | 153 |
| 20 | 3300025933 | Ga0207706_11497178 | Ga0207706_114971781 | 153 |
| 21 | 3300026089 | Ga0207648_10441026 | Ga0207648_104410262 | 153 |
| 22 | 3300028380 | Ga0268265_10035869 | Ga0268265_100358694 | 153 |
| 23 | 3300039437 | Ga0436365_0329556 | Ga0436365_0329556_3115_3585 | 153 |
| 24 | 3300048912 | Ga0496109_1331985 | Ga0496109_1331985_124_591 | 153 |
| 25 | 3300049582 | Ga0501048_0531792 | Ga0501048_0531792_123_599 | 153 |
| 26 | 3300006051 | Ga0075364_10019934 | Ga0075364_100199343 | 154 |
| 27 | 3300050491 | nmdc:mga00v17_17204_c1 | nmdc:mga00v17_17204_c1_28_507 | 154 |
| 28 | 3300005328 | Ga0070676_10065863 | Ga0070676_100658633 | 155 |
| 29 | 3300005333 | Ga0070677_10182789 | Ga0070677_101827892 | 155 |
| 30 | 3300005334 | Ga0068869_101185689 | Ga0068869_1011856891 | 155 |
| 31 | 3300005335 | Ga0070666_10448393 | Ga0070666_104483932 | 155 |
| 32 | 3300005338 | Ga0068868_100623382 | Ga0068868_1006233822 | 155 |
| 33 | 3300005343 | Ga0070687_100233222 | Ga0070687_1002332222 | 155 |
| 34 | 3300005354 | Ga0070675_100011432 | Ga0070675_1000114323 | 155 |
| 35 | 3300005355 | Ga0070671_101472945 | Ga0070671_1014729451 | 155 |
| 36 | 3300005356 | Ga0070674_100168572 | Ga0070674_1001685722 | 155 |
| 37 | 3300005365 | Ga0070688_100390607 | Ga0070688_1003906072 | 155 |
| 38 | 3300005367 | Ga0070667_100049666 | Ga0070667_1000496663 | 155 |
| 39 | 3300005436 | Ga0070713_100007687 | Ga0070713_1000076877 | 155 |
| 40 | 3300005437 | Ga0070710_10167409 | Ga0070710_101674092 | 155 |
| 41 | 3300005439 | Ga0070711_100134706 | Ga0070711_1001347062 | 155 |
| 42 | 3300005440 | Ga0070705_100024425 | Ga0070705_1000244253 | 155 |
| 43 | 3300005441 | Ga0070700_100054115 | Ga0070700_1000541152 | 155 |
| 44 | 3300005456 | Ga0070678_100017963 | Ga0070678_1000179632 | 155 |
| 45 | 3300005459 | Ga0068867_100039469 | Ga0068867_1000394693 | 155 |
| 46 | 3300005546 | Ga0070696_100271655 | Ga0070696_1002716553 | 155 |
| 47 | 3300005615 | Ga0070702_100035794 | Ga0070702_1000357942 | 155 |
| 48 | 3300005617 | Ga0068859_100058282 | Ga0068859_1000582822 | 155 |
| 49 | 3300005618 | Ga0068864_100283274 | Ga0068864_1002832743 | 155 |
| 50 | 3300005840 | Ga0068870_10045399 | Ga0068870_100453993 | 155 |
| 51 | 3300005842 | Ga0068858_100318544 | Ga0068858_1003185443 | 155 |
| 52 | 3300005844 | Ga0068862_100232097 | Ga0068862_1002320972 | 155 |
| 53 | 3300006028 | Ga0070717_10056304 | Ga0070717_100563042 | 155 |
| 54 | 3300006237 | Ga0097621_100072670 | Ga0097621_1000726703 | 155 |
| 55 | 3300006358 | Ga0068871_100090138 | Ga0068871_1000901383 | 155 |
| 56 | 3300006881 | Ga0068865_100056366 | Ga0068865_1000563662 | 155 |
| 57 | 3300006931 | Ga0097620_100058282 | Ga0097620_1000582822 | 155 |
| 58 | 3300009176 | Ga0105242_10049058 | Ga0105242_100490584 | 155 |
| 59 | 3300009177 | Ga0105248_10795523 | Ga0105248_107955232 | 155 |
| 60 | 3300013297 | Ga0157378_10420788 | Ga0157378_104207882 | 155 |
| 61 | 3300013306 | Ga0163162_10072595 | Ga0163162_100725954 | 155 |
| 62 | 3300014326 | Ga0157380_10276026 | Ga0157380_102760263 | 155 |
| 63 | 3300014968 | Ga0157379_10227421 | Ga0157379_102274212 | 155 |
| 64 | 3300014969 | Ga0157376_10423351 | Ga0157376_104233511 | 155 |
| 65 | 3300021377 | Ga0213874_10027527 | Ga0213874_100275272 | 155 |
| 66 | 3300025893 | Ga0207682_10123077 | Ga0207682_101230772 | 155 |
| 67 | 3300025903 | Ga0207680_10125098 | Ga0207680_101250982 | 155 |
| 68 | 3300025907 | Ga0207645_10088069 | Ga0207645_100880692 | 155 |
| 69 | 3300025908 | Ga0207643_10001865 | Ga0207643_1000186510 | 155 |
| 70 | 3300025916 | Ga0207663_10158576 | Ga0207663_101585761 | 155 |
| 71 | 3300025926 | Ga0207659_10115422 | Ga0207659_101154222 | 155 |
| 72 | 3300025928 | Ga0207700_10190409 | Ga0207700_101904092 | 155 |
| 73 | 3300025929 | Ga0207664_10007711 | Ga0207664_100077117 | 155 |
| 74 | 3300025931 | Ga0207644_10734893 | Ga0207644_107348932 | 155 |
| 75 | 3300025934 | Ga0207686_10119785 | Ga0207686_101197852 | 155 |
| 76 | 3300025936 | Ga0207670_10350757 | Ga0207670_103507572 | 155 |
| 77 | 3300025937 | Ga0207669_10035917 | Ga0207669_100359173 | 155 |
| 78 | 3300025938 | Ga0207704_10022673 | Ga0207704_100226734 | 155 |
| 79 | 3300025940 | Ga0207691_10005394 | Ga0207691_100053946 | 155 |
| 80 | 3300025942 | Ga0207689_10107674 | Ga0207689_101076742 | 155 |
| 81 | 3300025960 | Ga0207651_10161517 | Ga0207651_101615173 | 155 |
| 82 | 3300025986 | Ga0207658_10136945 | Ga0207658_101369452 | 155 |
| 83 | 3300026023 | Ga0207677_10634241 | Ga0207677_106342412 | 155 |
| 84 | 3300026075 | Ga0207708_10005886 | Ga0207708_100058865 | 155 |
| 85 | 3300026088 | Ga0207641_10194203 | Ga0207641_101942032 | 155 |
| 86 | 3300026089 | Ga0207648_10039075 | Ga0207648_100390752 | 155 |
| 87 | 3300026095 | Ga0207676_10073371 | Ga0207676_100733713 | 155 |
| 88 | 3300026118 | Ga0207675_100012762 | Ga0207675_1000127626 | 155 |
| 89 | 3300026121 | Ga0207683_10049484 | Ga0207683_100494843 | 155 |
| 90 | 3300028380 | Ga0268265_11594982 | Ga0268265_115949822 | 155 |
| 91 | 3300032002 | Ga0307416_101711588 | Ga0307416_1017115882 | 155 |
| 92 | 3300035695 | Ga0373927_0843027 | Ga0373927_0843027_73_546 | 155 |
| 93 | 3300037853 | Ga0436364_0000349 | Ga0436364_0000349_1151_1624 | 155 |
| 94 | 3300039450 | Ga0436363_0616384 | Ga0436363_0616384_369_842 | 155 |
| 95 | 3300049575 | Ga0501039_0118390 | Ga0501039_0118390_198_680 | 155 |
| 96 | 3300049743 | Ga0501081_0293447 | Ga0501081_0293447_667_1146 | 155 |
| 97 | 3300005439 | Ga0070711_101722286 | Ga0070711_1017222861 | 157 |
| 98 | 3300032168 | Ga0316593_10105112 | Ga0316593_101051122 | 157 |
| 99 | 3300044712 | Ga0453684_1276296 | Ga0453684_1276296_41_526 | 157 |
| 100 | 3300005331 | Ga0070670_100421263 | Ga0070670_1004212632 | 158 |
| 101 | 3300005334 | Ga0068869_100329427 | Ga0068869_1003294272 | 158 |
| 102 | 3300005335 | Ga0070666_10241169 | Ga0070666_102411692 | 158 |
| 103 | 3300005338 | Ga0068868_100060838 | Ga0068868_1000608383 | 158 |
| 104 | 3300005343 | Ga0070687_100511250 | Ga0070687_1005112501 | 158 |
| 105 | 3300005345 | Ga0070692_10203482 | Ga0070692_102034821 | 158 |
| 106 | 3300005347 | Ga0070668_100077814 | Ga0070668_1000778143 | 158 |
| 107 | 3300005354 | Ga0070675_100118562 | Ga0070675_1001185623 | 158 |
| 108 | 3300005355 | Ga0070671_100968597 | Ga0070671_1009685972 | 158 |
| 109 | 3300005356 | Ga0070674_100101676 | Ga0070674_1001016763 | 158 |
| 110 | 3300005364 | Ga0070673_100399829 | Ga0070673_1003998291 | 158 |
| 111 | 3300005366 | Ga0070659_100951260 | Ga0070659_1009512601 | 158 |
| 112 | 3300005438 | Ga0070701_10005875 | Ga0070701_100058755 | 158 |
| 113 | 3300005440 | Ga0070705_100145336 | Ga0070705_1001453362 | 158 |
| 114 | 3300005441 | Ga0070700_100570012 | Ga0070700_1005700122 | 158 |
| 115 | 3300005444 | Ga0070694_100042721 | Ga0070694_1000427211 | 158 |
| 116 | 3300005455 | Ga0070663_100182178 | Ga0070663_1001821782 | 158 |
| 117 | 3300005456 | Ga0070678_100070066 | Ga0070678_1000700662 | 158 |
| 118 | 3300005459 | Ga0068867_100065027 | Ga0068867_1000650272 | 158 |
| 119 | 3300005459 | Ga0068867_100208206 | Ga0068867_1002082062 | 158 |
| 120 | 3300005466 | Ga0070685_10764635 | Ga0070685_107646351 | 158 |
| 121 | 3300005543 | Ga0070672_100313410 | Ga0070672_1003134103 | 158 |
| 122 | 3300005545 | Ga0070695_100210915 | Ga0070695_1002109151 | 158 |
| 123 | 3300005545 | Ga0070695_101241966 | Ga0070695_1012419661 | 158 |
| 124 | 3300005548 | Ga0070665_100309148 | Ga0070665_1003091483 | 158 |
| 125 | 3300005548 | Ga0070665_100779169 | Ga0070665_1007791692 | 158 |
| 126 | 3300005549 | Ga0070704_100073773 | Ga0070704_1000737731 | 158 |
| 127 | 3300005577 | Ga0068857_100193968 | Ga0068857_1001939682 | 158 |
| 128 | 3300005615 | Ga0070702_100013246 | Ga0070702_1000132464 | 158 |
| 129 | 3300005719 | Ga0068861_100755973 | Ga0068861_1007559732 | 158 |
| 130 | 3300005844 | Ga0068862_100532687 | Ga0068862_1005326871 | 158 |
| 131 | 3300006237 | Ga0097621_100061156 | Ga0097621_1000611562 | 158 |
| 132 | 3300006358 | Ga0068871_100044641 | Ga0068871_1000446414 | 158 |
| 133 | 3300006881 | Ga0068865_100011735 | Ga0068865_1000117352 | 158 |
| 134 | 3300009098 | Ga0105245_10698749 | Ga0105245_106987491 | 158 |
| 135 | 3300009176 | Ga0105242_10002070 | Ga0105242_100020707 | 158 |
| 136 | 3300009177 | Ga0105248_10372454 | Ga0105248_103724543 | 158 |
| 137 | 3300009553 | Ga0105249_11615933 | Ga0105249_116159331 | 158 |
| 138 | 3300013306 | Ga0163162_10203455 | Ga0163162_102034553 | 158 |
| 139 | 3300013308 | Ga0157375_10955596 | Ga0157375_109555961 | 158 |
| 140 | 3300014969 | Ga0157376_10021270 | Ga0157376_100212703 | 158 |
| 141 | 3300025315 | Ga0207697_10205850 | Ga0207697_102058501 | 158 |
| 142 | 3300025903 | Ga0207680_10081190 | Ga0207680_100811902 | 158 |
| 143 | 3300025927 | Ga0207687_10383705 | Ga0207687_103837052 | 158 |
| 144 | 3300025931 | Ga0207644_10773994 | Ga0207644_107739941 | 158 |
| 145 | 3300025934 | Ga0207686_10003081 | Ga0207686_100030812 | 158 |
| 146 | 3300025938 | Ga0207704_10129914 | Ga0207704_101299142 | 158 |
| 147 | 3300025938 | Ga0207704_10748481 | Ga0207704_107484812 | 158 |
| 148 | 3300025940 | Ga0207691_10221616 | Ga0207691_102216162 | 158 |
| 149 | 3300025941 | Ga0207711_11194073 | Ga0207711_111940732 | 158 |
| 150 | 3300025960 | Ga0207651_10259020 | Ga0207651_102590202 | 158 |
| 151 | 3300026023 | Ga0207677_10222914 | Ga0207677_102229142 | 158 |
| 152 | 3300026067 | Ga0207678_10274124 | Ga0207678_102741242 | 158 |
| 153 | 3300026089 | Ga0207648_10148930 | Ga0207648_101489302 | 158 |
| 154 | 3300026116 | Ga0207674_10005757 | Ga0207674_100057578 | 158 |
| 155 | 3300026121 | Ga0207683_10091640 | Ga0207683_100916402 | 158 |
| 156 | 3300028577 | Ga0265318_10160944 | Ga0265318_101609442 | 158 |
| 157 | 3300029957 | Ga0265324_10000052 | Ga0265324_1000005260 | 158 |
| 158 | 3300031711 | Ga0265314_10006121 | Ga0265314_100061214 | 158 |
| 159 | 3300037418 | Ga0395900_0790914 | Ga0395900_0790914_12_506 | 158 |
| 160 | 3300046460 | Ga0495638_0006915 | Ga0495638_0006915_5731_6222 | 158 |
| 161 | 3300046471 | Ga0495650_0005218 | Ga0495650_0005218_2045_2542 | 158 |
| 162 | 3300048917 | Ga0496114_0212630 | Ga0496114_0212630_612_1088 | 158 |
| 163 | 3300059645 | Ga0587076_074189 | Ga0587076_074189_74_577 | 158 |
| 164 | 3300005334 | Ga0068869_100002690 | Ga0068869_1000026908 | 159 |
| 165 | 3300005437 | Ga0070710_10077291 | Ga0070710_100772911 | 159 |
| 166 | 3300005544 | Ga0070686_100073183 | Ga0070686_1000731833 | 159 |
| 167 | 3300005546 | Ga0070696_100451544 | Ga0070696_1004515441 | 159 |
| 168 | 3300005547 | Ga0070693_100007417 | Ga0070693_1000074173 | 159 |
| 169 | 3300005614 | Ga0068856_100039023 | Ga0068856_1000390232 | 159 |
| 170 | 3300005843 | Ga0068860_100000419 | Ga0068860_10000041935 | 159 |
| 171 | 3300005843 | Ga0068860_100185957 | Ga0068860_1001859572 | 159 |
| 172 | 3300006844 | Ga0075428_100034297 | Ga0075428_1000342975 | 159 |
| 173 | 3300006846 | Ga0075430_100112037 | Ga0075430_1001120372 | 159 |
| 174 | 3300006847 | Ga0075431_100402251 | Ga0075431_1004022512 | 159 |
| 175 | 3300006881 | Ga0068865_100144732 | Ga0068865_1001447323 | 159 |
| 176 | 3300025938 | Ga0207704_10182475 | Ga0207704_101824752 | 159 |
| 177 | 3300025942 | Ga0207689_10033622 | Ga0207689_100336224 | 159 |
| 178 | 3300026078 | Ga0207702_10372084 | Ga0207702_103720842 | 159 |
| 179 | 3300028380 | Ga0268265_10196329 | Ga0268265_101963293 | 159 |
| 180 | 3300028381 | Ga0268264_10001500 | Ga0268264_100015005 | 159 |
| 181 | 3300028381 | Ga0268264_10114691 | Ga0268264_101146913 | 159 |
| 182 | 3300031730 | Ga0307516_10011796 | Ga0307516_100117965 | 159 |
| 183 | 3300046499 | Ga0495594_0298776 | Ga0495594_0298776_261_749 | 159 |
| 184 | 3300047318 | Ga0495636_0213802 | Ga0495636_0213802_40_528 | 159 |
| 185 | 3300049581 | Ga0501047_0257012 | Ga0501047_0257012_55_561 | 159 |
| 186 | 3300049822 | Ga0501035_0001086 | Ga0501035_0001086_16709_17197 | 159 |
| 187 | 3300050509 | nmdc:mga0qj67_127284_c1 | nmdc:mga0qj67_127284_c1_244_732 | 159 |
| 188 | 3300050510 | nmdc:mga06r32_389688_c1 | nmdc:mga06r32_389688_c1_45_533 | 159 |
| 189 | 3300005293 | Ga0065715_10091404 | Ga0065715_100914045 | 160 |
| 190 | 3300005458 | Ga0070681_10084039 | Ga0070681_100840394 | 160 |
| 191 | 3300005535 | Ga0070684_100774337 | Ga0070684_1007743372 | 160 |
| 192 | 3300005615 | Ga0070702_100385582 | Ga0070702_1003855822 | 160 |
| 193 | 3300005937 | Ga0081455_10089521 | Ga0081455_100895213 | 160 |
| 194 | 3300007076 | Ga0075435_101274774 | Ga0075435_1012747741 | 160 |
| 195 | 3300009011 | Ga0105251_10184366 | Ga0105251_101843662 | 160 |
| 196 | 3300009101 | Ga0105247_10000037 | Ga0105247_1000003712 | 160 |
| 197 | 3300009177 | Ga0105248_10008194 | Ga0105248_100081942 | 160 |
| 198 | 3300013297 | Ga0157378_10181838 | Ga0157378_101818383 | 160 |
| 199 | 3300014968 | Ga0157379_10101627 | Ga0157379_101016273 | 160 |
| 200 | 3300025735 | Ga0207713_1124849 | Ga0207713_11248491 | 160 |
| 201 | 3300025900 | Ga0207710_10000059 | Ga0207710_10000059108 | 160 |
| 202 | 3300025912 | Ga0207707_10104757 | Ga0207707_101047573 | 160 |
| 203 | 3300025921 | Ga0207652_10096413 | Ga0207652_100964133 | 160 |
| 204 | 3300025941 | Ga0207711_10055548 | Ga0207711_100555484 | 160 |
| 205 | 3300031616 | Ga0307508_10144262 | Ga0307508_101442622 | 160 |
| 206 | 3300048907 | Ga0496104_0538982 | Ga0496104_0538982_259_807 | 160 |
| 207 | 3300048909 | Ga0496106_0687367 | Ga0496106_0687367_115_663 | 160 |
| 208 | 3300048922 | Ga0496119_0002078 | Ga0496119_0002078_16341_16889 | 160 |
| 209 | 3300048923 | Ga0496120_0002824 | Ga0496120_0002824_10448_10996 | 160 |
| 210 | 3300003323 | rootH1_10213091 | rootH1_102130912 | 161 |
| 211 | 3300005334 | Ga0068869_100117535 | Ga0068869_1001175352 | 161 |
| 212 | 3300005343 | Ga0070687_100158838 | Ga0070687_1001588383 | 161 |
| 213 | 3300005440 | Ga0070705_100257565 | Ga0070705_1002575652 | 161 |
| 214 | 3300005444 | Ga0070694_100190066 | Ga0070694_1001900661 | 161 |
| 215 | 3300005468 | Ga0070707_100005468 | Ga0070707_1000054687 | 161 |
| 216 | 3300005844 | Ga0068862_100439122 | Ga0068862_1004391222 | 161 |
| 217 | 3300007076 | Ga0075435_100362566 | Ga0075435_1003625662 | 161 |
| 218 | 3300013105 | Ga0157369_11632837 | Ga0157369_116328372 | 161 |
| 219 | 3300025922 | Ga0207646_10006258 | Ga0207646_100062587 | 161 |
| 220 | 3300025936 | Ga0207670_10043058 | Ga0207670_100430582 | 161 |
| 221 | 3300028380 | Ga0268265_10876254 | Ga0268265_108762542 | 161 |
| 222 | 3300036401 | Ga0373937_1169615 | Ga0373937_1169615_118_621 | 161 |
| 223 | 3300036401 | Ga0373937_1271060 | Ga0373937_1271060_90_575 | 161 |
| 224 | 3300037312 | Ga0395899_0010847 | Ga0395899_0010847_5334_5819 | 161 |
| 225 | 3300037418 | Ga0395900_0047902 | Ga0395900_0047902_699_1184 | 161 |
| 226 | 3300037466 | Ga0395898_0080896 | Ga0395898_0080896_638_1123 | 161 |
| 227 | 3300038443 | Ga0395901_0002479 | Ga0395901_0002479_16732_17217 | 161 |
| 228 | 3300046694 | Ga0495649_0172164 | Ga0495649_0172164_423_932 | 161 |
| 229 | 3300049741 | Ga0501079_0407107 | Ga0501079_0407107_459_983 | 161 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3klu-assembly1.cif.gz_A | crystal structure of the protein yqbn. northeast structural genomics consortium target sr445. | 0.6298 | 16 | 102 |
| 2ob9-assembly1.cif.gz_B | structure of bacteriophage hk97 tail assembly chaperone | 0.5498 | 6 | 99 |
| 2ob9-assembly1.cif.gz_B | structure of bacteriophage hk97 tail assembly chaperone | 0.5052 | 6 | 99 |
| 3klu-assembly1.cif.gz_A | crystal structure of the protein yqbn. northeast structural genomics consortium target sr445. | 0.4845 | 16 | 102 |
| 1y4j-assembly1.cif.gz_A | crystal structure of the paralogue of the human formylglycine generating enzyme | 0.4171 | 15 | 59 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3kluA01 | Alpha Beta;2-Layer Sandwich;rbstp2171; | 0.6298 | 16 | 102 | 3.30.2220.30 |
| af_I1LHG3_113_220_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.5967 | 17 | 45 | 1.25.40.10 |
| 2ob9B00 | Alpha Beta;2-Layer Sandwich;rbstp2171;Phage tail assembly chaperone gp13-like | 0.5912 | 11 | 99 | 3.30.2220.20 |
| 2ob9B00 | Alpha Beta;2-Layer Sandwich;rbstp2171;Phage tail assembly chaperone gp13-like | 0.5331 | 11 | 99 | 3.30.2220.20 |
| 3kluA01 | Alpha Beta;2-Layer Sandwich;rbstp2171; | 0.5165 | 16 | 102 | 3.30.2220.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A845ZDZ9-F1-model_v4 | Uncharacterized protein | 0.9484 | 41 | 103 |
|
| AF-A0A845ZDZ9-F1-model_v4 | Uncharacterized protein | 0.8695 | 41 | 103 |
|
| AF-A0A497RIG7-F1-model_v4 | Uncharacterized protein | 0.8428 | 18 | 89 |
|
| AF-A0A3N5TUZ7-F1-model_v4 | Uncharacterized protein | 0.836 | 4 | 105 |
|
| AF-A0A7C4ZXG5-F1-model_v4 | Phage tail assembly protein | 0.8324 | 3 | 103 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar