F341813

General Info

Members Datasets Scaffolds Average Seq Length
229 167 458 125

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100016279|Ga0070697_1000162793
Length 143
Sequence MDAACEMAHRFVMQGHQVTSVMERPLLSVVDDDESVRESLPDLLREFGFAARAFSSAQEFLASDYLDETRCLILDVAMPGMSGLDLQQELKRHGKQIPIIFITGQKEEDIRKRAFREGAVKFLYKPFSDSALLDAVSAALTAK

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
105 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
147 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
148 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
149 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
150 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
151 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
160 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
165 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
166 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
167 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 1.31
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 1.31
Rhizoplane 6.55
Rhizosphere 88.65
Stem 0
Stem Tuber 0
Unclassified 11.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100016279 3300005536 Bacteria 5847
2 CNBas_1000136 3300000531 Bacteria 2456
3 rootH2_10134598 3300003320 Bacteria 3382
4 Ga0065715_10406016 3300005293 Bacteria 873
5 Ga0070690_100077940 3300005330 Bacteria 2164
6 Ga0070666_10022629 3300005335 Bacteria 4083
7 Ga0068868_100214666 3300005338 Bacteria 1609
8 Ga0070689_100039916 3300005340 Bacteria 3596
9 Ga0070687_100017032 3300005343 Bacteria 3332
10 Ga0070661_100216673 3300005344 Bacteria 1467
11 Ga0070669_100242245 3300005353 Bacteria 1433
12 Ga0070671_100636381 3300005355 Bacteria 923
13 Ga0070674_100047650 3300005356 Bacteria 2938
14 Ga0070673_100336024 3300005364 Bacteria 1337
15 Ga0070688_100060933 3300005365 Bacteria 2384
16 Ga0070667_100034125 3300005367 Bacteria 4255
17 Ga0070705_100232646 3300005440 Bacteria 1283
18 Ga0070694_100166445 3300005444 Bacteria 1621
19 Ga0070694_101536007 3300005444 Unclassified 564
20 Ga0070708_100364048 3300005445 Bacteria 1363
21 Ga0070708_101105956 3300005445 Unclassified 742
22 Ga0068867_100719518 3300005459 Bacteria 883
23 Ga0070685_10005388 3300005466 Bacteria 6480
24 Ga0070685_10075651 3300005466 Bacteria 2006
25 Ga0070699_100154587 3300005518 Bacteria 2030
26 Ga0068853_100531024 3300005539 Bacteria 1113
27 Ga0070686_100038697 3300005544 Bacteria 2966
28 Ga0070695_101111858 3300005545 Bacteria 647
29 Ga0070696_100064380 3300005546 Bacteria 2569
30 Ga0070696_100368894 3300005546 Unclassified 1116
31 Ga0070665_100002277 3300005548 Bacteria 21338
32 Ga0070665_100184125 3300005548 Bacteria 2089
33 Ga0070665_101309885 3300005548 Unclassified 734
34 Ga0070704_100187783 3300005549 Bacteria 1659
35 Ga0068855_100000006 3300005563 Bacteria 298092
36 Ga0068855_100331774 3300005563 Bacteria 1679
37 Ga0070664_100000914 3300005564 Bacteria 23012
38 Ga0068854_100329063 3300005578 Bacteria 1244
39 Ga0068856_100628760 3300005614 Bacteria 1094
40 Ga0068852_100009505 3300005616 Bacteria 7225
41 Ga0068864_100058781 3300005618 Bacteria 3324
42 Ga0068866_10075120 3300005718 Bacteria 1799
43 Ga0068861_101681341 3300005719 Bacteria 627
44 Ga0068870_11190396 3300005840 Bacteria 551
45 Ga0068863_100035499 3300005841 Bacteria 4749
46 Ga0068863_100195578 3300005841 Bacteria 1944
47 Ga0068858_100184091 3300005842 Bacteria 1973
48 Ga0068858_100331153 3300005842 Bacteria 1456
49 Ga0068860_100443558 3300005843 Bacteria 1290
50 Ga0068862_100390710 3300005844 Bacteria 1299
51 Ga0070716_100105178 3300006173 Bacteria 1739
52 Ga0068871_102147008 3300006358 Unclassified 532
53 Ga0075428_100159469 3300006844 Bacteria 2449
54 Ga0068865_100365435 3300006881 Bacteria 1173
55 Ga0099795_10154331 3300007788 Bacteria 943
56 Ga0105240_10000080 3300009093 Bacteria 195633
57 Ga0105240_10017353 3300009093 Bacteria 9704
58 Ga0105240_10032836 3300009093 Bacteria 6714
59 Ga0105240_11026133 3300009093 Unclassified 881
60 Ga0111539_12509368 3300009094 Unclassified 598
61 Ga0105245_10234294 3300009098 Bacteria 1777
62 Ga0105247_11218131 3300009101 Bacteria 600
63 Ga0114129_10112571 3300009147 Bacteria 3753
64 Ga0105243_11192702 3300009148 Bacteria 774
65 Ga0105242_10140729 3300009176 Bacteria 2093
66 Ga0105242_11493214 3300009176 Bacteria 706
67 Ga0105248_10032293 3300009177 Bacteria 5852
68 Ga0105248_10060068 3300009177 Bacteria 4268
69 Ga0105248_10143621 3300009177 Bacteria 2693
70 Ga0105248_13121522 3300009177 Bacteria 527
71 Ga0105237_10014777 3300009545 Bacteria 8148
72 Ga0105237_10051724 3300009545 Bacteria 4126
73 Ga0105237_10091617 3300009545 Bacteria 3029
74 Ga0105237_10204294 3300009545 Unclassified 1976
75 Ga0105238_10004695 3300009551 Bacteria 13513
76 Ga0105238_10004932 3300009551 Bacteria 13207
77 Ga0105238_10110888 3300009551 Bacteria 2724
78 Ga0105238_10467272 3300009551 Bacteria 1260
79 Ga0105249_11125974 3300009553 Bacteria 855
80 Ga0099796_10072044 3300010159 Bacteria 1249
81 Ga0105239_10014353 3300010375 Bacteria 8789
82 Ga0105239_10226867 3300010375 Bacteria 2095
83 Ga0105239_11032675 3300010375 Bacteria 945
84 Ga0157373_10234629 3300013100 Unclassified 1296
85 Ga0157374_10060930 3300013296 Bacteria 3533
86 Ga0157374_10157370 3300013296 Bacteria 2212
87 Ga0157374_10938949 3300013296 Bacteria 883
88 Ga0157374_11129512 3300013296 Unclassified 804
89 Ga0157378_10007461 3300013297 Bacteria 9555
90 Ga0157378_10058801 3300013297 Bacteria 3429
91 Ga0163162_10018714 3300013306 Bacteria 6788
92 Ga0163162_10144066 3300013306 Bacteria 2497
93 Ga0163162_10389427 3300013306 Bacteria 1527
94 Ga0163162_12640153 3300013306 Bacteria 578
95 Ga0157372_10021113 3300013307 Bacteria 7033
96 Ga0157372_10037932 3300013307 Bacteria 5317
97 Ga0157375_10233109 3300013308 Bacteria 2000
98 Ga0157375_13199971 3300013308 Bacteria 546
99 Ga0163163_10334664 3300014325 Unclassified 1569
100 Ga0163163_11624787 3300014325 Bacteria 707
101 Ga0163163_11707692 3300014325 Unclassified 690
102 Ga0157380_10603069 3300014326 Bacteria 1087
103 Ga0157380_11477655 3300014326 Unclassified 732
104 Ga0157379_10291058 3300014968 Bacteria 1487
105 Ga0157376_10026915 3300014969 Bacteria 4551
106 Ga0157376_10071160 3300014969 Bacteria 2955
107 Ga0157376_11631324 3300014969 Unclassified 679
108 Ga0207697_10001608 3300025315 Bacteria 12201
109 Ga0207680_10013257 3300025903 Bacteria 4229
110 Ga0207645_10500846 3300025907 Unclassified 822
111 Ga0207684_11641695 3300025910 Bacteria 519
112 Ga0207695_10000004 3300025913 Bacteria 1288665
113 Ga0207695_10003769 3300025913 Bacteria 21043
114 Ga0207671_10058638 3300025914 Bacteria 2854
115 Ga0207671_10071474 3300025914 Unclassified 2588
116 Ga0207671_10537268 3300025914 Bacteria 932
117 Ga0207649_10007172 3300025920 Bacteria 6058
118 Ga0207681_10288681 3300025923 Bacteria 1294
119 Ga0207694_10000014 3300025924 Bacteria 374435
120 Ga0207694_10695554 3300025924 Bacteria 857
121 Ga0207659_10201655 3300025926 Bacteria 1589
122 Ga0207687_10993234 3300025927 Bacteria 720
123 Ga0207690_10050039 3300025932 Bacteria 2788
124 Ga0207690_10301103 3300025932 Bacteria 1255
125 Ga0207706_11008480 3300025933 Unclassified 699
126 Ga0207709_11532317 3300025935 Bacteria 553
127 Ga0207669_10174235 3300025937 Bacteria 1535
128 Ga0207704_11732673 3300025938 Bacteria 537
129 Ga0207691_11154664 3300025940 Bacteria 643
130 Ga0207711_10080739 3300025941 Bacteria 2841
131 Ga0207711_10211352 3300025941 Bacteria 1772
132 Ga0207689_10021295 3300025942 Bacteria 5451
133 Ga0207679_10046368 3300025945 Bacteria 3150
134 Ga0207667_10000202 3300025949 Bacteria 86408
135 Ga0207667_10475387 3300025949 Bacteria 1269
136 Ga0207651_11129873 3300025960 Bacteria 702
137 Ga0207712_10925255 3300025961 Bacteria 771
138 Ga0207640_10274916 3300025981 Bacteria 1320
139 Ga0207640_10699153 3300025981 Bacteria 869
140 Ga0207658_10069131 3300025986 Bacteria 2667
141 Ga0207677_10042973 3300026023 Bacteria 3001
142 Ga0207703_10351270 3300026035 Bacteria 1357
143 Ga0207703_11172393 3300026035 Bacteria 738
144 Ga0207702_10121866 3300026078 Bacteria 2335
145 Ga0207702_10721564 3300026078 Bacteria 983
146 Ga0207641_10097545 3300026088 Bacteria 2583
147 Ga0207641_10333694 3300026088 Bacteria 1441
148 Ga0207676_10026154 3300026095 Bacteria 4338
149 Ga0207675_100754778 3300026118 Bacteria 984
150 Ga0207675_101685386 3300026118 Bacteria 654
151 Ga0207698_10002106 3300026142 Bacteria 11733
152 Ga0268266_10002203 3300028379 Bacteria 21319
153 Ga0268266_10231712 3300028379 Bacteria 1701
154 Ga0268266_10251944 3300028379 Unclassified 1633
155 Ga0268264_10089885 3300028381 Bacteria 2645
156 Ga0265337_1002846 3300028556 Bacteria 7725
157 Ga0265334_10044205 3300028573 Bacteria 1731
158 Ga0265338_10366983 3300028800 Unclassified 1032
159 Ga0265762_1048103 3300030760 Bacteria 850
160 Ga0265332_10019790 3300031238 Bacteria 2971
161 Ga0265320_10003808 3300031240 Bacteria 10012
162 Ga0265339_10182782 3300031249 Bacteria 1043
163 Ga0265316_10071850 3300031344 Bacteria 2667
164 Ga0265316_10249695 3300031344 Bacteria 1303
165 Ga0265314_10019126 3300031711 Bacteria 5314
166 Ga0307410_10176470 3300031852 Bacteria 1614
167 Ga0307409_101574746 3300031995 Bacteria 685
168 Ga0307416_100633497 3300032002 Bacteria 1152
169 Ga0395900_0024150 3300037418 Bacteria 6223
170 Ga0395900_0692165 3300037418 Bacteria 953
171 Ga0395898_0071285 3300037466 Bacteria 3358
172 Ga0395905_0044700 3300037471 Bacteria 4156
173 Ga0395905_0049401 3300037471 Bacteria 3942
174 Ga0436364_1345244 3300037853 Bacteria 104196
175 Ga0436364_1473028 3300037853 Bacteria 4708
176 Ga0395901_0160695 3300038443 Bacteria 2360
177 Ga0395901_0192007 3300038443 Bacteria 2141
178 Ga0242420_017048 3300038996 Bacteria 1269
179 Ga0436365_0656949 3300039437 Bacteria 1410
180 Ga0436361_1089038 3300039447 Unclassified 546
181 Ga0436363_0388092 3300039450 Bacteria 1032
182 Ga0436363_0548996 3300039450 Unclassified 1388
183 Ga0495628_0296747 3300046516 Unclassified 1197
184 Ga0495640_0525546 3300046533 Unclassified 719
185 Ga0495625_0004348 3300046660 Bacteria 13457
186 Ga0495581_0603059 3300047315 Bacteria 636
187 Ga0496101_0630837 3300048904 Bacteria 847
188 Ga0496102_0026313 3300048905 Bacteria 5187
189 Ga0496104_1168809 3300048907 Unclassified 673
190 Ga0496104_1437943 3300048907 Bacteria 592
191 Ga0496106_0137416 3300048909 Bacteria 1921
192 Ga0496107_0149897 3300048910 Bacteria 1725
193 Ga0496108_0542025 3300048911 Bacteria 1015
194 Ga0496109_0139957 3300048912 Bacteria 2263
195 Ga0496109_1532585 3300048912 Bacteria 601
196 Ga0496110_0073756 3300048913 Bacteria 3029
197 Ga0496112_0046479 3300048915 Bacteria 4258
198 Ga0496112_0100069 3300048915 Bacteria 2869
199 Ga0496113_0149921 3300048916 Bacteria 1839
200 Ga0496113_0368498 3300048916 Bacteria 1153
201 Ga0496115_0081745 3300048918 Bacteria 2631
202 Ga0501298_008852 3300049521 Bacteria 1700
203 Ga0501038_0647525 3300049574 Bacteria 796
204 Ga0501041_0330557 3300049577 Bacteria 962
205 Ga0501048_0191919 3300049582 Bacteria 1448
206 Ga0501076_0288982 3300049592 Bacteria 1343
207 Ga0501077_0047996 3300049593 Bacteria 2713
208 Ga0501233_049537 3300049668 Bacteria 1014
209 Ga0501247_009480 3300049677 Bacteria 1149
210 Ga0501250_019555 3300049680 Bacteria 866
211 Ga0501253_019412 3300049683 Bacteria 1173
212 Ga0501259_047900 3300049688 Bacteria 860
213 Ga0501234_014713 3300049707 Bacteria 1229
214 Ga0501083_1033832 3300049744 Unclassified 535
215 Ga0501045_0435050 3300049824 Bacteria 976
216 nmdc:mga05p37_452428_c1 3300050507 Bacteria 1486
217 nmdc:mga06r32_2055772_c1 3300050510 Bacteria 504
218 nmdc:mga08y16_1724787_c1 3300050511 Unclassified 581
219 nmdc:mga0rr50_719118_c1 3300050513 Bacteria 852
220 nmdc:mga0a205_386766_c1 3300050515 Bacteria 1264
221 Ga0500566_0470842 3300053094 Unclassified 546
222 Ga0500595_000377 3300053119 Bacteria 28751
223 Ga0501084_0528334 3300054114 Bacteria 997
224 Ga0587101_114097 3300059623 Bacteria 552
225 Ga0587071_080302 3300060344 Bacteria 725
226 Ga0530510_0379705 3300061734 Bacteria 1063
227 2513660892 2513237096 Bacteria 8722461
228 2513919571 2513237145 Bacteria 8979722
229 3004273312 3004268573 Bacteria 7043476
230 Ga0070697_100016279
231 CNBas_1000136
232 rootH2_10134598
233 Ga0065715_10406016
234 Ga0070690_100077940
235 Ga0070666_10022629
236 Ga0068868_100214666
237 Ga0070689_100039916
238 Ga0070687_100017032
239 Ga0070661_100216673
240 Ga0070669_100242245
241 Ga0070671_100636381
242 Ga0070674_100047650
243 Ga0070673_100336024
244 Ga0070688_100060933
245 Ga0070667_100034125
246 Ga0070705_100232646
247 Ga0070694_100166445
248 Ga0070694_101536007
249 Ga0070708_100364048
250 Ga0070708_101105956
251 Ga0068867_100719518
252 Ga0070685_10005388
253 Ga0070685_10075651
254 Ga0070699_100154587
255 Ga0068853_100531024
256 Ga0070686_100038697
257 Ga0070695_101111858
258 Ga0070696_100064380
259 Ga0070696_100368894
260 Ga0070665_100002277
261 Ga0070665_100184125
262 Ga0070665_101309885
263 Ga0070704_100187783
264 Ga0068855_100000006
265 Ga0068855_100331774
266 Ga0070664_100000914
267 Ga0068854_100329063
268 Ga0068856_100628760
269 Ga0068852_100009505
270 Ga0068864_100058781
271 Ga0068866_10075120
272 Ga0068861_101681341
273 Ga0068870_11190396
274 Ga0068863_100035499
275 Ga0068863_100195578
276 Ga0068858_100184091
277 Ga0068858_100331153
278 Ga0068860_100443558
279 Ga0068862_100390710
280 Ga0070716_100105178
281 Ga0068871_102147008
282 Ga0075428_100159469
283 Ga0068865_100365435
284 Ga0099795_10154331
285 Ga0105240_10000080
286 Ga0105240_10017353
287 Ga0105240_10032836
288 Ga0105240_11026133
289 Ga0111539_12509368
290 Ga0105245_10234294
291 Ga0105247_11218131
292 Ga0114129_10112571
293 Ga0105243_11192702
294 Ga0105242_10140729
295 Ga0105242_11493214
296 Ga0105248_10032293
297 Ga0105248_10060068
298 Ga0105248_10143621
299 Ga0105248_13121522
300 Ga0105237_10014777
301 Ga0105237_10051724
302 Ga0105237_10091617
303 Ga0105237_10204294
304 Ga0105238_10004695
305 Ga0105238_10004932
306 Ga0105238_10110888
307 Ga0105238_10467272
308 Ga0105249_11125974
309 Ga0099796_10072044
310 Ga0105239_10014353
311 Ga0105239_10226867
312 Ga0105239_11032675
313 Ga0157373_10234629
314 Ga0157374_10060930
315 Ga0157374_10157370
316 Ga0157374_10938949
317 Ga0157374_11129512
318 Ga0157378_10007461
319 Ga0157378_10058801
320 Ga0163162_10018714
321 Ga0163162_10144066
322 Ga0163162_10389427
323 Ga0163162_12640153
324 Ga0157372_10021113
325 Ga0157372_10037932
326 Ga0157375_10233109
327 Ga0157375_13199971
328 Ga0163163_10334664
329 Ga0163163_11624787
330 Ga0163163_11707692
331 Ga0157380_10603069
332 Ga0157380_11477655
333 Ga0157379_10291058
334 Ga0157376_10026915
335 Ga0157376_10071160
336 Ga0157376_11631324
337 Ga0207697_10001608
338 Ga0207680_10013257
339 Ga0207645_10500846
340 Ga0207684_11641695
341 Ga0207695_10000004
342 Ga0207695_10003769
343 Ga0207671_10058638
344 Ga0207671_10071474
345 Ga0207671_10537268
346 Ga0207649_10007172
347 Ga0207681_10288681
348 Ga0207694_10000014
349 Ga0207694_10695554
350 Ga0207659_10201655
351 Ga0207687_10993234
352 Ga0207690_10050039
353 Ga0207690_10301103
354 Ga0207706_11008480
355 Ga0207709_11532317
356 Ga0207669_10174235
357 Ga0207704_11732673
358 Ga0207691_11154664
359 Ga0207711_10080739
360 Ga0207711_10211352
361 Ga0207689_10021295
362 Ga0207679_10046368
363 Ga0207667_10000202
364 Ga0207667_10475387
365 Ga0207651_11129873
366 Ga0207712_10925255
367 Ga0207640_10274916
368 Ga0207640_10699153
369 Ga0207658_10069131
370 Ga0207677_10042973
371 Ga0207703_10351270
372 Ga0207703_11172393
373 Ga0207702_10121866
374 Ga0207702_10721564
375 Ga0207641_10097545
376 Ga0207641_10333694
377 Ga0207676_10026154
378 Ga0207675_100754778
379 Ga0207675_101685386
380 Ga0207698_10002106
381 Ga0268266_10002203
382 Ga0268266_10231712
383 Ga0268266_10251944
384 Ga0268264_10089885
385 Ga0265337_1002846
386 Ga0265334_10044205
387 Ga0265338_10366983
388 Ga0265762_1048103
389 Ga0265332_10019790
390 Ga0265320_10003808
391 Ga0265339_10182782
392 Ga0265316_10071850
393 Ga0265316_10249695
394 Ga0265314_10019126
395 Ga0307410_10176470
396 Ga0307409_101574746
397 Ga0307416_100633497
398 Ga0395900_0024150
399 Ga0395900_0692165
400 Ga0395898_0071285
401 Ga0395905_0044700
402 Ga0395905_0049401
403 Ga0436364_1345244
404 Ga0436364_1473028
405 Ga0395901_0160695
406 Ga0395901_0192007
407 Ga0242420_017048
408 Ga0436365_0656949
409 Ga0436361_1089038
410 Ga0436363_0388092
411 Ga0436363_0548996
412 Ga0495628_0296747
413 Ga0495640_0525546
414 Ga0495625_0004348
415 Ga0495581_0603059
416 Ga0496101_0630837
417 Ga0496102_0026313
418 Ga0496104_1168809
419 Ga0496104_1437943
420 Ga0496106_0137416
421 Ga0496107_0149897
422 Ga0496108_0542025
423 Ga0496109_0139957
424 Ga0496109_1532585
425 Ga0496110_0073756
426 Ga0496112_0046479
427 Ga0496112_0100069
428 Ga0496113_0149921
429 Ga0496113_0368498
430 Ga0496115_0081745
431 Ga0501298_008852
432 Ga0501038_0647525
433 Ga0501041_0330557
434 Ga0501048_0191919
435 Ga0501076_0288982
436 Ga0501077_0047996
437 Ga0501233_049537
438 Ga0501247_009480
439 Ga0501250_019555
440 Ga0501253_019412
441 Ga0501259_047900
442 Ga0501234_014713
443 Ga0501083_1033832
444 Ga0501045_0435050
445 nmdc:mga05p37_452428_c1
446 nmdc:mga06r32_2055772_c1
447 nmdc:mga08y16_1724787_c1
448 nmdc:mga0rr50_719118_c1
449 nmdc:mga0a205_386766_c1
450 Ga0500566_0470842
451 Ga0500595_000377
452 Ga0501084_0528334
453 Ga0587101_114097
454 Ga0587071_080302
455 Ga0530510_0379705
456 2513660892
457 2513919571
458 3004273312

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

27

137

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s04-assembly2.cif.gz_F crystal structure of klebsiella pneumoniae pmra in complex with pmra box dna 0.9189 6 121
2pl1-assembly1.cif.gz_A berrylium fluoride activated receiver domain of e.coli phop 0.9163 6 121
3w9s-assembly1.cif.gz_B crystal structure analysis of the n-terminal receiver domain of response regulator pmra 0.9159 7 122
1zn2-assembly1.cif.gz_A low resolution structure of response regulator styr 0.9158 4 121
1dck-assembly1.cif.gz_A structure of unphosphorylated fixj-n complexed with mn2+ 0.9148 3 121
ID Description Score Start End Superfamily
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9435 3 81 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9339 5 84 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9262 6 84 3.40.50.2300
af_P0AFU4_2_125_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9261 1 121 3.40.50.2300
af_P71814_19_100_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9259 6 84 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1H8TJS6-F1-model_v4 Transcriptional regulatory protein TdiR 0.9882 2 119 GO:0000160
AF-A0A7R7Y367-F1-model_v4 deleted 0.9876 1 121
AF-A0A3S3Y6B5-F1-model_v4 deleted 0.9875 1 119
AF-A0A7W5MDP2-F1-model_v4 deleted 0.9868 1 122
AF-A0A537VFP9-F1-model_v4 Response regulator 0.9861 3 121 GO:0000160

Map