F341952

General Info

Members Datasets Scaffolds Average Seq Length
229 163 229 161

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10184366|Ga0105251_101843662
Length 182
Sequence MTLLTAEELLAGAALTHRVRLPSHLAPSSPVPDGVRPVDDAAAAEVVVRPLVLADIVRLNRAAGDDGDLAGAFMVHQALVEPRLSLEEVHRLPAGLVEFLLGEVNRVSGLSVHEDDLHEAVHAPLARACFVLAREFGWTPQRCAELTVGQLLLYLEMLGRGDVQAGAGATSPAGESLVGMGR

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 1.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0
Rhizoplane 1.75
Rhizosphere 92.58
Stem 0
Stem Tuber 0
Unclassified 4.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10213091 3300003323 Bacteria 1181
2 Ga0065715_10091404 3300005293 Bacteria 5798
3 Ga0070676_10065863 3300005328 Bacteria 2164
4 Ga0070670_100421263 3300005331 Bacteria 1180
5 Ga0070677_10182789 3300005333 Bacteria 1000
6 Ga0068869_100002690 3300005334 Bacteria 10751
7 Ga0068869_100117535 3300005334 Bacteria 2030
8 Ga0068869_100329427 3300005334 Bacteria 1240
9 Ga0068869_101185689 3300005334 Unclassified 671
10 Ga0070666_10241169 3300005335 Bacteria 1278
11 Ga0070666_10448393 3300005335 Unclassified 931
12 Ga0068868_100060838 3300005338 Bacteria 2991
13 Ga0068868_100623382 3300005338 Unclassified 958
14 Ga0070687_100158838 3300005343 Bacteria 1334
15 Ga0070687_100233222 3300005343 Unclassified 1134
16 Ga0070687_100511250 3300005343 Bacteria 810
17 Ga0070692_10203482 3300005345 Bacteria 1161
18 Ga0070668_100077814 3300005347 Bacteria 2593
19 Ga0070675_100011432 3300005354 Bacteria 6948
20 Ga0070675_100118562 3300005354 Bacteria 2247
21 Ga0070671_100968597 3300005355 Bacteria 745
22 Ga0070671_101472945 3300005355 Unclassified 602
23 Ga0070674_100101676 3300005356 Bacteria 2095
24 Ga0070674_100168572 3300005356 Bacteria 1667
25 Ga0070673_100399829 3300005364 Bacteria 1228
26 Ga0070688_100390607 3300005365 Bacteria 1028
27 Ga0070659_100951260 3300005366 Bacteria 752
28 Ga0070667_100049666 3300005367 Bacteria 3534
29 Ga0070713_100007687 3300005436 Bacteria 7587
30 Ga0070710_10077291 3300005437 Bacteria 1934
31 Ga0070710_10167409 3300005437 Bacteria 1367
32 Ga0070701_10005875 3300005438 Bacteria 5120
33 Ga0070701_11140502 3300005438 Unclassified 550
34 Ga0070711_100134706 3300005439 Bacteria 1845
35 Ga0070711_101722286 3300005439 Unclassified 549
36 Ga0070705_100024425 3300005440 Unclassified 3262
37 Ga0070705_100145336 3300005440 Bacteria 1566
38 Ga0070705_100257565 3300005440 Bacteria 1228
39 Ga0070700_100054115 3300005441 Unclassified 2507
40 Ga0070700_100570012 3300005441 Bacteria 882
41 Ga0070694_100042721 3300005444 Bacteria 3029
42 Ga0070694_100190066 3300005444 Bacteria 1524
43 Ga0070663_100182178 3300005455 Bacteria 1630
44 Ga0070678_100017963 3300005456 Bacteria 4571
45 Ga0070678_100070066 3300005456 Bacteria 2620
46 Ga0070681_10084039 3300005458 Unclassified 3136
47 Ga0068867_100039469 3300005459 Unclassified 3442
48 Ga0068867_100065027 3300005459 Bacteria 2713
49 Ga0068867_100120495 3300005459 Bacteria 2027
50 Ga0068867_100208206 3300005459 Bacteria 1569
51 Ga0070685_10764635 3300005466 Bacteria 709
52 Ga0070707_100005468 3300005468 Bacteria 11877
53 Ga0070684_100774337 3300005535 Bacteria 896
54 Ga0070672_100313410 3300005543 Bacteria 1332
55 Ga0070686_100073183 3300005544 Bacteria 2249
56 Ga0070695_100210915 3300005545 Bacteria 1394
57 Ga0070695_101241966 3300005545 Bacteria 614
58 Ga0070696_100271655 3300005546 Unclassified 1289
59 Ga0070696_100451544 3300005546 Bacteria 1014
60 Ga0070693_100007417 3300005547 Bacteria 5361
61 Ga0070665_100309148 3300005548 Bacteria 1584
62 Ga0070665_100779169 3300005548 Bacteria 969
63 Ga0070704_100073773 3300005549 Bacteria 2487
64 Ga0068857_100193968 3300005577 Bacteria 1850
65 Ga0068856_100039023 3300005614 Unclassified 4663
66 Ga0070702_100013246 3300005615 Bacteria 4159
67 Ga0070702_100035794 3300005615 Unclassified 2745
68 Ga0070702_100385582 3300005615 Bacteria 998
69 Ga0068859_100058282 3300005617 Bacteria 3890
70 Ga0068864_100283274 3300005618 Bacteria 1548
71 Ga0068861_100755973 3300005719 Bacteria 908
72 Ga0068870_10045399 3300005840 Bacteria 2300
73 Ga0068858_100318544 3300005842 Bacteria 1486
74 Ga0068860_100000419 3300005843 Bacteria 54802
75 Ga0068860_100185957 3300005843 Bacteria 2009
76 Ga0068862_100051405 3300005844 Bacteria 3525
77 Ga0068862_100232097 3300005844 Bacteria 1674
78 Ga0068862_100439122 3300005844 Unclassified 1228
79 Ga0068862_100532687 3300005844 Bacteria 1119
80 Ga0081455_10089521 3300005937 Unclassified 2497
81 Ga0070717_10056304 3300006028 Bacteria 3248
82 Ga0075364_10019934 3300006051 Bacteria 4214
83 Ga0097621_100061156 3300006237 Bacteria 3088
84 Ga0097621_100072670 3300006237 Bacteria 2845
85 Ga0068871_100044641 3300006358 Bacteria 3565
86 Ga0068871_100090138 3300006358 Bacteria 2553
87 Ga0075428_100034297 3300006844 Bacteria 5599
88 Ga0075430_100112037 3300006846 Bacteria 2275
89 Ga0075431_100402251 3300006847 Bacteria 1370
90 Ga0075434_100169952 3300006871 Bacteria 2200
91 Ga0068865_100011735 3300006881 Bacteria 5488
92 Ga0068865_100056366 3300006881 Bacteria 2737
93 Ga0068865_100144732 3300006881 Bacteria 1796
94 Ga0097620_100058282 3300006931 Bacteria 3890
95 Ga0075435_100362566 3300007076 Bacteria 1243
96 Ga0075435_101274774 3300007076 Unclassified 643
97 Ga0099794_10052288 3300007265 Unclassified 1969
98 Ga0105251_10184366 3300009011 Bacteria 940
99 Ga0105245_10698749 3300009098 Bacteria 1047
100 Ga0105247_10000037 3300009101 Bacteria 165929
101 Ga0105242_10002070 3300009176 Bacteria 15822
102 Ga0105242_10049058 3300009176 Bacteria 3434
103 Ga0105248_10008194 3300009177 Bacteria 11478
104 Ga0105248_10372454 3300009177 Bacteria 1608
105 Ga0105248_10795523 3300009177 Unclassified 1067
106 Ga0105249_11615933 3300009553 Bacteria 721
107 Ga0157369_11632837 3300013105 Unclassified 655
108 Ga0157378_10181838 3300013297 Unclassified 1978
109 Ga0157378_10420788 3300013297 Bacteria 1320
110 Ga0163162_10072595 3300013306 Bacteria 3497
111 Ga0163162_10203455 3300013306 Bacteria 2109
112 Ga0157375_10955596 3300013308 Unclassified 998
113 Ga0157380_10276026 3300014326 Bacteria 1535
114 Ga0157380_10283207 3300014326 Bacteria 1518
115 Ga0157380_12396351 3300014326 Unclassified 593
116 Ga0157379_10101627 3300014968 Bacteria 2580
117 Ga0157379_10227421 3300014968 Bacteria 1691
118 Ga0157376_10021270 3300014969 Bacteria 5038
119 Ga0157376_10423351 3300014969 Bacteria 1293
120 Ga0213872_10029960 3300021361 Bacteria 2496
121 Ga0213874_10027527 3300021377 Bacteria 1618
122 Ga0213876_10037244 3300021384 Bacteria 2566
123 Ga0213871_10000892 3300021441 Bacteria 4558
124 Ga0209257_1011176 3300025304 Bacteria 4371
125 Ga0207697_10205850 3300025315 Bacteria 866
126 Ga0207713_1124849 3300025735 Bacteria 859
127 Ga0207682_10123077 3300025893 Bacteria 1152
128 Ga0207710_10000059 3300025900 Bacteria 171838
129 Ga0207680_10081190 3300025903 Bacteria 2038
130 Ga0207680_10125098 3300025903 Bacteria 1687
131 Ga0207645_10088069 3300025907 Bacteria 1995
132 Ga0207643_10001865 3300025908 Bacteria 11656
133 Ga0207707_10104757 3300025912 Unclassified 2472
134 Ga0207663_10158576 3300025916 Bacteria 1595
135 Ga0207662_10017491 3300025918 Bacteria 4057
136 Ga0207652_10096413 3300025921 Unclassified 2606
137 Ga0207646_10006258 3300025922 Bacteria 12353
138 Ga0207659_10115422 3300025926 Bacteria 2048
139 Ga0207687_10383705 3300025927 Bacteria 1152
140 Ga0207700_10190409 3300025928 Bacteria 1723
141 Ga0207664_10007711 3300025929 Bacteria 7471
142 Ga0207644_10734893 3300025931 Unclassified 824
143 Ga0207644_10773994 3300025931 Bacteria 802
144 Ga0207706_11497178 3300025933 Unclassified 551
145 Ga0207686_10003081 3300025934 Bacteria 8978
146 Ga0207686_10119785 3300025934 Bacteria 1789
147 Ga0207670_10043058 3300025936 Bacteria 2980
148 Ga0207670_10350757 3300025936 Unclassified 1168
149 Ga0207669_10035917 3300025937 Bacteria 2826
150 Ga0207704_10022673 3300025938 Bacteria 3370
151 Ga0207704_10129914 3300025938 Bacteria 1742
152 Ga0207704_10182475 3300025938 Bacteria 1518
153 Ga0207704_10748481 3300025938 Bacteria 813
154 Ga0207691_10005394 3300025940 Bacteria 12347
155 Ga0207691_10221616 3300025940 Bacteria 1640
156 Ga0207711_10055548 3300025941 Bacteria 3399
157 Ga0207711_11194073 3300025941 Unclassified 702
158 Ga0207689_10033622 3300025942 Unclassified 4260
159 Ga0207689_10107674 3300025942 Bacteria 2290
160 Ga0207651_10161517 3300025960 Bacteria 1757
161 Ga0207651_10259020 3300025960 Bacteria 1427
162 Ga0207658_10136945 3300025986 Bacteria 1976
163 Ga0207677_10222914 3300026023 Bacteria 1513
164 Ga0207677_10634241 3300026023 Unclassified 941
165 Ga0207678_10274124 3300026067 Bacteria 1447
166 Ga0207708_10005886 3300026075 Bacteria 9069
167 Ga0207702_10372084 3300026078 Unclassified 1372
168 Ga0207641_10194203 3300026088 Bacteria 1867
169 Ga0207648_10039075 3300026089 Bacteria 4173
170 Ga0207648_10148930 3300026089 Bacteria 2065
171 Ga0207648_10441026 3300026089 Bacteria 1184
172 Ga0207676_10073371 3300026095 Unclassified 2754
173 Ga0207674_10005757 3300026116 Bacteria 14703
174 Ga0207675_100012762 3300026118 Bacteria 7849
175 Ga0207683_10049484 3300026121 Bacteria 3680
176 Ga0207683_10091640 3300026121 Bacteria 2708
177 Ga0268265_10035869 3300028380 Bacteria 3628
178 Ga0268265_10196329 3300028380 Bacteria 1747
179 Ga0268265_10876254 3300028380 Unclassified 880
180 Ga0268265_11594982 3300028380 Unclassified 657
181 Ga0268264_10001500 3300028381 Bacteria 21760
182 Ga0268264_10114691 3300028381 Bacteria 2366
183 Ga0265318_10160944 3300028577 Bacteria 823
184 Ga0265324_10000052 3300029957 Bacteria 97159
185 Ga0307508_10144262 3300031616 Unclassified 1985
186 Ga0316579_10160225 3300031691 Unclassified 1087
187 Ga0265314_10006121 3300031711 Bacteria 10690
188 Ga0307516_10011796 3300031730 Bacteria 9474
189 Ga0316577_10043784 3300031733 Unclassified 2504
190 Ga0307416_101711588 3300032002 Bacteria 733
191 Ga0316593_10000174 3300032168 Bacteria 9549
192 Ga0316593_10105112 3300032168 Bacteria 1005
193 Ga0316596_1045038 3300033541 Bacteria 1163
194 Ga0373927_0843027 3300035695 Unclassified 605
195 Ga0373937_1169615 3300036401 Bacteria 718
196 Ga0373937_1271060 3300036401 Bacteria 684
197 Ga0395899_0010847 3300037312 Bacteria 6984
198 Ga0395900_0047902 3300037418 Bacteria 4403
199 Ga0395900_0790914 3300037418 Bacteria 877
200 Ga0395898_0080896 3300037466 Bacteria 3133
201 Ga0436364_0000349 3300037853 Bacteria 3592
202 Ga0395901_0002479 3300038443 Bacteria 18725
203 Ga0436365_0329556 3300039437 Bacteria 3776
204 Ga0436360_1315499 3300039438 Bacteria 12430
205 Ga0436361_0051447 3300039447 Bacteria 11059
206 Ga0436363_0616384 3300039450 Bacteria 1512
207 Ga0436362_0765386 3300039453 Bacteria 3191
208 Ga0453684_1276296 3300044712 Unclassified 767
209 Ga0495638_0006915 3300046460 Bacteria 8183
210 Ga0495650_0005218 3300046471 Bacteria 8526
211 Ga0495594_0298776 3300046499 Bacteria 917
212 Ga0495649_0172164 3300046694 Unclassified 1132
213 Ga0495636_0213802 3300047318 Bacteria 883
214 Ga0496104_0538982 3300048907 Bacteria 1078
215 Ga0496106_0687367 3300048909 Bacteria 816
216 Ga0496109_1331985 3300048912 Unclassified 654
217 Ga0496114_0212630 3300048917 Bacteria 1696
218 Ga0496119_0002078 3300048922 Bacteria 22645
219 Ga0496120_0002824 3300048923 Bacteria 16752
220 Ga0501039_0118390 3300049575 Bacteria 2075
221 Ga0501047_0257012 3300049581 Bacteria 1595
222 Ga0501048_0531792 3300049582 Bacteria 843
223 Ga0501079_0407107 3300049741 Bacteria 1067
224 Ga0501081_0293447 3300049743 Bacteria 1192
225 Ga0501035_0001086 3300049822 Bacteria 28527
226 nmdc:mga00v17_17204_c1 3300050491 Bacteria 4087
227 nmdc:mga0qj67_127284_c1 3300050509 Bacteria 2061
228 nmdc:mga06r32_389688_c1 3300050510 Bacteria 1376
229 Ga0587076_074189 3300059645 Unclassified 713

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021361 Ga0213872_10029960 Ga0213872_100299603 147
2 3300021441 Ga0213871_10000892 Ga0213871_100008926 147
3 3300039438 Ga0436360_1315499 Ga0436360_1315499_469_918 147
4 3300039447 Ga0436361_0051447 Ga0436361_0051447_9417_9866 147
5 3300039453 Ga0436362_0765386 Ga0436362_0765386_2258_2707 147
6 3300007265 Ga0099794_10052288 Ga0099794_100522882 148
7 3300005438 Ga0070701_11140502 Ga0070701_111405021 151
8 3300025918 Ga0207662_10017491 Ga0207662_100174915 151
9 3300014326 Ga0157380_10283207 Ga0157380_102832072 152
10 3300031691 Ga0316579_10160225 Ga0316579_101602252 152
11 3300031733 Ga0316577_10043784 Ga0316577_100437842 152
12 3300032168 Ga0316593_10000174 Ga0316593_100001744 152
13 3300033541 Ga0316596_1045038 Ga0316596_10450382 152
14 3300005459 Ga0068867_100120495 Ga0068867_1001204953 153
15 3300005844 Ga0068862_100051405 Ga0068862_1000514054 153
16 3300006871 Ga0075434_100169952 Ga0075434_1001699521 153
17 3300014326 Ga0157380_12396351 Ga0157380_123963512 153
18 3300021384 Ga0213876_10037244 Ga0213876_100372442 153
19 3300025304 Ga0209257_1011176 Ga0209257_10111763 153
20 3300025933 Ga0207706_11497178 Ga0207706_114971781 153
21 3300026089 Ga0207648_10441026 Ga0207648_104410262 153
22 3300028380 Ga0268265_10035869 Ga0268265_100358694 153
23 3300039437 Ga0436365_0329556 Ga0436365_0329556_3115_3585 153
24 3300048912 Ga0496109_1331985 Ga0496109_1331985_124_591 153
25 3300049582 Ga0501048_0531792 Ga0501048_0531792_123_599 153
26 3300006051 Ga0075364_10019934 Ga0075364_100199343 154
27 3300050491 nmdc:mga00v17_17204_c1 nmdc:mga00v17_17204_c1_28_507 154
28 3300005328 Ga0070676_10065863 Ga0070676_100658633 155
29 3300005333 Ga0070677_10182789 Ga0070677_101827892 155
30 3300005334 Ga0068869_101185689 Ga0068869_1011856891 155
31 3300005335 Ga0070666_10448393 Ga0070666_104483932 155
32 3300005338 Ga0068868_100623382 Ga0068868_1006233822 155
33 3300005343 Ga0070687_100233222 Ga0070687_1002332222 155
34 3300005354 Ga0070675_100011432 Ga0070675_1000114323 155
35 3300005355 Ga0070671_101472945 Ga0070671_1014729451 155
36 3300005356 Ga0070674_100168572 Ga0070674_1001685722 155
37 3300005365 Ga0070688_100390607 Ga0070688_1003906072 155
38 3300005367 Ga0070667_100049666 Ga0070667_1000496663 155
39 3300005436 Ga0070713_100007687 Ga0070713_1000076877 155
40 3300005437 Ga0070710_10167409 Ga0070710_101674092 155
41 3300005439 Ga0070711_100134706 Ga0070711_1001347062 155
42 3300005440 Ga0070705_100024425 Ga0070705_1000244253 155
43 3300005441 Ga0070700_100054115 Ga0070700_1000541152 155
44 3300005456 Ga0070678_100017963 Ga0070678_1000179632 155
45 3300005459 Ga0068867_100039469 Ga0068867_1000394693 155
46 3300005546 Ga0070696_100271655 Ga0070696_1002716553 155
47 3300005615 Ga0070702_100035794 Ga0070702_1000357942 155
48 3300005617 Ga0068859_100058282 Ga0068859_1000582822 155
49 3300005618 Ga0068864_100283274 Ga0068864_1002832743 155
50 3300005840 Ga0068870_10045399 Ga0068870_100453993 155
51 3300005842 Ga0068858_100318544 Ga0068858_1003185443 155
52 3300005844 Ga0068862_100232097 Ga0068862_1002320972 155
53 3300006028 Ga0070717_10056304 Ga0070717_100563042 155
54 3300006237 Ga0097621_100072670 Ga0097621_1000726703 155
55 3300006358 Ga0068871_100090138 Ga0068871_1000901383 155
56 3300006881 Ga0068865_100056366 Ga0068865_1000563662 155
57 3300006931 Ga0097620_100058282 Ga0097620_1000582822 155
58 3300009176 Ga0105242_10049058 Ga0105242_100490584 155
59 3300009177 Ga0105248_10795523 Ga0105248_107955232 155
60 3300013297 Ga0157378_10420788 Ga0157378_104207882 155
61 3300013306 Ga0163162_10072595 Ga0163162_100725954 155
62 3300014326 Ga0157380_10276026 Ga0157380_102760263 155
63 3300014968 Ga0157379_10227421 Ga0157379_102274212 155
64 3300014969 Ga0157376_10423351 Ga0157376_104233511 155
65 3300021377 Ga0213874_10027527 Ga0213874_100275272 155
66 3300025893 Ga0207682_10123077 Ga0207682_101230772 155
67 3300025903 Ga0207680_10125098 Ga0207680_101250982 155
68 3300025907 Ga0207645_10088069 Ga0207645_100880692 155
69 3300025908 Ga0207643_10001865 Ga0207643_1000186510 155
70 3300025916 Ga0207663_10158576 Ga0207663_101585761 155
71 3300025926 Ga0207659_10115422 Ga0207659_101154222 155
72 3300025928 Ga0207700_10190409 Ga0207700_101904092 155
73 3300025929 Ga0207664_10007711 Ga0207664_100077117 155
74 3300025931 Ga0207644_10734893 Ga0207644_107348932 155
75 3300025934 Ga0207686_10119785 Ga0207686_101197852 155
76 3300025936 Ga0207670_10350757 Ga0207670_103507572 155
77 3300025937 Ga0207669_10035917 Ga0207669_100359173 155
78 3300025938 Ga0207704_10022673 Ga0207704_100226734 155
79 3300025940 Ga0207691_10005394 Ga0207691_100053946 155
80 3300025942 Ga0207689_10107674 Ga0207689_101076742 155
81 3300025960 Ga0207651_10161517 Ga0207651_101615173 155
82 3300025986 Ga0207658_10136945 Ga0207658_101369452 155
83 3300026023 Ga0207677_10634241 Ga0207677_106342412 155
84 3300026075 Ga0207708_10005886 Ga0207708_100058865 155
85 3300026088 Ga0207641_10194203 Ga0207641_101942032 155
86 3300026089 Ga0207648_10039075 Ga0207648_100390752 155
87 3300026095 Ga0207676_10073371 Ga0207676_100733713 155
88 3300026118 Ga0207675_100012762 Ga0207675_1000127626 155
89 3300026121 Ga0207683_10049484 Ga0207683_100494843 155
90 3300028380 Ga0268265_11594982 Ga0268265_115949822 155
91 3300032002 Ga0307416_101711588 Ga0307416_1017115882 155
92 3300035695 Ga0373927_0843027 Ga0373927_0843027_73_546 155
93 3300037853 Ga0436364_0000349 Ga0436364_0000349_1151_1624 155
94 3300039450 Ga0436363_0616384 Ga0436363_0616384_369_842 155
95 3300049575 Ga0501039_0118390 Ga0501039_0118390_198_680 155
96 3300049743 Ga0501081_0293447 Ga0501081_0293447_667_1146 155
97 3300005439 Ga0070711_101722286 Ga0070711_1017222861 157
98 3300032168 Ga0316593_10105112 Ga0316593_101051122 157
99 3300044712 Ga0453684_1276296 Ga0453684_1276296_41_526 157
100 3300005331 Ga0070670_100421263 Ga0070670_1004212632 158
101 3300005334 Ga0068869_100329427 Ga0068869_1003294272 158
102 3300005335 Ga0070666_10241169 Ga0070666_102411692 158
103 3300005338 Ga0068868_100060838 Ga0068868_1000608383 158
104 3300005343 Ga0070687_100511250 Ga0070687_1005112501 158
105 3300005345 Ga0070692_10203482 Ga0070692_102034821 158
106 3300005347 Ga0070668_100077814 Ga0070668_1000778143 158
107 3300005354 Ga0070675_100118562 Ga0070675_1001185623 158
108 3300005355 Ga0070671_100968597 Ga0070671_1009685972 158
109 3300005356 Ga0070674_100101676 Ga0070674_1001016763 158
110 3300005364 Ga0070673_100399829 Ga0070673_1003998291 158
111 3300005366 Ga0070659_100951260 Ga0070659_1009512601 158
112 3300005438 Ga0070701_10005875 Ga0070701_100058755 158
113 3300005440 Ga0070705_100145336 Ga0070705_1001453362 158
114 3300005441 Ga0070700_100570012 Ga0070700_1005700122 158
115 3300005444 Ga0070694_100042721 Ga0070694_1000427211 158
116 3300005455 Ga0070663_100182178 Ga0070663_1001821782 158
117 3300005456 Ga0070678_100070066 Ga0070678_1000700662 158
118 3300005459 Ga0068867_100065027 Ga0068867_1000650272 158
119 3300005459 Ga0068867_100208206 Ga0068867_1002082062 158
120 3300005466 Ga0070685_10764635 Ga0070685_107646351 158
121 3300005543 Ga0070672_100313410 Ga0070672_1003134103 158
122 3300005545 Ga0070695_100210915 Ga0070695_1002109151 158
123 3300005545 Ga0070695_101241966 Ga0070695_1012419661 158
124 3300005548 Ga0070665_100309148 Ga0070665_1003091483 158
125 3300005548 Ga0070665_100779169 Ga0070665_1007791692 158
126 3300005549 Ga0070704_100073773 Ga0070704_1000737731 158
127 3300005577 Ga0068857_100193968 Ga0068857_1001939682 158
128 3300005615 Ga0070702_100013246 Ga0070702_1000132464 158
129 3300005719 Ga0068861_100755973 Ga0068861_1007559732 158
130 3300005844 Ga0068862_100532687 Ga0068862_1005326871 158
131 3300006237 Ga0097621_100061156 Ga0097621_1000611562 158
132 3300006358 Ga0068871_100044641 Ga0068871_1000446414 158
133 3300006881 Ga0068865_100011735 Ga0068865_1000117352 158
134 3300009098 Ga0105245_10698749 Ga0105245_106987491 158
135 3300009176 Ga0105242_10002070 Ga0105242_100020707 158
136 3300009177 Ga0105248_10372454 Ga0105248_103724543 158
137 3300009553 Ga0105249_11615933 Ga0105249_116159331 158
138 3300013306 Ga0163162_10203455 Ga0163162_102034553 158
139 3300013308 Ga0157375_10955596 Ga0157375_109555961 158
140 3300014969 Ga0157376_10021270 Ga0157376_100212703 158
141 3300025315 Ga0207697_10205850 Ga0207697_102058501 158
142 3300025903 Ga0207680_10081190 Ga0207680_100811902 158
143 3300025927 Ga0207687_10383705 Ga0207687_103837052 158
144 3300025931 Ga0207644_10773994 Ga0207644_107739941 158
145 3300025934 Ga0207686_10003081 Ga0207686_100030812 158
146 3300025938 Ga0207704_10129914 Ga0207704_101299142 158
147 3300025938 Ga0207704_10748481 Ga0207704_107484812 158
148 3300025940 Ga0207691_10221616 Ga0207691_102216162 158
149 3300025941 Ga0207711_11194073 Ga0207711_111940732 158
150 3300025960 Ga0207651_10259020 Ga0207651_102590202 158
151 3300026023 Ga0207677_10222914 Ga0207677_102229142 158
152 3300026067 Ga0207678_10274124 Ga0207678_102741242 158
153 3300026089 Ga0207648_10148930 Ga0207648_101489302 158
154 3300026116 Ga0207674_10005757 Ga0207674_100057578 158
155 3300026121 Ga0207683_10091640 Ga0207683_100916402 158
156 3300028577 Ga0265318_10160944 Ga0265318_101609442 158
157 3300029957 Ga0265324_10000052 Ga0265324_1000005260 158
158 3300031711 Ga0265314_10006121 Ga0265314_100061214 158
159 3300037418 Ga0395900_0790914 Ga0395900_0790914_12_506 158
160 3300046460 Ga0495638_0006915 Ga0495638_0006915_5731_6222 158
161 3300046471 Ga0495650_0005218 Ga0495650_0005218_2045_2542 158
162 3300048917 Ga0496114_0212630 Ga0496114_0212630_612_1088 158
163 3300059645 Ga0587076_074189 Ga0587076_074189_74_577 158
164 3300005334 Ga0068869_100002690 Ga0068869_1000026908 159
165 3300005437 Ga0070710_10077291 Ga0070710_100772911 159
166 3300005544 Ga0070686_100073183 Ga0070686_1000731833 159
167 3300005546 Ga0070696_100451544 Ga0070696_1004515441 159
168 3300005547 Ga0070693_100007417 Ga0070693_1000074173 159
169 3300005614 Ga0068856_100039023 Ga0068856_1000390232 159
170 3300005843 Ga0068860_100000419 Ga0068860_10000041935 159
171 3300005843 Ga0068860_100185957 Ga0068860_1001859572 159
172 3300006844 Ga0075428_100034297 Ga0075428_1000342975 159
173 3300006846 Ga0075430_100112037 Ga0075430_1001120372 159
174 3300006847 Ga0075431_100402251 Ga0075431_1004022512 159
175 3300006881 Ga0068865_100144732 Ga0068865_1001447323 159
176 3300025938 Ga0207704_10182475 Ga0207704_101824752 159
177 3300025942 Ga0207689_10033622 Ga0207689_100336224 159
178 3300026078 Ga0207702_10372084 Ga0207702_103720842 159
179 3300028380 Ga0268265_10196329 Ga0268265_101963293 159
180 3300028381 Ga0268264_10001500 Ga0268264_100015005 159
181 3300028381 Ga0268264_10114691 Ga0268264_101146913 159
182 3300031730 Ga0307516_10011796 Ga0307516_100117965 159
183 3300046499 Ga0495594_0298776 Ga0495594_0298776_261_749 159
184 3300047318 Ga0495636_0213802 Ga0495636_0213802_40_528 159
185 3300049581 Ga0501047_0257012 Ga0501047_0257012_55_561 159
186 3300049822 Ga0501035_0001086 Ga0501035_0001086_16709_17197 159
187 3300050509 nmdc:mga0qj67_127284_c1 nmdc:mga0qj67_127284_c1_244_732 159
188 3300050510 nmdc:mga06r32_389688_c1 nmdc:mga06r32_389688_c1_45_533 159
189 3300005293 Ga0065715_10091404 Ga0065715_100914045 160
190 3300005458 Ga0070681_10084039 Ga0070681_100840394 160
191 3300005535 Ga0070684_100774337 Ga0070684_1007743372 160
192 3300005615 Ga0070702_100385582 Ga0070702_1003855822 160
193 3300005937 Ga0081455_10089521 Ga0081455_100895213 160
194 3300007076 Ga0075435_101274774 Ga0075435_1012747741 160
195 3300009011 Ga0105251_10184366 Ga0105251_101843662 160
196 3300009101 Ga0105247_10000037 Ga0105247_1000003712 160
197 3300009177 Ga0105248_10008194 Ga0105248_100081942 160
198 3300013297 Ga0157378_10181838 Ga0157378_101818383 160
199 3300014968 Ga0157379_10101627 Ga0157379_101016273 160
200 3300025735 Ga0207713_1124849 Ga0207713_11248491 160
201 3300025900 Ga0207710_10000059 Ga0207710_10000059108 160
202 3300025912 Ga0207707_10104757 Ga0207707_101047573 160
203 3300025921 Ga0207652_10096413 Ga0207652_100964133 160
204 3300025941 Ga0207711_10055548 Ga0207711_100555484 160
205 3300031616 Ga0307508_10144262 Ga0307508_101442622 160
206 3300048907 Ga0496104_0538982 Ga0496104_0538982_259_807 160
207 3300048909 Ga0496106_0687367 Ga0496106_0687367_115_663 160
208 3300048922 Ga0496119_0002078 Ga0496119_0002078_16341_16889 160
209 3300048923 Ga0496120_0002824 Ga0496120_0002824_10448_10996 160
210 3300003323 rootH1_10213091 rootH1_102130912 161
211 3300005334 Ga0068869_100117535 Ga0068869_1001175352 161
212 3300005343 Ga0070687_100158838 Ga0070687_1001588383 161
213 3300005440 Ga0070705_100257565 Ga0070705_1002575652 161
214 3300005444 Ga0070694_100190066 Ga0070694_1001900661 161
215 3300005468 Ga0070707_100005468 Ga0070707_1000054687 161
216 3300005844 Ga0068862_100439122 Ga0068862_1004391222 161
217 3300007076 Ga0075435_100362566 Ga0075435_1003625662 161
218 3300013105 Ga0157369_11632837 Ga0157369_116328372 161
219 3300025922 Ga0207646_10006258 Ga0207646_100062587 161
220 3300025936 Ga0207670_10043058 Ga0207670_100430582 161
221 3300028380 Ga0268265_10876254 Ga0268265_108762542 161
222 3300036401 Ga0373937_1169615 Ga0373937_1169615_118_621 161
223 3300036401 Ga0373937_1271060 Ga0373937_1271060_90_575 161
224 3300037312 Ga0395899_0010847 Ga0395899_0010847_5334_5819 161
225 3300037418 Ga0395900_0047902 Ga0395900_0047902_699_1184 161
226 3300037466 Ga0395898_0080896 Ga0395898_0080896_638_1123 161
227 3300038443 Ga0395901_0002479 Ga0395901_0002479_16732_17217 161
228 3300046694 Ga0495649_0172164 Ga0495649_0172164_423_932 161
229 3300049741 Ga0501079_0407107 Ga0501079_0407107_459_983 161

Structural Annotation

Top 5 Hits

ID Description Score Start End
3klu-assembly1.cif.gz_A crystal structure of the protein yqbn. northeast structural genomics consortium target sr445. 0.6298 16 102
2ob9-assembly1.cif.gz_B structure of bacteriophage hk97 tail assembly chaperone 0.5498 6 99
2ob9-assembly1.cif.gz_B structure of bacteriophage hk97 tail assembly chaperone 0.5052 6 99
3klu-assembly1.cif.gz_A crystal structure of the protein yqbn. northeast structural genomics consortium target sr445. 0.4845 16 102
1y4j-assembly1.cif.gz_A crystal structure of the paralogue of the human formylglycine generating enzyme 0.4171 15 59
ID Description Score Start End Superfamily
3kluA01 Alpha Beta;2-Layer Sandwich;rbstp2171; 0.6298 16 102 3.30.2220.30
af_I1LHG3_113_220_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5967 17 45 1.25.40.10
2ob9B00 Alpha Beta;2-Layer Sandwich;rbstp2171;Phage tail assembly chaperone gp13-like 0.5912 11 99 3.30.2220.20
2ob9B00 Alpha Beta;2-Layer Sandwich;rbstp2171;Phage tail assembly chaperone gp13-like 0.5331 11 99 3.30.2220.20
3kluA01 Alpha Beta;2-Layer Sandwich;rbstp2171; 0.5165 16 102 3.30.2220.30
ID Description Score Start End GO Terms
AF-A0A845ZDZ9-F1-model_v4 Uncharacterized protein 0.9484 41 103
AF-A0A845ZDZ9-F1-model_v4 Uncharacterized protein 0.8695 41 103
AF-A0A497RIG7-F1-model_v4 Uncharacterized protein 0.8428 18 89
AF-A0A3N5TUZ7-F1-model_v4 Uncharacterized protein 0.836 4 105
AF-A0A7C4ZXG5-F1-model_v4 Phage tail assembly protein 0.8324 3 103

Feature Viewer

pLDDT pTM Quality
84.46 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map