F341828

General Info

Members Datasets Scaffolds Average Seq Length
229 151 229 109

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_102081843|Ga0070665_1020818431
Length 122
Sequence MVGPGPDREVGLANIAILAALLLAALLEVGGDALVRAGLHGATMPARLGLLALGGVVLFAYGVTVNLPPWDFGRLLGVYVTLFFLLAQLVGWLAFGTRPTAPILVGGALIVAGGLTITFWQT

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
150 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
151 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 0
Rhizoplane 5.24
Rhizosphere 87.34
Stem 0
Stem Tuber 0
Unclassified 3.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1019438 3300000546 Bacteria 724
2 JGI24741J21665_1003340 3300001915 Bacteria 3844
3 JGI24740J21852_10017466 3300001979 Bacteria 2566
4 JGI24738J21930_10003292 3300002075 Bacteria 4105
5 JGI25157J39369_1035886 3300002741 Bacteria 556
6 JGI25165J46597_1000188 3300003214 Bacteria 92329
7 JGI25165J46597_1045860 3300003214 Bacteria 560
8 Ga0065715_10497164 3300005293 Unclassified 783
9 Ga0070658_10001003 3300005327 Bacteria 24214
10 Ga0070658_10037120 3300005327 Unclassified 3927
11 Ga0070658_10558666 3300005327 Bacteria 991
12 Ga0070658_10881061 3300005327 Unclassified 778
13 Ga0070676_10171121 3300005328 Bacteria 1405
14 Ga0070683_102072528 3300005329 Unclassified 546
15 Ga0070680_100191744 3300005336 Unclassified 1722
16 Ga0070675_101564933 3300005354 Unclassified 608
17 Ga0070709_10000498 3300005434 Bacteria 23165
18 Ga0070709_10183712 3300005434 Viruses 1470
19 Ga0070709_11324620 3300005434 Bacteria 581
20 Ga0070714_100473381 3300005435 Unclassified 1192
21 Ga0070713_100000322 3300005436 Bacteria 31317
22 Ga0070713_100115947 3300005436 Bacteria 2342
23 Ga0070713_102305662 3300005436 Unclassified 521
24 Ga0070710_10343602 3300005437 Unclassified 986
25 Ga0070711_100176795 3300005439 Unclassified 1631
26 Ga0070711_100225309 3300005439 Unclassified 1459
27 Ga0070711_100494981 3300005439 Unclassified 1007
28 Ga0070708_100090817 3300005445 Bacteria 2780
29 Ga0070708_100144865 3300005445 Bacteria 2206
30 Ga0070663_100036894 3300005455 Bacteria 3399
31 Ga0070663_100116411 3300005455 Unclassified 2014
32 Ga0068867_100732592 3300005459 Unclassified 875
33 Ga0070706_100033710 3300005467 Bacteria 4727
34 Ga0070706_100043653 3300005467 Bacteria 4142
35 Ga0070707_100007502 3300005468 Bacteria 10127
36 Ga0070707_101927089 3300005468 Unclassified 558
37 Ga0070699_100485110 3300005518 Unclassified 1122
38 Ga0070699_100526040 3300005518 Bacteria 1075
39 Ga0070679_100121069 3300005530 Bacteria 2601
40 Ga0070679_101497098 3300005530 Unclassified 622
41 Ga0070697_100001015 3300005536 Bacteria 21202
42 Ga0070697_100343131 3300005536 Unclassified 1289
43 Ga0068853_100005297 3300005539 Bacteria 10094
44 Ga0070665_102081843 3300005548 Bacteria 572
45 Ga0068855_100077515 3300005563 Bacteria 3856
46 Ga0068855_100232074 3300005563 Bacteria 2066
47 Ga0068855_100974132 3300005563 Unclassified 892
48 Ga0068854_100000027 3300005578 Bacteria 117836
49 Ga0068854_101216416 3300005578 Unclassified 675
50 Ga0068856_100002333 3300005614 Bacteria 19522
51 Ga0068856_100518823 3300005614 Unclassified 1213
52 Ga0068852_100506997 3300005616 Bacteria 1202
53 Ga0068864_100140621 3300005618 Bacteria 2177
54 Ga0068864_100651749 3300005618 Bacteria 1025
55 Ga0068851_10058058 3300005834 Bacteria 1977
56 Ga0068863_100484841 3300005841 Bacteria 1216
57 Ga0068863_100553640 3300005841 Bacteria 1136
58 Ga0070717_10121361 3300006028 Bacteria 2239
59 Ga0070717_10144456 3300006028 Bacteria 2054
60 Ga0070715_10064475 3300006163 Unclassified 1618
61 Ga0070716_100005730 3300006173 Bacteria 6034
62 Ga0070716_100065810 3300006173 Unclassified 2112
63 Ga0070712_100000456 3300006175 Bacteria 23452
64 Ga0070712_100091118 3300006175 Viruses 2233
65 Ga0070712_100100306 3300006175 Bacteria 2139
66 Ga0097621_100003095 3300006237 Bacteria 11412
67 Ga0097621_100089381 3300006237 Unclassified 2575
68 Ga0068871_100004613 3300006358 Bacteria 9620
69 Ga0068871_100047178 3300006358 Unclassified 3473
70 Ga0075428_100365502 3300006844 Unclassified 1548
71 Ga0075431_100233408 3300006847 Unclassified 1874
72 Ga0075433_10218102 3300006852 Unclassified 1695
73 Ga0068865_100570013 3300006881 Bacteria 953
74 Ga0075435_100703875 3300007076 Unclassified 878
75 Ga0099794_10062814 3300007265 Unclassified 1807
76 Ga0105240_10028603 3300009093 Bacteria 7275
77 Ga0105240_10105792 3300009093 Bacteria 3415
78 Ga0105240_10207961 3300009093 Bacteria 2289
79 Ga0105240_10363160 3300009093 Bacteria 1639
80 Ga0105245_10099380 3300009098 Bacteria 2690
81 Ga0114129_10286778 3300009147 Bacteria 2198
82 Ga0114129_11516752 3300009147 Unclassified 823
83 Ga0105241_10000207 3300009174 Bacteria 44168
84 Ga0105241_10059533 3300009174 Bacteria 2937
85 Ga0105241_10497999 3300009174 Bacteria 1086
86 Ga0105248_10000049 3300009177 Bacteria 153741
87 Ga0105248_10967385 3300009177 Bacteria 961
88 Ga0105237_10376567 3300009545 Bacteria 1424
89 Ga0105238_10141035 3300009551 Bacteria 2387
90 Ga0105239_10006050 3300010375 Bacteria 14087
91 Ga0105239_10015005 3300010375 Bacteria 8588
92 Ga0157373_10093177 3300013100 Bacteria 2122
93 Ga0157371_11007468 3300013102 Bacteria 636
94 Ga0157370_10199256 3300013104 Unclassified 1857
95 Ga0157370_10560657 3300013104 Unclassified 1047
96 Ga0157369_10085566 3300013105 Bacteria 3369
97 Ga0157374_10060042 3300013296 Unclassified 3558
98 Ga0157374_10349458 3300013296 Bacteria 1469
99 Ga0157374_11595700 3300013296 Unclassified 676
100 Ga0157378_10741381 3300013297 Bacteria 1004
101 Ga0157378_12152193 3300013297 Unclassified 609
102 Ga0163162_10534613 3300013306 Bacteria 1301
103 Ga0157372_11404215 3300013307 Bacteria 805
104 Ga0163163_10979976 3300014325 Bacteria 909
105 Ga0157379_10079068 3300014968 Bacteria 2945
106 Ga0157379_11113566 3300014968 Bacteria 757
107 Ga0157376_10069137 3300014969 Unclassified 2993
108 Ga0157376_10356879 3300014969 Bacteria 1401
109 Ga0206354_10308572 3300020081 Bacteria 1474
110 Ga0213876_10151434 3300021384 Bacteria 1233
111 Ga0207427_100914 3300025231 Bacteria 12723
112 Ga0209026_1001702 3300025250 Bacteria 9180
113 Ga0209233_1000120 3300025261 Bacteria 233311
114 Ga0209233_1007429 3300025261 Bacteria 3474
115 Ga0207656_10071683 3300025321 Bacteria 1541
116 Ga0207692_10232160 3300025898 Unclassified 1098
117 Ga0207692_10236213 3300025898 Unclassified 1090
118 Ga0207685_10049309 3300025905 Unclassified 1617
119 Ga0207699_10002436 3300025906 Bacteria 8782
120 Ga0207699_10958658 3300025906 Bacteria 632
121 Ga0207705_10000883 3300025909 Bacteria 24528
122 Ga0207705_10005741 3300025909 Bacteria 9261
123 Ga0207705_10371793 3300025909 Bacteria 1103
124 Ga0207684_10014678 3300025910 Bacteria 6747
125 Ga0207684_10325299 3300025910 Unclassified 1325
126 Ga0207654_10001292 3300025911 Bacteria 13327
127 Ga0207654_10034449 3300025911 Bacteria 2813
128 Ga0207654_10304708 3300025911 Unclassified 1084
129 Ga0207695_10084972 3300025913 Bacteria 3194
130 Ga0207695_10163306 3300025913 Bacteria 2157
131 Ga0207695_10673911 3300025913 Bacteria 915
132 Ga0207671_10513381 3300025914 Bacteria 955
133 Ga0207693_10000055 3300025915 Bacteria 96481
134 Ga0207693_10105349 3300025915 Viruses 2211
135 Ga0207663_10179243 3300025916 Unclassified 1512
136 Ga0207660_10595258 3300025917 Unclassified 900
137 Ga0207652_10111125 3300025921 Bacteria 2430
138 Ga0207646_10000992 3300025922 Bacteria 36429
139 Ga0207646_10061038 3300025922 Bacteria 3365
140 Ga0207646_10451579 3300025922 Bacteria 1160
141 Ga0207700_10000206 3300025928 Bacteria 35436
142 Ga0207664_10625940 3300025929 Unclassified 967
143 Ga0207664_11940901 3300025929 Unclassified 511
144 Ga0207665_10005073 3300025939 Bacteria 8791
145 Ga0207665_10007618 3300025939 Bacteria 7150
146 Ga0207711_10000033 3300025941 Bacteria 193513
147 Ga0207667_10251433 3300025949 Unclassified 1808
148 Ga0207667_11357733 3300025949 Bacteria 685
149 Ga0207712_11980492 3300025961 Unclassified 521
150 Ga0207640_10000145 3300025981 Bacteria 51603
151 Ga0207640_11053929 3300025981 Unclassified 717
152 Ga0207639_10005234 3300026041 Bacteria 8750
153 Ga0207678_10016113 3300026067 Bacteria 6564
154 Ga0207678_10056269 3300026067 Bacteria 3386
155 Ga0207702_10003111 3300026078 Bacteria 15373
156 Ga0207702_10462293 3300026078 Unclassified 1233
157 Ga0207641_10322294 3300026088 Bacteria 1466
158 Ga0207641_10539904 3300026088 Bacteria 1136
159 Ga0207641_12206558 3300026088 Bacteria 551
160 Ga0207648_10992875 3300026089 Bacteria 786
161 Ga0207698_10808875 3300026142 Bacteria 940
162 Ga0265337_1006225 3300028556 Unclassified 4634
163 Ga0265334_10000234 3300028573 Bacteria 31941
164 Ga0265334_10151454 3300028573 Unclassified 818
165 Ga0265336_10001220 3300028666 Bacteria 12202
166 Ga0265338_10002091 3300028800 Bacteria 30830
167 Ga0265338_10505527 3300028800 Bacteria 850
168 Ga0307510_10138946 3300033180 Bacteria 2078
169 Ga0373953_0397227 3300035117 Unclassified 607
170 Ga0373957_0174258 3300035120 Bacteria 890
171 Ga0373946_0182666 3300035171 Unclassified 996
172 Ga0373955_0116439 3300035172 Unclassified 1550
173 Ga0373935_0572030 3300035692 Unclassified 825
174 Ga0373937_0170014 3300036401 Bacteria 2045
175 Ga0373937_1089034 3300036401 Bacteria 748
176 Ga0395899_0000797 3300037312 Bacteria 30839
177 Ga0395900_0060992 3300037418 Bacteria 3879
178 Ga0395900_0085967 3300037418 Bacteria 3232
179 Ga0395905_0170339 3300037471 Bacteria 2045
180 Ga0395905_1091894 3300037471 Bacteria 701
181 Ga0436364_0975370 3300037853 Bacteria 1946
182 Ga0395901_1098763 3300038443 Bacteria 766
183 Ga0436365_1741909 3300039437 Bacteria 900
184 Ga0436360_0683347 3300039438 Unclassified 568
185 Ga0436363_1586536 3300039450 Unclassified 1406
186 Ga0453683_0220173 3300044673 Unclassified 1207
187 Ga0466957_0006633 3300044842 Bacteria 6545
188 Ga0451576_0964573 3300045051 Bacteria 894
189 Ga0495664_0399505 3300046477 Unclassified 825
190 Ga0495618_0307760 3300046514 Bacteria 983
191 Ga0495628_0050056 3300046516 Bacteria 3306
192 Ga0495628_0115739 3300046516 Bacteria 2059
193 Ga0495628_0224889 3300046516 Bacteria 1408
194 Ga0495630_0035313 3300046517 Bacteria 3736
195 Ga0495630_0210204 3300046517 Bacteria 1485
196 Ga0495586_0407965 3300046535 Unclassified 782
197 Ga0495645_0012551 3300046543 Bacteria 5972
198 Ga0495634_0337375 3300046642 Bacteria 905
199 Ga0495599_0074000 3300046678 Bacteria 2127
200 Ga0495646_0427344 3300046680 Unclassified 686
201 Ga0495674_0027377 3300047319 Bacteria 5210
202 Ga0495680_0242067 3300047322 Bacteria 1281
203 Ga0495684_0504125 3300047471 Unclassified 832
204 Ga0495686_0000006 3300047472 Bacteria 770778
205 Ga0495686_0067875 3300047472 Bacteria 2201
206 Ga0496100_0054594 3300048903 Bacteria 2606
207 Ga0496101_0001362 3300048904 Bacteria 14635
208 Ga0496102_0455490 3300048905 Bacteria 1200
209 Ga0496104_0000021 3300048907 Bacteria 243663
210 Ga0496104_0051779 3300048907 Bacteria 3876
211 Ga0496105_0171488 3300048908 Bacteria 1778
212 Ga0496105_1177470 3300048908 Unclassified 565
213 Ga0496106_0301704 3300048909 Bacteria 1285
214 Ga0496107_0037168 3300048910 Bacteria 3494
215 Ga0496112_0350295 3300048915 Unclassified 1419
216 Ga0496114_0000743 3300048917 Bacteria 24334
217 Ga0496115_0870214 3300048918 Unclassified 697
218 Ga0496126_0948386 3300048929 Unclassified 649
219 nmdc:mga09592_723648_c1 3300050508 Unclassified 846
220 nmdc:mga06r32_192910_c1 3300050510 Bacteria 2024
221 nmdc:mga0rr50_1265236_c1 3300050513 Unclassified 626
222 nmdc:mga0rr50_678497_c1 3300050513 Unclassified 879
223 Ga0495601_0028541 3300053077 Bacteria 3456
224 Ga0495612_0054537 3300053078 Bacteria 1647
225 Ga0495612_0156272 3300053078 Bacteria 994
226 Ga0500644_0112609 3300053088 Bacteria 1050
227 Ga0500644_0476236 3300053088 Unclassified 548
228 Ga0500595_101990 3300053119 Unclassified 821
229 Ga0500576_212575 3300053725 Unclassified 644

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100144865 Ga0070708_1001448651 92
2 3300005467 Ga0070706_100043653 Ga0070706_1000436535 92
3 3300005518 Ga0070699_100485110 Ga0070699_1004851102 92
4 3300005536 Ga0070697_100343131 Ga0070697_1003431312 92
5 3300025922 Ga0207646_10061038 Ga0207646_100610382 92
6 3300025929 Ga0207664_11940901 Ga0207664_119409011 92
7 3300026088 Ga0207641_12206558 Ga0207641_122065581 93
8 3300005354 Ga0070675_101564933 Ga0070675_1015649331 96
9 3300005329 Ga0070683_102072528 Ga0070683_1020725281 98
10 3300005434 Ga0070709_11324620 Ga0070709_113246201 99
11 3300005563 Ga0068855_100232074 Ga0068855_1002320741 99
12 3300009174 Ga0105241_10000207 Ga0105241_100002079 99
13 3300025906 Ga0207699_10958658 Ga0207699_109586582 99
14 3300053725 Ga0500576_212575 Ga0500576_212575_131_469 99
15 3300025911 Ga0207654_10001292 Ga0207654_100012928 100
16 3300006847 Ga0075431_100233408 Ga0075431_1002334082 101
17 3300006852 Ga0075433_10218102 Ga0075433_102181022 101
18 3300009147 Ga0114129_10286778 Ga0114129_102867782 101
19 3300037853 Ga0436364_0975370 Ga0436364_0975370_1524_1859 101
20 3300039450 Ga0436363_1586536 Ga0436363_1586536_271_606 101
21 3300050510 nmdc:mga06r32_192910_c1 nmdc:mga06r32_192910_c1_737_1057 101
22 3300053088 Ga0500644_0112609 Ga0500644_0112609_15_359 101
23 3300025961 Ga0207712_11980492 Ga0207712_119804921 102
24 3300006844 Ga0075428_100365502 Ga0075428_1003655022 103
25 3300009147 Ga0114129_11516752 Ga0114129_115167522 103
26 3300025910 Ga0207684_10325299 Ga0207684_103252992 103
27 3300050508 nmdc:mga09592_723648_c1 nmdc:mga09592_723648_c1_507_833 103
28 3300009098 Ga0105245_10099380 Ga0105245_100993803 104
29 3300021384 Ga0213876_10151434 Ga0213876_101514343 104
30 3300025922 Ga0207646_10451579 Ga0207646_104515792 104
31 3300035120 Ga0373957_0174258 Ga0373957_0174258_544_864 104
32 3300035171 Ga0373946_0182666 Ga0373946_0182666_421_747 104
33 3300036401 Ga0373937_0170014 Ga0373937_0170014_1448_1768 104
34 3300039437 Ga0436365_1741909 Ga0436365_1741909_326_649 104
35 3300046514 Ga0495618_0307760 Ga0495618_0307760_17_343 104
36 3300046516 Ga0495628_0115739 Ga0495628_0115739_1674_2000 104
37 3300046516 Ga0495628_0224889 Ga0495628_0224889_755_1075 104
38 3300046517 Ga0495630_0035313 Ga0495630_0035313_2454_2780 104
39 3300046535 Ga0495586_0407965 Ga0495586_0407965_380_706 104
40 3300046642 Ga0495634_0337375 Ga0495634_0337375_304_630 104
41 3300046678 Ga0495599_0074000 Ga0495599_0074000_739_1059 104
42 3300046680 Ga0495646_0427344 Ga0495646_0427344_278_604 104
43 3300047322 Ga0495680_0242067 Ga0495680_0242067_610_930 104
44 3300047471 Ga0495684_0504125 Ga0495684_0504125_22_348 104
45 3300050513 nmdc:mga0rr50_1265236_c1 nmdc:mga0rr50_1265236_c1_88_414 104
46 3300053078 Ga0495612_0156272 Ga0495612_0156272_128_448 104
47 3300009093 Ga0105240_10363160 Ga0105240_103631602 105
48 3300010375 Ga0105239_10015005 Ga0105239_100150055 105
49 3300005327 Ga0070658_10881061 Ga0070658_108810612 106
50 3300013307 Ga0157372_11404215 Ga0157372_114042151 106
51 3300020081 Ga0206354_10308572 Ga0206354_103085722 106
52 3300003214 JGI25165J46597_1045860 JGI25165J46597_10458601 107
53 3300005327 Ga0070658_10037120 Ga0070658_100371203 107
54 3300005336 Ga0070680_100191744 Ga0070680_1001917443 107
55 3300005434 Ga0070709_10000498 Ga0070709_1000049812 107
56 3300005434 Ga0070709_10183712 Ga0070709_101837122 107
57 3300005435 Ga0070714_100473381 Ga0070714_1004733812 107
58 3300005436 Ga0070713_100000322 Ga0070713_10000032228 107
59 3300005436 Ga0070713_102305662 Ga0070713_1023056621 107
60 3300005437 Ga0070710_10343602 Ga0070710_103436023 107
61 3300005439 Ga0070711_100176795 Ga0070711_1001767952 107
62 3300005439 Ga0070711_100225309 Ga0070711_1002253093 107
63 3300005439 Ga0070711_100494981 Ga0070711_1004949811 107
64 3300005445 Ga0070708_100090817 Ga0070708_1000908173 107
65 3300005455 Ga0070663_100116411 Ga0070663_1001164113 107
66 3300005459 Ga0068867_100732592 Ga0068867_1007325921 107
67 3300005467 Ga0070706_100033710 Ga0070706_1000337104 107
68 3300005468 Ga0070707_100007502 Ga0070707_1000075027 107
69 3300005530 Ga0070679_100121069 Ga0070679_1001210692 107
70 3300005530 Ga0070679_101497098 Ga0070679_1014970981 107
71 3300005536 Ga0070697_100001015 Ga0070697_1000010157 107
72 3300005563 Ga0068855_100077515 Ga0068855_1000775154 107
73 3300005578 Ga0068854_101216416 Ga0068854_1012164161 107
74 3300005614 Ga0068856_100518823 Ga0068856_1005188231 107
75 3300006028 Ga0070717_10121361 Ga0070717_101213612 107
76 3300006028 Ga0070717_10144456 Ga0070717_101444561 107
77 3300006163 Ga0070715_10064475 Ga0070715_100644752 107
78 3300006173 Ga0070716_100005730 Ga0070716_1000057304 107
79 3300006173 Ga0070716_100065810 Ga0070716_1000658103 107
80 3300006175 Ga0070712_100000456 Ga0070712_10000045611 107
81 3300006175 Ga0070712_100091118 Ga0070712_1000911184 107
82 3300006237 Ga0097621_100089381 Ga0097621_1000893814 107
83 3300006358 Ga0068871_100047178 Ga0068871_1000471783 107
84 3300007076 Ga0075435_100703875 Ga0075435_1007038751 107
85 3300009093 Ga0105240_10028603 Ga0105240_100286033 107
86 3300009093 Ga0105240_10105792 Ga0105240_101057922 107
87 3300009093 Ga0105240_10207961 Ga0105240_102079612 107
88 3300009177 Ga0105248_10000049 Ga0105248_1000004914 107
89 3300009177 Ga0105248_10967385 Ga0105248_109673851 107
90 3300013104 Ga0157370_10199256 Ga0157370_101992562 107
91 3300013104 Ga0157370_10560657 Ga0157370_105606571 107
92 3300013296 Ga0157374_11595700 Ga0157374_115957001 107
93 3300013297 Ga0157378_12152193 Ga0157378_121521931 107
94 3300013306 Ga0163162_10534613 Ga0163162_105346132 107
95 3300014968 Ga0157379_10079068 Ga0157379_100790683 107
96 3300014969 Ga0157376_10069137 Ga0157376_100691375 107
97 3300014969 Ga0157376_10356879 Ga0157376_103568792 107
98 3300025261 Ga0209233_1007429 Ga0209233_10074292 107
99 3300025898 Ga0207692_10232160 Ga0207692_102321602 107
100 3300025898 Ga0207692_10236213 Ga0207692_102362132 107
101 3300025905 Ga0207685_10049309 Ga0207685_100493092 107
102 3300025906 Ga0207699_10002436 Ga0207699_1000243611 107
103 3300025909 Ga0207705_10005741 Ga0207705_100057413 107
104 3300025910 Ga0207684_10014678 Ga0207684_100146785 107
105 3300025911 Ga0207654_10304708 Ga0207654_103047081 107
106 3300025913 Ga0207695_10084972 Ga0207695_100849722 107
107 3300025913 Ga0207695_10163306 Ga0207695_101633061 107
108 3300025915 Ga0207693_10000055 Ga0207693_1000005554 107
109 3300025915 Ga0207693_10105349 Ga0207693_101053494 107
110 3300025916 Ga0207663_10179243 Ga0207663_101792431 107
111 3300025917 Ga0207660_10595258 Ga0207660_105952582 107
112 3300025921 Ga0207652_10111125 Ga0207652_101111252 107
113 3300025922 Ga0207646_10000992 Ga0207646_100009925 107
114 3300025928 Ga0207700_10000206 Ga0207700_1000020625 107
115 3300025929 Ga0207664_10625940 Ga0207664_106259402 107
116 3300025939 Ga0207665_10005073 Ga0207665_1000507310 107
117 3300025939 Ga0207665_10007618 Ga0207665_100076186 107
118 3300025941 Ga0207711_10000033 Ga0207711_1000003351 107
119 3300025949 Ga0207667_10251433 Ga0207667_102514332 107
120 3300025949 Ga0207667_11357733 Ga0207667_113577332 107
121 3300025981 Ga0207640_11053929 Ga0207640_110539291 107
122 3300026067 Ga0207678_10016113 Ga0207678_100161136 107
123 3300026078 Ga0207702_10462293 Ga0207702_104622931 107
124 3300026089 Ga0207648_10992875 Ga0207648_109928752 107
125 3300028666 Ga0265336_10001220 Ga0265336_1000122010 107
126 3300046477 Ga0495664_0399505 Ga0495664_0399505_362_685 107
127 3300046516 Ga0495628_0050056 Ga0495628_0050056_2380_2703 107
128 3300046517 Ga0495630_0210204 Ga0495630_0210204_815_1138 107
129 3300046543 Ga0495645_0012551 Ga0495645_0012551_4291_4614 107
130 3300047319 Ga0495674_0027377 Ga0495674_0027377_602_925 107
131 3300047472 Ga0495686_0000006 Ga0495686_0000006_341378_341701 107
132 3300047472 Ga0495686_0067875 Ga0495686_0067875_1470_1793 107
133 3300048907 Ga0496104_0000021 Ga0496104_0000021_113573_113896 107
134 3300048908 Ga0496105_1177470 Ga0496105_1177470_66_389 107
135 3300048915 Ga0496112_0350295 Ga0496112_0350295_1042_1365 107
136 3300048918 Ga0496115_0870214 Ga0496115_0870214_265_588 107
137 3300050513 nmdc:mga0rr50_678497_c1 nmdc:mga0rr50_678497_c1_149_472 107
138 3300053077 Ga0495601_0028541 Ga0495601_0028541_2215_2538 107
139 3300053078 Ga0495612_0054537 Ga0495612_0054537_1032_1355 107
140 3300053088 Ga0500644_0476236 Ga0500644_0476236_50_373 107
141 3300053119 Ga0500595_101990 Ga0500595_101990_261_584 107
142 3300005327 Ga0070658_10001003 Ga0070658_1000100318 108
143 3300005563 Ga0068855_100974132 Ga0068855_1009741322 108
144 3300013296 Ga0157374_10060042 Ga0157374_100600422 108
145 3300025909 Ga0207705_10000883 Ga0207705_1000088318 108
146 3300025913 Ga0207695_10673911 Ga0207695_106739112 108
147 3300028556 Ga0265337_1006225 Ga0265337_10062251 108
148 3300028573 Ga0265334_10000234 Ga0265334_100002349 108
149 3300028573 Ga0265334_10151454 Ga0265334_101514542 108
150 3300028800 Ga0265338_10002091 Ga0265338_1000209124 108
151 3300028800 Ga0265338_10505527 Ga0265338_105055272 108
152 3300005468 Ga0070707_101927089 Ga0070707_1019270891 110
153 3300005618 Ga0068864_100651749 Ga0068864_1006517492 110
154 3300048929 Ga0496126_0948386 Ga0496126_0948386_94_426 110
155 3300005293 Ga0065715_10497164 Ga0065715_104971641 111
156 3300005436 Ga0070713_100115947 Ga0070713_1001159472 111
157 3300005518 Ga0070699_100526040 Ga0070699_1005260401 111
158 3300005841 Ga0068863_100484841 Ga0068863_1004848412 111
159 3300006175 Ga0070712_100100306 Ga0070712_1001003063 111
160 3300006881 Ga0068865_100570013 Ga0068865_1005700131 111
161 3300007265 Ga0099794_10062814 Ga0099794_100628142 111
162 3300009174 Ga0105241_10497999 Ga0105241_104979992 111
163 3300009545 Ga0105237_10376567 Ga0105237_103765673 111
164 3300013297 Ga0157378_10741381 Ga0157378_107413812 111
165 3300025914 Ga0207671_10513381 Ga0207671_105133812 111
166 3300026088 Ga0207641_10539904 Ga0207641_105399042 111
167 3300033180 Ga0307510_10138946 Ga0307510_101389462 111
168 3300035117 Ga0373953_0397227 Ga0373953_0397227_245_583 111
169 3300035172 Ga0373955_0116439 Ga0373955_0116439_684_1022 111
170 3300035692 Ga0373935_0572030 Ga0373935_0572030_440_778 111
171 3300036401 Ga0373937_1089034 Ga0373937_1089034_250_588 111
172 3300039438 Ga0436360_0683347 Ga0436360_0683347_42_380 111
173 3300044673 Ga0453683_0220173 Ga0453683_0220173_742_1077 111
174 3300044842 Ga0466957_0006633 Ga0466957_0006633_1665_2000 111
175 3300045051 Ga0451576_0964573 Ga0451576_0964573_75_410 111
176 3300001915 JGI24741J21665_1003340 JGI24741J21665_10033402 114
177 3300001979 JGI24740J21852_10017466 JGI24740J21852_100174665 114
178 3300002075 JGI24738J21930_10003292 JGI24738J21930_100032922 114
179 3300002741 JGI25157J39369_1035886 JGI25157J39369_10358861 114
180 3300003214 JGI25165J46597_1000188 JGI25165J46597_100018871 114
181 3300005327 Ga0070658_10558666 Ga0070658_105586662 114
182 3300005328 Ga0070676_10171121 Ga0070676_101711212 114
183 3300005455 Ga0070663_100036894 Ga0070663_1000368944 114
184 3300005539 Ga0068853_100005297 Ga0068853_1000052976 114
185 3300005578 Ga0068854_100000027 Ga0068854_10000002733 114
186 3300005614 Ga0068856_100002333 Ga0068856_1000023335 114
187 3300005616 Ga0068852_100506997 Ga0068852_1005069972 114
188 3300005834 Ga0068851_10058058 Ga0068851_100580582 114
189 3300006237 Ga0097621_100003095 Ga0097621_1000030956 114
190 3300006358 Ga0068871_100004613 Ga0068871_1000046132 114
191 3300009174 Ga0105241_10059533 Ga0105241_100595332 114
192 3300009551 Ga0105238_10141035 Ga0105238_101410353 114
193 3300010375 Ga0105239_10006050 Ga0105239_100060505 114
194 3300013100 Ga0157373_10093177 Ga0157373_100931772 114
195 3300013102 Ga0157371_11007468 Ga0157371_110074681 114
196 3300013105 Ga0157369_10085566 Ga0157369_100855665 114
197 3300013296 Ga0157374_10349458 Ga0157374_103494582 114
198 3300025231 Ga0207427_100914 Ga0207427_1009143 114
199 3300025250 Ga0209026_1001702 Ga0209026_10017028 114
200 3300025261 Ga0209233_1000120 Ga0209233_1000120212 114
201 3300025321 Ga0207656_10071683 Ga0207656_100716832 114
202 3300025909 Ga0207705_10371793 Ga0207705_103717932 114
203 3300025911 Ga0207654_10034449 Ga0207654_100344494 114
204 3300025981 Ga0207640_10000145 Ga0207640_100001459 114
205 3300026041 Ga0207639_10005234 Ga0207639_100052346 114
206 3300026067 Ga0207678_10056269 Ga0207678_100562692 114
207 3300026078 Ga0207702_10003111 Ga0207702_100031113 114
208 3300026142 Ga0207698_10808875 Ga0207698_108088752 114
209 3300037312 Ga0395899_0000797 Ga0395899_0000797_17581_17937 114
210 3300037418 Ga0395900_0060992 Ga0395900_0060992_3303_3659 114
211 3300037418 Ga0395900_0085967 Ga0395900_0085967_2644_3000 114
212 3300037471 Ga0395905_0170339 Ga0395905_0170339_568_924 114
213 3300037471 Ga0395905_1091894 Ga0395905_1091894_235_591 114
214 3300038443 Ga0395901_1098763 Ga0395901_1098763_119_475 114
215 3300048905 Ga0496102_0455490 Ga0496102_0455490_301_657 114
216 3300000546 LJNas_1019438 LJNas_10194381 115
217 3300005548 Ga0070665_102081843 Ga0070665_1020818431 115
218 3300005618 Ga0068864_100140621 Ga0068864_1001406212 115
219 3300005841 Ga0068863_100553640 Ga0068863_1005536402 115
220 3300014325 Ga0163163_10979976 Ga0163163_109799761 115
221 3300014968 Ga0157379_11113566 Ga0157379_111135661 115
222 3300026088 Ga0207641_10322294 Ga0207641_103222943 115
223 3300048903 Ga0496100_0054594 Ga0496100_0054594_687_1040 115
224 3300048904 Ga0496101_0001362 Ga0496101_0001362_9745_10098 115
225 3300048907 Ga0496104_0051779 Ga0496104_0051779_1720_2073 115
226 3300048908 Ga0496105_0171488 Ga0496105_0171488_146_499 115
227 3300048909 Ga0496106_0301704 Ga0496106_0301704_118_471 115
228 3300048910 Ga0496107_0037168 Ga0496107_0037168_828_1181 115
229 3300048917 Ga0496114_0000743 Ga0496114_0000743_10860_11213 115

Structural Annotation

Top 5 Hits

ID Description Score Start End
7svx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and harmane 0.735 10 110
7svx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and harmane 0.7109 10 110
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.6527 10 110
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.6332 10 110
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.6138 12 112
ID Description Score Start End Superfamily
af_P9WFN9_2_109_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8655 8 115 1.20.1280.290
af_Q2FVS6_1_108_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8611 8 112 1.20.1280.290
af_P76169_1_108_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8594 8 110 1.20.1280.290
af_P9WFN9_2_109_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.844 8 115 1.20.1280.290
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8379 11 110 1.10.3730.20
ID Description Score Start End GO Terms
AF-E8V4R5-F1-model_v4 Small multidrug resistance protein 0.9873 12 114 GO:0016020
AF-A0A1M7U925-F1-model_v4 Small multidrug resistance family-3 protein 0.9845 7 114 GO:0016020
AF-A0A1M7U925-F1-model_v4 Small multidrug resistance family-3 protein 0.9668 7 114 GO:0016020
AF-A0A257NZU6-F1-model_v4 EamA domain-containing protein 0.9635 12 115 GO:0016020
AF-A0A2V9UW04-F1-model_v4 EamA domain-containing protein 0.9549 14 113 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.84 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map