F341828
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 229 | 151 | 229 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_102081843|Ga0070665_1020818431 |
| Length | 122 |
| Sequence | MVGPGPDREVGLANIAILAALLLAALLEVGGDALVRAGLHGATMPARLGLLALGGVVLFAYGVTVNLPPWDFGRLLGVYVTLFFLLAQLVGWLAFGTRPTAPILVGGALIVAGGLTITFWQT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 68 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 99 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 103 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 104 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 105 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 106 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 107 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 115 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 116 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 117 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 118 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 119 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 120 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 136 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 137 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 138 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 139 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 140 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 141 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 142 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 143 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 144 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 150 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 151 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0.44 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.93 |
| Nodule | 0 |
| Rhizoplane | 5.24 |
| Rhizosphere | 87.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1019438 | 3300000546 | Bacteria | 724 |
| 2 | JGI24741J21665_1003340 | 3300001915 | Bacteria | 3844 |
| 3 | JGI24740J21852_10017466 | 3300001979 | Bacteria | 2566 |
| 4 | JGI24738J21930_10003292 | 3300002075 | Bacteria | 4105 |
| 5 | JGI25157J39369_1035886 | 3300002741 | Bacteria | 556 |
| 6 | JGI25165J46597_1000188 | 3300003214 | Bacteria | 92329 |
| 7 | JGI25165J46597_1045860 | 3300003214 | Bacteria | 560 |
| 8 | Ga0065715_10497164 | 3300005293 | Unclassified | 783 |
| 9 | Ga0070658_10001003 | 3300005327 | Bacteria | 24214 |
| 10 | Ga0070658_10037120 | 3300005327 | Unclassified | 3927 |
| 11 | Ga0070658_10558666 | 3300005327 | Bacteria | 991 |
| 12 | Ga0070658_10881061 | 3300005327 | Unclassified | 778 |
| 13 | Ga0070676_10171121 | 3300005328 | Bacteria | 1405 |
| 14 | Ga0070683_102072528 | 3300005329 | Unclassified | 546 |
| 15 | Ga0070680_100191744 | 3300005336 | Unclassified | 1722 |
| 16 | Ga0070675_101564933 | 3300005354 | Unclassified | 608 |
| 17 | Ga0070709_10000498 | 3300005434 | Bacteria | 23165 |
| 18 | Ga0070709_10183712 | 3300005434 | Viruses | 1470 |
| 19 | Ga0070709_11324620 | 3300005434 | Bacteria | 581 |
| 20 | Ga0070714_100473381 | 3300005435 | Unclassified | 1192 |
| 21 | Ga0070713_100000322 | 3300005436 | Bacteria | 31317 |
| 22 | Ga0070713_100115947 | 3300005436 | Bacteria | 2342 |
| 23 | Ga0070713_102305662 | 3300005436 | Unclassified | 521 |
| 24 | Ga0070710_10343602 | 3300005437 | Unclassified | 986 |
| 25 | Ga0070711_100176795 | 3300005439 | Unclassified | 1631 |
| 26 | Ga0070711_100225309 | 3300005439 | Unclassified | 1459 |
| 27 | Ga0070711_100494981 | 3300005439 | Unclassified | 1007 |
| 28 | Ga0070708_100090817 | 3300005445 | Bacteria | 2780 |
| 29 | Ga0070708_100144865 | 3300005445 | Bacteria | 2206 |
| 30 | Ga0070663_100036894 | 3300005455 | Bacteria | 3399 |
| 31 | Ga0070663_100116411 | 3300005455 | Unclassified | 2014 |
| 32 | Ga0068867_100732592 | 3300005459 | Unclassified | 875 |
| 33 | Ga0070706_100033710 | 3300005467 | Bacteria | 4727 |
| 34 | Ga0070706_100043653 | 3300005467 | Bacteria | 4142 |
| 35 | Ga0070707_100007502 | 3300005468 | Bacteria | 10127 |
| 36 | Ga0070707_101927089 | 3300005468 | Unclassified | 558 |
| 37 | Ga0070699_100485110 | 3300005518 | Unclassified | 1122 |
| 38 | Ga0070699_100526040 | 3300005518 | Bacteria | 1075 |
| 39 | Ga0070679_100121069 | 3300005530 | Bacteria | 2601 |
| 40 | Ga0070679_101497098 | 3300005530 | Unclassified | 622 |
| 41 | Ga0070697_100001015 | 3300005536 | Bacteria | 21202 |
| 42 | Ga0070697_100343131 | 3300005536 | Unclassified | 1289 |
| 43 | Ga0068853_100005297 | 3300005539 | Bacteria | 10094 |
| 44 | Ga0070665_102081843 | 3300005548 | Bacteria | 572 |
| 45 | Ga0068855_100077515 | 3300005563 | Bacteria | 3856 |
| 46 | Ga0068855_100232074 | 3300005563 | Bacteria | 2066 |
| 47 | Ga0068855_100974132 | 3300005563 | Unclassified | 892 |
| 48 | Ga0068854_100000027 | 3300005578 | Bacteria | 117836 |
| 49 | Ga0068854_101216416 | 3300005578 | Unclassified | 675 |
| 50 | Ga0068856_100002333 | 3300005614 | Bacteria | 19522 |
| 51 | Ga0068856_100518823 | 3300005614 | Unclassified | 1213 |
| 52 | Ga0068852_100506997 | 3300005616 | Bacteria | 1202 |
| 53 | Ga0068864_100140621 | 3300005618 | Bacteria | 2177 |
| 54 | Ga0068864_100651749 | 3300005618 | Bacteria | 1025 |
| 55 | Ga0068851_10058058 | 3300005834 | Bacteria | 1977 |
| 56 | Ga0068863_100484841 | 3300005841 | Bacteria | 1216 |
| 57 | Ga0068863_100553640 | 3300005841 | Bacteria | 1136 |
| 58 | Ga0070717_10121361 | 3300006028 | Bacteria | 2239 |
| 59 | Ga0070717_10144456 | 3300006028 | Bacteria | 2054 |
| 60 | Ga0070715_10064475 | 3300006163 | Unclassified | 1618 |
| 61 | Ga0070716_100005730 | 3300006173 | Bacteria | 6034 |
| 62 | Ga0070716_100065810 | 3300006173 | Unclassified | 2112 |
| 63 | Ga0070712_100000456 | 3300006175 | Bacteria | 23452 |
| 64 | Ga0070712_100091118 | 3300006175 | Viruses | 2233 |
| 65 | Ga0070712_100100306 | 3300006175 | Bacteria | 2139 |
| 66 | Ga0097621_100003095 | 3300006237 | Bacteria | 11412 |
| 67 | Ga0097621_100089381 | 3300006237 | Unclassified | 2575 |
| 68 | Ga0068871_100004613 | 3300006358 | Bacteria | 9620 |
| 69 | Ga0068871_100047178 | 3300006358 | Unclassified | 3473 |
| 70 | Ga0075428_100365502 | 3300006844 | Unclassified | 1548 |
| 71 | Ga0075431_100233408 | 3300006847 | Unclassified | 1874 |
| 72 | Ga0075433_10218102 | 3300006852 | Unclassified | 1695 |
| 73 | Ga0068865_100570013 | 3300006881 | Bacteria | 953 |
| 74 | Ga0075435_100703875 | 3300007076 | Unclassified | 878 |
| 75 | Ga0099794_10062814 | 3300007265 | Unclassified | 1807 |
| 76 | Ga0105240_10028603 | 3300009093 | Bacteria | 7275 |
| 77 | Ga0105240_10105792 | 3300009093 | Bacteria | 3415 |
| 78 | Ga0105240_10207961 | 3300009093 | Bacteria | 2289 |
| 79 | Ga0105240_10363160 | 3300009093 | Bacteria | 1639 |
| 80 | Ga0105245_10099380 | 3300009098 | Bacteria | 2690 |
| 81 | Ga0114129_10286778 | 3300009147 | Bacteria | 2198 |
| 82 | Ga0114129_11516752 | 3300009147 | Unclassified | 823 |
| 83 | Ga0105241_10000207 | 3300009174 | Bacteria | 44168 |
| 84 | Ga0105241_10059533 | 3300009174 | Bacteria | 2937 |
| 85 | Ga0105241_10497999 | 3300009174 | Bacteria | 1086 |
| 86 | Ga0105248_10000049 | 3300009177 | Bacteria | 153741 |
| 87 | Ga0105248_10967385 | 3300009177 | Bacteria | 961 |
| 88 | Ga0105237_10376567 | 3300009545 | Bacteria | 1424 |
| 89 | Ga0105238_10141035 | 3300009551 | Bacteria | 2387 |
| 90 | Ga0105239_10006050 | 3300010375 | Bacteria | 14087 |
| 91 | Ga0105239_10015005 | 3300010375 | Bacteria | 8588 |
| 92 | Ga0157373_10093177 | 3300013100 | Bacteria | 2122 |
| 93 | Ga0157371_11007468 | 3300013102 | Bacteria | 636 |
| 94 | Ga0157370_10199256 | 3300013104 | Unclassified | 1857 |
| 95 | Ga0157370_10560657 | 3300013104 | Unclassified | 1047 |
| 96 | Ga0157369_10085566 | 3300013105 | Bacteria | 3369 |
| 97 | Ga0157374_10060042 | 3300013296 | Unclassified | 3558 |
| 98 | Ga0157374_10349458 | 3300013296 | Bacteria | 1469 |
| 99 | Ga0157374_11595700 | 3300013296 | Unclassified | 676 |
| 100 | Ga0157378_10741381 | 3300013297 | Bacteria | 1004 |
| 101 | Ga0157378_12152193 | 3300013297 | Unclassified | 609 |
| 102 | Ga0163162_10534613 | 3300013306 | Bacteria | 1301 |
| 103 | Ga0157372_11404215 | 3300013307 | Bacteria | 805 |
| 104 | Ga0163163_10979976 | 3300014325 | Bacteria | 909 |
| 105 | Ga0157379_10079068 | 3300014968 | Bacteria | 2945 |
| 106 | Ga0157379_11113566 | 3300014968 | Bacteria | 757 |
| 107 | Ga0157376_10069137 | 3300014969 | Unclassified | 2993 |
| 108 | Ga0157376_10356879 | 3300014969 | Bacteria | 1401 |
| 109 | Ga0206354_10308572 | 3300020081 | Bacteria | 1474 |
| 110 | Ga0213876_10151434 | 3300021384 | Bacteria | 1233 |
| 111 | Ga0207427_100914 | 3300025231 | Bacteria | 12723 |
| 112 | Ga0209026_1001702 | 3300025250 | Bacteria | 9180 |
| 113 | Ga0209233_1000120 | 3300025261 | Bacteria | 233311 |
| 114 | Ga0209233_1007429 | 3300025261 | Bacteria | 3474 |
| 115 | Ga0207656_10071683 | 3300025321 | Bacteria | 1541 |
| 116 | Ga0207692_10232160 | 3300025898 | Unclassified | 1098 |
| 117 | Ga0207692_10236213 | 3300025898 | Unclassified | 1090 |
| 118 | Ga0207685_10049309 | 3300025905 | Unclassified | 1617 |
| 119 | Ga0207699_10002436 | 3300025906 | Bacteria | 8782 |
| 120 | Ga0207699_10958658 | 3300025906 | Bacteria | 632 |
| 121 | Ga0207705_10000883 | 3300025909 | Bacteria | 24528 |
| 122 | Ga0207705_10005741 | 3300025909 | Bacteria | 9261 |
| 123 | Ga0207705_10371793 | 3300025909 | Bacteria | 1103 |
| 124 | Ga0207684_10014678 | 3300025910 | Bacteria | 6747 |
| 125 | Ga0207684_10325299 | 3300025910 | Unclassified | 1325 |
| 126 | Ga0207654_10001292 | 3300025911 | Bacteria | 13327 |
| 127 | Ga0207654_10034449 | 3300025911 | Bacteria | 2813 |
| 128 | Ga0207654_10304708 | 3300025911 | Unclassified | 1084 |
| 129 | Ga0207695_10084972 | 3300025913 | Bacteria | 3194 |
| 130 | Ga0207695_10163306 | 3300025913 | Bacteria | 2157 |
| 131 | Ga0207695_10673911 | 3300025913 | Bacteria | 915 |
| 132 | Ga0207671_10513381 | 3300025914 | Bacteria | 955 |
| 133 | Ga0207693_10000055 | 3300025915 | Bacteria | 96481 |
| 134 | Ga0207693_10105349 | 3300025915 | Viruses | 2211 |
| 135 | Ga0207663_10179243 | 3300025916 | Unclassified | 1512 |
| 136 | Ga0207660_10595258 | 3300025917 | Unclassified | 900 |
| 137 | Ga0207652_10111125 | 3300025921 | Bacteria | 2430 |
| 138 | Ga0207646_10000992 | 3300025922 | Bacteria | 36429 |
| 139 | Ga0207646_10061038 | 3300025922 | Bacteria | 3365 |
| 140 | Ga0207646_10451579 | 3300025922 | Bacteria | 1160 |
| 141 | Ga0207700_10000206 | 3300025928 | Bacteria | 35436 |
| 142 | Ga0207664_10625940 | 3300025929 | Unclassified | 967 |
| 143 | Ga0207664_11940901 | 3300025929 | Unclassified | 511 |
| 144 | Ga0207665_10005073 | 3300025939 | Bacteria | 8791 |
| 145 | Ga0207665_10007618 | 3300025939 | Bacteria | 7150 |
| 146 | Ga0207711_10000033 | 3300025941 | Bacteria | 193513 |
| 147 | Ga0207667_10251433 | 3300025949 | Unclassified | 1808 |
| 148 | Ga0207667_11357733 | 3300025949 | Bacteria | 685 |
| 149 | Ga0207712_11980492 | 3300025961 | Unclassified | 521 |
| 150 | Ga0207640_10000145 | 3300025981 | Bacteria | 51603 |
| 151 | Ga0207640_11053929 | 3300025981 | Unclassified | 717 |
| 152 | Ga0207639_10005234 | 3300026041 | Bacteria | 8750 |
| 153 | Ga0207678_10016113 | 3300026067 | Bacteria | 6564 |
| 154 | Ga0207678_10056269 | 3300026067 | Bacteria | 3386 |
| 155 | Ga0207702_10003111 | 3300026078 | Bacteria | 15373 |
| 156 | Ga0207702_10462293 | 3300026078 | Unclassified | 1233 |
| 157 | Ga0207641_10322294 | 3300026088 | Bacteria | 1466 |
| 158 | Ga0207641_10539904 | 3300026088 | Bacteria | 1136 |
| 159 | Ga0207641_12206558 | 3300026088 | Bacteria | 551 |
| 160 | Ga0207648_10992875 | 3300026089 | Bacteria | 786 |
| 161 | Ga0207698_10808875 | 3300026142 | Bacteria | 940 |
| 162 | Ga0265337_1006225 | 3300028556 | Unclassified | 4634 |
| 163 | Ga0265334_10000234 | 3300028573 | Bacteria | 31941 |
| 164 | Ga0265334_10151454 | 3300028573 | Unclassified | 818 |
| 165 | Ga0265336_10001220 | 3300028666 | Bacteria | 12202 |
| 166 | Ga0265338_10002091 | 3300028800 | Bacteria | 30830 |
| 167 | Ga0265338_10505527 | 3300028800 | Bacteria | 850 |
| 168 | Ga0307510_10138946 | 3300033180 | Bacteria | 2078 |
| 169 | Ga0373953_0397227 | 3300035117 | Unclassified | 607 |
| 170 | Ga0373957_0174258 | 3300035120 | Bacteria | 890 |
| 171 | Ga0373946_0182666 | 3300035171 | Unclassified | 996 |
| 172 | Ga0373955_0116439 | 3300035172 | Unclassified | 1550 |
| 173 | Ga0373935_0572030 | 3300035692 | Unclassified | 825 |
| 174 | Ga0373937_0170014 | 3300036401 | Bacteria | 2045 |
| 175 | Ga0373937_1089034 | 3300036401 | Bacteria | 748 |
| 176 | Ga0395899_0000797 | 3300037312 | Bacteria | 30839 |
| 177 | Ga0395900_0060992 | 3300037418 | Bacteria | 3879 |
| 178 | Ga0395900_0085967 | 3300037418 | Bacteria | 3232 |
| 179 | Ga0395905_0170339 | 3300037471 | Bacteria | 2045 |
| 180 | Ga0395905_1091894 | 3300037471 | Bacteria | 701 |
| 181 | Ga0436364_0975370 | 3300037853 | Bacteria | 1946 |
| 182 | Ga0395901_1098763 | 3300038443 | Bacteria | 766 |
| 183 | Ga0436365_1741909 | 3300039437 | Bacteria | 900 |
| 184 | Ga0436360_0683347 | 3300039438 | Unclassified | 568 |
| 185 | Ga0436363_1586536 | 3300039450 | Unclassified | 1406 |
| 186 | Ga0453683_0220173 | 3300044673 | Unclassified | 1207 |
| 187 | Ga0466957_0006633 | 3300044842 | Bacteria | 6545 |
| 188 | Ga0451576_0964573 | 3300045051 | Bacteria | 894 |
| 189 | Ga0495664_0399505 | 3300046477 | Unclassified | 825 |
| 190 | Ga0495618_0307760 | 3300046514 | Bacteria | 983 |
| 191 | Ga0495628_0050056 | 3300046516 | Bacteria | 3306 |
| 192 | Ga0495628_0115739 | 3300046516 | Bacteria | 2059 |
| 193 | Ga0495628_0224889 | 3300046516 | Bacteria | 1408 |
| 194 | Ga0495630_0035313 | 3300046517 | Bacteria | 3736 |
| 195 | Ga0495630_0210204 | 3300046517 | Bacteria | 1485 |
| 196 | Ga0495586_0407965 | 3300046535 | Unclassified | 782 |
| 197 | Ga0495645_0012551 | 3300046543 | Bacteria | 5972 |
| 198 | Ga0495634_0337375 | 3300046642 | Bacteria | 905 |
| 199 | Ga0495599_0074000 | 3300046678 | Bacteria | 2127 |
| 200 | Ga0495646_0427344 | 3300046680 | Unclassified | 686 |
| 201 | Ga0495674_0027377 | 3300047319 | Bacteria | 5210 |
| 202 | Ga0495680_0242067 | 3300047322 | Bacteria | 1281 |
| 203 | Ga0495684_0504125 | 3300047471 | Unclassified | 832 |
| 204 | Ga0495686_0000006 | 3300047472 | Bacteria | 770778 |
| 205 | Ga0495686_0067875 | 3300047472 | Bacteria | 2201 |
| 206 | Ga0496100_0054594 | 3300048903 | Bacteria | 2606 |
| 207 | Ga0496101_0001362 | 3300048904 | Bacteria | 14635 |
| 208 | Ga0496102_0455490 | 3300048905 | Bacteria | 1200 |
| 209 | Ga0496104_0000021 | 3300048907 | Bacteria | 243663 |
| 210 | Ga0496104_0051779 | 3300048907 | Bacteria | 3876 |
| 211 | Ga0496105_0171488 | 3300048908 | Bacteria | 1778 |
| 212 | Ga0496105_1177470 | 3300048908 | Unclassified | 565 |
| 213 | Ga0496106_0301704 | 3300048909 | Bacteria | 1285 |
| 214 | Ga0496107_0037168 | 3300048910 | Bacteria | 3494 |
| 215 | Ga0496112_0350295 | 3300048915 | Unclassified | 1419 |
| 216 | Ga0496114_0000743 | 3300048917 | Bacteria | 24334 |
| 217 | Ga0496115_0870214 | 3300048918 | Unclassified | 697 |
| 218 | Ga0496126_0948386 | 3300048929 | Unclassified | 649 |
| 219 | nmdc:mga09592_723648_c1 | 3300050508 | Unclassified | 846 |
| 220 | nmdc:mga06r32_192910_c1 | 3300050510 | Bacteria | 2024 |
| 221 | nmdc:mga0rr50_1265236_c1 | 3300050513 | Unclassified | 626 |
| 222 | nmdc:mga0rr50_678497_c1 | 3300050513 | Unclassified | 879 |
| 223 | Ga0495601_0028541 | 3300053077 | Bacteria | 3456 |
| 224 | Ga0495612_0054537 | 3300053078 | Bacteria | 1647 |
| 225 | Ga0495612_0156272 | 3300053078 | Bacteria | 994 |
| 226 | Ga0500644_0112609 | 3300053088 | Bacteria | 1050 |
| 227 | Ga0500644_0476236 | 3300053088 | Unclassified | 548 |
| 228 | Ga0500595_101990 | 3300053119 | Unclassified | 821 |
| 229 | Ga0500576_212575 | 3300053725 | Unclassified | 644 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100144865 | Ga0070708_1001448651 | 92 |
| 2 | 3300005467 | Ga0070706_100043653 | Ga0070706_1000436535 | 92 |
| 3 | 3300005518 | Ga0070699_100485110 | Ga0070699_1004851102 | 92 |
| 4 | 3300005536 | Ga0070697_100343131 | Ga0070697_1003431312 | 92 |
| 5 | 3300025922 | Ga0207646_10061038 | Ga0207646_100610382 | 92 |
| 6 | 3300025929 | Ga0207664_11940901 | Ga0207664_119409011 | 92 |
| 7 | 3300026088 | Ga0207641_12206558 | Ga0207641_122065581 | 93 |
| 8 | 3300005354 | Ga0070675_101564933 | Ga0070675_1015649331 | 96 |
| 9 | 3300005329 | Ga0070683_102072528 | Ga0070683_1020725281 | 98 |
| 10 | 3300005434 | Ga0070709_11324620 | Ga0070709_113246201 | 99 |
| 11 | 3300005563 | Ga0068855_100232074 | Ga0068855_1002320741 | 99 |
| 12 | 3300009174 | Ga0105241_10000207 | Ga0105241_100002079 | 99 |
| 13 | 3300025906 | Ga0207699_10958658 | Ga0207699_109586582 | 99 |
| 14 | 3300053725 | Ga0500576_212575 | Ga0500576_212575_131_469 | 99 |
| 15 | 3300025911 | Ga0207654_10001292 | Ga0207654_100012928 | 100 |
| 16 | 3300006847 | Ga0075431_100233408 | Ga0075431_1002334082 | 101 |
| 17 | 3300006852 | Ga0075433_10218102 | Ga0075433_102181022 | 101 |
| 18 | 3300009147 | Ga0114129_10286778 | Ga0114129_102867782 | 101 |
| 19 | 3300037853 | Ga0436364_0975370 | Ga0436364_0975370_1524_1859 | 101 |
| 20 | 3300039450 | Ga0436363_1586536 | Ga0436363_1586536_271_606 | 101 |
| 21 | 3300050510 | nmdc:mga06r32_192910_c1 | nmdc:mga06r32_192910_c1_737_1057 | 101 |
| 22 | 3300053088 | Ga0500644_0112609 | Ga0500644_0112609_15_359 | 101 |
| 23 | 3300025961 | Ga0207712_11980492 | Ga0207712_119804921 | 102 |
| 24 | 3300006844 | Ga0075428_100365502 | Ga0075428_1003655022 | 103 |
| 25 | 3300009147 | Ga0114129_11516752 | Ga0114129_115167522 | 103 |
| 26 | 3300025910 | Ga0207684_10325299 | Ga0207684_103252992 | 103 |
| 27 | 3300050508 | nmdc:mga09592_723648_c1 | nmdc:mga09592_723648_c1_507_833 | 103 |
| 28 | 3300009098 | Ga0105245_10099380 | Ga0105245_100993803 | 104 |
| 29 | 3300021384 | Ga0213876_10151434 | Ga0213876_101514343 | 104 |
| 30 | 3300025922 | Ga0207646_10451579 | Ga0207646_104515792 | 104 |
| 31 | 3300035120 | Ga0373957_0174258 | Ga0373957_0174258_544_864 | 104 |
| 32 | 3300035171 | Ga0373946_0182666 | Ga0373946_0182666_421_747 | 104 |
| 33 | 3300036401 | Ga0373937_0170014 | Ga0373937_0170014_1448_1768 | 104 |
| 34 | 3300039437 | Ga0436365_1741909 | Ga0436365_1741909_326_649 | 104 |
| 35 | 3300046514 | Ga0495618_0307760 | Ga0495618_0307760_17_343 | 104 |
| 36 | 3300046516 | Ga0495628_0115739 | Ga0495628_0115739_1674_2000 | 104 |
| 37 | 3300046516 | Ga0495628_0224889 | Ga0495628_0224889_755_1075 | 104 |
| 38 | 3300046517 | Ga0495630_0035313 | Ga0495630_0035313_2454_2780 | 104 |
| 39 | 3300046535 | Ga0495586_0407965 | Ga0495586_0407965_380_706 | 104 |
| 40 | 3300046642 | Ga0495634_0337375 | Ga0495634_0337375_304_630 | 104 |
| 41 | 3300046678 | Ga0495599_0074000 | Ga0495599_0074000_739_1059 | 104 |
| 42 | 3300046680 | Ga0495646_0427344 | Ga0495646_0427344_278_604 | 104 |
| 43 | 3300047322 | Ga0495680_0242067 | Ga0495680_0242067_610_930 | 104 |
| 44 | 3300047471 | Ga0495684_0504125 | Ga0495684_0504125_22_348 | 104 |
| 45 | 3300050513 | nmdc:mga0rr50_1265236_c1 | nmdc:mga0rr50_1265236_c1_88_414 | 104 |
| 46 | 3300053078 | Ga0495612_0156272 | Ga0495612_0156272_128_448 | 104 |
| 47 | 3300009093 | Ga0105240_10363160 | Ga0105240_103631602 | 105 |
| 48 | 3300010375 | Ga0105239_10015005 | Ga0105239_100150055 | 105 |
| 49 | 3300005327 | Ga0070658_10881061 | Ga0070658_108810612 | 106 |
| 50 | 3300013307 | Ga0157372_11404215 | Ga0157372_114042151 | 106 |
| 51 | 3300020081 | Ga0206354_10308572 | Ga0206354_103085722 | 106 |
| 52 | 3300003214 | JGI25165J46597_1045860 | JGI25165J46597_10458601 | 107 |
| 53 | 3300005327 | Ga0070658_10037120 | Ga0070658_100371203 | 107 |
| 54 | 3300005336 | Ga0070680_100191744 | Ga0070680_1001917443 | 107 |
| 55 | 3300005434 | Ga0070709_10000498 | Ga0070709_1000049812 | 107 |
| 56 | 3300005434 | Ga0070709_10183712 | Ga0070709_101837122 | 107 |
| 57 | 3300005435 | Ga0070714_100473381 | Ga0070714_1004733812 | 107 |
| 58 | 3300005436 | Ga0070713_100000322 | Ga0070713_10000032228 | 107 |
| 59 | 3300005436 | Ga0070713_102305662 | Ga0070713_1023056621 | 107 |
| 60 | 3300005437 | Ga0070710_10343602 | Ga0070710_103436023 | 107 |
| 61 | 3300005439 | Ga0070711_100176795 | Ga0070711_1001767952 | 107 |
| 62 | 3300005439 | Ga0070711_100225309 | Ga0070711_1002253093 | 107 |
| 63 | 3300005439 | Ga0070711_100494981 | Ga0070711_1004949811 | 107 |
| 64 | 3300005445 | Ga0070708_100090817 | Ga0070708_1000908173 | 107 |
| 65 | 3300005455 | Ga0070663_100116411 | Ga0070663_1001164113 | 107 |
| 66 | 3300005459 | Ga0068867_100732592 | Ga0068867_1007325921 | 107 |
| 67 | 3300005467 | Ga0070706_100033710 | Ga0070706_1000337104 | 107 |
| 68 | 3300005468 | Ga0070707_100007502 | Ga0070707_1000075027 | 107 |
| 69 | 3300005530 | Ga0070679_100121069 | Ga0070679_1001210692 | 107 |
| 70 | 3300005530 | Ga0070679_101497098 | Ga0070679_1014970981 | 107 |
| 71 | 3300005536 | Ga0070697_100001015 | Ga0070697_1000010157 | 107 |
| 72 | 3300005563 | Ga0068855_100077515 | Ga0068855_1000775154 | 107 |
| 73 | 3300005578 | Ga0068854_101216416 | Ga0068854_1012164161 | 107 |
| 74 | 3300005614 | Ga0068856_100518823 | Ga0068856_1005188231 | 107 |
| 75 | 3300006028 | Ga0070717_10121361 | Ga0070717_101213612 | 107 |
| 76 | 3300006028 | Ga0070717_10144456 | Ga0070717_101444561 | 107 |
| 77 | 3300006163 | Ga0070715_10064475 | Ga0070715_100644752 | 107 |
| 78 | 3300006173 | Ga0070716_100005730 | Ga0070716_1000057304 | 107 |
| 79 | 3300006173 | Ga0070716_100065810 | Ga0070716_1000658103 | 107 |
| 80 | 3300006175 | Ga0070712_100000456 | Ga0070712_10000045611 | 107 |
| 81 | 3300006175 | Ga0070712_100091118 | Ga0070712_1000911184 | 107 |
| 82 | 3300006237 | Ga0097621_100089381 | Ga0097621_1000893814 | 107 |
| 83 | 3300006358 | Ga0068871_100047178 | Ga0068871_1000471783 | 107 |
| 84 | 3300007076 | Ga0075435_100703875 | Ga0075435_1007038751 | 107 |
| 85 | 3300009093 | Ga0105240_10028603 | Ga0105240_100286033 | 107 |
| 86 | 3300009093 | Ga0105240_10105792 | Ga0105240_101057922 | 107 |
| 87 | 3300009093 | Ga0105240_10207961 | Ga0105240_102079612 | 107 |
| 88 | 3300009177 | Ga0105248_10000049 | Ga0105248_1000004914 | 107 |
| 89 | 3300009177 | Ga0105248_10967385 | Ga0105248_109673851 | 107 |
| 90 | 3300013104 | Ga0157370_10199256 | Ga0157370_101992562 | 107 |
| 91 | 3300013104 | Ga0157370_10560657 | Ga0157370_105606571 | 107 |
| 92 | 3300013296 | Ga0157374_11595700 | Ga0157374_115957001 | 107 |
| 93 | 3300013297 | Ga0157378_12152193 | Ga0157378_121521931 | 107 |
| 94 | 3300013306 | Ga0163162_10534613 | Ga0163162_105346132 | 107 |
| 95 | 3300014968 | Ga0157379_10079068 | Ga0157379_100790683 | 107 |
| 96 | 3300014969 | Ga0157376_10069137 | Ga0157376_100691375 | 107 |
| 97 | 3300014969 | Ga0157376_10356879 | Ga0157376_103568792 | 107 |
| 98 | 3300025261 | Ga0209233_1007429 | Ga0209233_10074292 | 107 |
| 99 | 3300025898 | Ga0207692_10232160 | Ga0207692_102321602 | 107 |
| 100 | 3300025898 | Ga0207692_10236213 | Ga0207692_102362132 | 107 |
| 101 | 3300025905 | Ga0207685_10049309 | Ga0207685_100493092 | 107 |
| 102 | 3300025906 | Ga0207699_10002436 | Ga0207699_1000243611 | 107 |
| 103 | 3300025909 | Ga0207705_10005741 | Ga0207705_100057413 | 107 |
| 104 | 3300025910 | Ga0207684_10014678 | Ga0207684_100146785 | 107 |
| 105 | 3300025911 | Ga0207654_10304708 | Ga0207654_103047081 | 107 |
| 106 | 3300025913 | Ga0207695_10084972 | Ga0207695_100849722 | 107 |
| 107 | 3300025913 | Ga0207695_10163306 | Ga0207695_101633061 | 107 |
| 108 | 3300025915 | Ga0207693_10000055 | Ga0207693_1000005554 | 107 |
| 109 | 3300025915 | Ga0207693_10105349 | Ga0207693_101053494 | 107 |
| 110 | 3300025916 | Ga0207663_10179243 | Ga0207663_101792431 | 107 |
| 111 | 3300025917 | Ga0207660_10595258 | Ga0207660_105952582 | 107 |
| 112 | 3300025921 | Ga0207652_10111125 | Ga0207652_101111252 | 107 |
| 113 | 3300025922 | Ga0207646_10000992 | Ga0207646_100009925 | 107 |
| 114 | 3300025928 | Ga0207700_10000206 | Ga0207700_1000020625 | 107 |
| 115 | 3300025929 | Ga0207664_10625940 | Ga0207664_106259402 | 107 |
| 116 | 3300025939 | Ga0207665_10005073 | Ga0207665_1000507310 | 107 |
| 117 | 3300025939 | Ga0207665_10007618 | Ga0207665_100076186 | 107 |
| 118 | 3300025941 | Ga0207711_10000033 | Ga0207711_1000003351 | 107 |
| 119 | 3300025949 | Ga0207667_10251433 | Ga0207667_102514332 | 107 |
| 120 | 3300025949 | Ga0207667_11357733 | Ga0207667_113577332 | 107 |
| 121 | 3300025981 | Ga0207640_11053929 | Ga0207640_110539291 | 107 |
| 122 | 3300026067 | Ga0207678_10016113 | Ga0207678_100161136 | 107 |
| 123 | 3300026078 | Ga0207702_10462293 | Ga0207702_104622931 | 107 |
| 124 | 3300026089 | Ga0207648_10992875 | Ga0207648_109928752 | 107 |
| 125 | 3300028666 | Ga0265336_10001220 | Ga0265336_1000122010 | 107 |
| 126 | 3300046477 | Ga0495664_0399505 | Ga0495664_0399505_362_685 | 107 |
| 127 | 3300046516 | Ga0495628_0050056 | Ga0495628_0050056_2380_2703 | 107 |
| 128 | 3300046517 | Ga0495630_0210204 | Ga0495630_0210204_815_1138 | 107 |
| 129 | 3300046543 | Ga0495645_0012551 | Ga0495645_0012551_4291_4614 | 107 |
| 130 | 3300047319 | Ga0495674_0027377 | Ga0495674_0027377_602_925 | 107 |
| 131 | 3300047472 | Ga0495686_0000006 | Ga0495686_0000006_341378_341701 | 107 |
| 132 | 3300047472 | Ga0495686_0067875 | Ga0495686_0067875_1470_1793 | 107 |
| 133 | 3300048907 | Ga0496104_0000021 | Ga0496104_0000021_113573_113896 | 107 |
| 134 | 3300048908 | Ga0496105_1177470 | Ga0496105_1177470_66_389 | 107 |
| 135 | 3300048915 | Ga0496112_0350295 | Ga0496112_0350295_1042_1365 | 107 |
| 136 | 3300048918 | Ga0496115_0870214 | Ga0496115_0870214_265_588 | 107 |
| 137 | 3300050513 | nmdc:mga0rr50_678497_c1 | nmdc:mga0rr50_678497_c1_149_472 | 107 |
| 138 | 3300053077 | Ga0495601_0028541 | Ga0495601_0028541_2215_2538 | 107 |
| 139 | 3300053078 | Ga0495612_0054537 | Ga0495612_0054537_1032_1355 | 107 |
| 140 | 3300053088 | Ga0500644_0476236 | Ga0500644_0476236_50_373 | 107 |
| 141 | 3300053119 | Ga0500595_101990 | Ga0500595_101990_261_584 | 107 |
| 142 | 3300005327 | Ga0070658_10001003 | Ga0070658_1000100318 | 108 |
| 143 | 3300005563 | Ga0068855_100974132 | Ga0068855_1009741322 | 108 |
| 144 | 3300013296 | Ga0157374_10060042 | Ga0157374_100600422 | 108 |
| 145 | 3300025909 | Ga0207705_10000883 | Ga0207705_1000088318 | 108 |
| 146 | 3300025913 | Ga0207695_10673911 | Ga0207695_106739112 | 108 |
| 147 | 3300028556 | Ga0265337_1006225 | Ga0265337_10062251 | 108 |
| 148 | 3300028573 | Ga0265334_10000234 | Ga0265334_100002349 | 108 |
| 149 | 3300028573 | Ga0265334_10151454 | Ga0265334_101514542 | 108 |
| 150 | 3300028800 | Ga0265338_10002091 | Ga0265338_1000209124 | 108 |
| 151 | 3300028800 | Ga0265338_10505527 | Ga0265338_105055272 | 108 |
| 152 | 3300005468 | Ga0070707_101927089 | Ga0070707_1019270891 | 110 |
| 153 | 3300005618 | Ga0068864_100651749 | Ga0068864_1006517492 | 110 |
| 154 | 3300048929 | Ga0496126_0948386 | Ga0496126_0948386_94_426 | 110 |
| 155 | 3300005293 | Ga0065715_10497164 | Ga0065715_104971641 | 111 |
| 156 | 3300005436 | Ga0070713_100115947 | Ga0070713_1001159472 | 111 |
| 157 | 3300005518 | Ga0070699_100526040 | Ga0070699_1005260401 | 111 |
| 158 | 3300005841 | Ga0068863_100484841 | Ga0068863_1004848412 | 111 |
| 159 | 3300006175 | Ga0070712_100100306 | Ga0070712_1001003063 | 111 |
| 160 | 3300006881 | Ga0068865_100570013 | Ga0068865_1005700131 | 111 |
| 161 | 3300007265 | Ga0099794_10062814 | Ga0099794_100628142 | 111 |
| 162 | 3300009174 | Ga0105241_10497999 | Ga0105241_104979992 | 111 |
| 163 | 3300009545 | Ga0105237_10376567 | Ga0105237_103765673 | 111 |
| 164 | 3300013297 | Ga0157378_10741381 | Ga0157378_107413812 | 111 |
| 165 | 3300025914 | Ga0207671_10513381 | Ga0207671_105133812 | 111 |
| 166 | 3300026088 | Ga0207641_10539904 | Ga0207641_105399042 | 111 |
| 167 | 3300033180 | Ga0307510_10138946 | Ga0307510_101389462 | 111 |
| 168 | 3300035117 | Ga0373953_0397227 | Ga0373953_0397227_245_583 | 111 |
| 169 | 3300035172 | Ga0373955_0116439 | Ga0373955_0116439_684_1022 | 111 |
| 170 | 3300035692 | Ga0373935_0572030 | Ga0373935_0572030_440_778 | 111 |
| 171 | 3300036401 | Ga0373937_1089034 | Ga0373937_1089034_250_588 | 111 |
| 172 | 3300039438 | Ga0436360_0683347 | Ga0436360_0683347_42_380 | 111 |
| 173 | 3300044673 | Ga0453683_0220173 | Ga0453683_0220173_742_1077 | 111 |
| 174 | 3300044842 | Ga0466957_0006633 | Ga0466957_0006633_1665_2000 | 111 |
| 175 | 3300045051 | Ga0451576_0964573 | Ga0451576_0964573_75_410 | 111 |
| 176 | 3300001915 | JGI24741J21665_1003340 | JGI24741J21665_10033402 | 114 |
| 177 | 3300001979 | JGI24740J21852_10017466 | JGI24740J21852_100174665 | 114 |
| 178 | 3300002075 | JGI24738J21930_10003292 | JGI24738J21930_100032922 | 114 |
| 179 | 3300002741 | JGI25157J39369_1035886 | JGI25157J39369_10358861 | 114 |
| 180 | 3300003214 | JGI25165J46597_1000188 | JGI25165J46597_100018871 | 114 |
| 181 | 3300005327 | Ga0070658_10558666 | Ga0070658_105586662 | 114 |
| 182 | 3300005328 | Ga0070676_10171121 | Ga0070676_101711212 | 114 |
| 183 | 3300005455 | Ga0070663_100036894 | Ga0070663_1000368944 | 114 |
| 184 | 3300005539 | Ga0068853_100005297 | Ga0068853_1000052976 | 114 |
| 185 | 3300005578 | Ga0068854_100000027 | Ga0068854_10000002733 | 114 |
| 186 | 3300005614 | Ga0068856_100002333 | Ga0068856_1000023335 | 114 |
| 187 | 3300005616 | Ga0068852_100506997 | Ga0068852_1005069972 | 114 |
| 188 | 3300005834 | Ga0068851_10058058 | Ga0068851_100580582 | 114 |
| 189 | 3300006237 | Ga0097621_100003095 | Ga0097621_1000030956 | 114 |
| 190 | 3300006358 | Ga0068871_100004613 | Ga0068871_1000046132 | 114 |
| 191 | 3300009174 | Ga0105241_10059533 | Ga0105241_100595332 | 114 |
| 192 | 3300009551 | Ga0105238_10141035 | Ga0105238_101410353 | 114 |
| 193 | 3300010375 | Ga0105239_10006050 | Ga0105239_100060505 | 114 |
| 194 | 3300013100 | Ga0157373_10093177 | Ga0157373_100931772 | 114 |
| 195 | 3300013102 | Ga0157371_11007468 | Ga0157371_110074681 | 114 |
| 196 | 3300013105 | Ga0157369_10085566 | Ga0157369_100855665 | 114 |
| 197 | 3300013296 | Ga0157374_10349458 | Ga0157374_103494582 | 114 |
| 198 | 3300025231 | Ga0207427_100914 | Ga0207427_1009143 | 114 |
| 199 | 3300025250 | Ga0209026_1001702 | Ga0209026_10017028 | 114 |
| 200 | 3300025261 | Ga0209233_1000120 | Ga0209233_1000120212 | 114 |
| 201 | 3300025321 | Ga0207656_10071683 | Ga0207656_100716832 | 114 |
| 202 | 3300025909 | Ga0207705_10371793 | Ga0207705_103717932 | 114 |
| 203 | 3300025911 | Ga0207654_10034449 | Ga0207654_100344494 | 114 |
| 204 | 3300025981 | Ga0207640_10000145 | Ga0207640_100001459 | 114 |
| 205 | 3300026041 | Ga0207639_10005234 | Ga0207639_100052346 | 114 |
| 206 | 3300026067 | Ga0207678_10056269 | Ga0207678_100562692 | 114 |
| 207 | 3300026078 | Ga0207702_10003111 | Ga0207702_100031113 | 114 |
| 208 | 3300026142 | Ga0207698_10808875 | Ga0207698_108088752 | 114 |
| 209 | 3300037312 | Ga0395899_0000797 | Ga0395899_0000797_17581_17937 | 114 |
| 210 | 3300037418 | Ga0395900_0060992 | Ga0395900_0060992_3303_3659 | 114 |
| 211 | 3300037418 | Ga0395900_0085967 | Ga0395900_0085967_2644_3000 | 114 |
| 212 | 3300037471 | Ga0395905_0170339 | Ga0395905_0170339_568_924 | 114 |
| 213 | 3300037471 | Ga0395905_1091894 | Ga0395905_1091894_235_591 | 114 |
| 214 | 3300038443 | Ga0395901_1098763 | Ga0395901_1098763_119_475 | 114 |
| 215 | 3300048905 | Ga0496102_0455490 | Ga0496102_0455490_301_657 | 114 |
| 216 | 3300000546 | LJNas_1019438 | LJNas_10194381 | 115 |
| 217 | 3300005548 | Ga0070665_102081843 | Ga0070665_1020818431 | 115 |
| 218 | 3300005618 | Ga0068864_100140621 | Ga0068864_1001406212 | 115 |
| 219 | 3300005841 | Ga0068863_100553640 | Ga0068863_1005536402 | 115 |
| 220 | 3300014325 | Ga0163163_10979976 | Ga0163163_109799761 | 115 |
| 221 | 3300014968 | Ga0157379_11113566 | Ga0157379_111135661 | 115 |
| 222 | 3300026088 | Ga0207641_10322294 | Ga0207641_103222943 | 115 |
| 223 | 3300048903 | Ga0496100_0054594 | Ga0496100_0054594_687_1040 | 115 |
| 224 | 3300048904 | Ga0496101_0001362 | Ga0496101_0001362_9745_10098 | 115 |
| 225 | 3300048907 | Ga0496104_0051779 | Ga0496104_0051779_1720_2073 | 115 |
| 226 | 3300048908 | Ga0496105_0171488 | Ga0496105_0171488_146_499 | 115 |
| 227 | 3300048909 | Ga0496106_0301704 | Ga0496106_0301704_118_471 | 115 |
| 228 | 3300048910 | Ga0496107_0037168 | Ga0496107_0037168_828_1181 | 115 |
| 229 | 3300048917 | Ga0496114_0000743 | Ga0496114_0000743_10860_11213 | 115 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7svx-assembly1.cif.gz_B | structure of emre-d3 mutant in complex with monobody l10 and harmane | 0.735 | 10 | 110 |
| 7svx-assembly1.cif.gz_B | structure of emre-d3 mutant in complex with monobody l10 and harmane | 0.7109 | 10 | 110 |
| 7ssu-assembly1.cif.gz_B | structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium | 0.6527 | 10 | 110 |
| 7ssu-assembly1.cif.gz_B | structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium | 0.6332 | 10 | 110 |
| 7szt-assembly1.cif.gz_A | crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) | 0.6138 | 12 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFN9_2_109_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.8655 | 8 | 115 | 1.20.1280.290 |
| af_Q2FVS6_1_108_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.8611 | 8 | 112 | 1.20.1280.290 |
| af_P76169_1_108_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.8594 | 8 | 110 | 1.20.1280.290 |
| af_P9WFN9_2_109_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.844 | 8 | 115 | 1.20.1280.290 |
| af_P69210_8_109_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8379 | 11 | 110 | 1.10.3730.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-E8V4R5-F1-model_v4 | Small multidrug resistance protein | 0.9873 | 12 | 114 |
GO:0016020
|
| AF-A0A1M7U925-F1-model_v4 | Small multidrug resistance family-3 protein | 0.9845 | 7 | 114 |
GO:0016020
|
| AF-A0A1M7U925-F1-model_v4 | Small multidrug resistance family-3 protein | 0.9668 | 7 | 114 |
GO:0016020
|
| AF-A0A257NZU6-F1-model_v4 | EamA domain-containing protein | 0.9635 | 12 | 115 |
GO:0016020
|
| AF-A0A2V9UW04-F1-model_v4 | EamA domain-containing protein | 0.9549 | 14 | 113 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar