F341768

General Info

Members Datasets Scaffolds Average Seq Length
229 135 458 154

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100167152|Ga0070694_1001671522
Length 173
Sequence MRASLMLSPTQPPYEVIMKIAVGFDHAGFPLKQIVLEAIRDAGHEPIDLGTNSTEPVDFPDYSEKVGRAVQSGEAERGILVCGSGVGACIAANKMKGIYASICHDTYSAAQGVRHDDMNVLCLGARVIGPELAIALVKAFLEARYIGNDTGGERLARRVAKIHEIEDTGKLEI

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.18
Rhizosphere 97.82
Stem 0
Stem Tuber 0
Unclassified 29.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100167152 3300005444 Unclassified 1618
2 SwRhRL3b_contig_951261 2162886006 Unclassified 1811
3 SwRhRL2b_contig_1565409 2162886007 Unclassified 3803
4 SwRhRL2b_contig_294902 2162886007 Bacteria 8083
5 Ga0065704_10000384 3300005289 Bacteria 38753
6 Ga0065704_10096336 3300005289 Unclassified 2446
7 Ga0065704_10370834 3300005289 Unclassified 785
8 Ga0065704_10389106 3300005289 Unclassified 764
9 Ga0065715_10123128 3300005293 Bacteria 2186
10 Ga0065707_10000885 3300005295 Bacteria 19270
11 Ga0065707_10086361 3300005295 Bacteria 5496
12 Ga0065707_10128341 3300005295 Unclassified 1962
13 Ga0065707_10335597 3300005295 Unclassified 942
14 Ga0068869_100180414 3300005334 Unclassified 1655
15 Ga0070680_100677108 3300005336 Unclassified 887
16 Ga0070660_101741830 3300005339 Bacteria 531
17 Ga0070689_100126886 3300005340 Bacteria 2043
18 Ga0070692_10990034 3300005345 Unclassified 587
19 Ga0070669_101120348 3300005353 Bacteria 678
20 Ga0070705_100115895 3300005440 Bacteria 1721
21 Ga0070705_100389711 3300005440 Unclassified 1028
22 Ga0070705_100500437 3300005440 Bacteria 922
23 Ga0070705_101891044 3300005440 Unclassified 508
24 Ga0070700_100003069 3300005441 Bacteria 8561
25 Ga0070694_101336208 3300005444 Unclassified 604
26 Ga0070681_10113567 3300005458 Bacteria 2648
27 Ga0070681_10387351 3300005458 Bacteria 1309
28 Ga0070706_100086782 3300005467 Unclassified 2900
29 Ga0070706_100466310 3300005467 Unclassified 1175
30 Ga0070707_100102196 3300005468 Unclassified 2777
31 Ga0070707_101533842 3300005468 Unclassified 633
32 Ga0070698_100001617 3300005471 Bacteria 25083
33 Ga0070698_100183326 3300005471 Bacteria 2031
34 Ga0070698_100847051 3300005471 Bacteria 859
35 Ga0070698_100909837 3300005471 Unclassified 825
36 Ga0070699_100115207 3300005518 Bacteria 2362
37 Ga0070699_100126281 3300005518 Unclassified 2252
38 Ga0070684_101463928 3300005535 Unclassified 643
39 Ga0070696_100812959 3300005546 Unclassified 770
40 Ga0070704_100647456 3300005549 Unclassified 933
41 Ga0070704_101291992 3300005549 Unclassified 667
42 Ga0068855_100039634 3300005563 Bacteria 5592
43 Ga0068857_100200872 3300005577 Unclassified 1817
44 Ga0068857_100211670 3300005577 Unclassified 1769
45 Ga0068854_100106538 3300005578 Bacteria 2109
46 Ga0068859_100079535 3300005617 Bacteria 3318
47 Ga0068864_100090232 3300005618 Bacteria 2702
48 Ga0068870_10145826 3300005840 Unclassified 1389
49 Ga0068870_11026979 3300005840 Unclassified 589
50 Ga0068858_100237961 3300005842 Unclassified 1727
51 Ga0068862_100011507 3300005844 Bacteria 7304
52 Ga0068862_100050589 3300005844 Bacteria 3552
53 Ga0081539_10006781 3300005985 Bacteria 10747
54 Ga0081539_10048216 3300005985 Bacteria 2425
55 Ga0075428_100212831 3300006844 Bacteria 2089
56 Ga0075428_100765352 3300006844 Bacteria 1027
57 Ga0075430_100094817 3300006846 Bacteria 2494
58 Ga0075430_100937038 3300006846 Unclassified 713
59 Ga0075431_100025419 3300006847 Bacteria 6069
60 Ga0075431_100601321 3300006847 Bacteria 1084
61 Ga0075431_101171869 3300006847 Bacteria 732
62 Ga0075433_10027755 3300006852 Bacteria 4805
63 Ga0075433_10448021 3300006852 Bacteria 1138
64 Ga0075434_100207653 3300006871 Bacteria 1979
65 Ga0075434_100372878 3300006871 Unclassified 1448
66 Ga0075429_100004587 3300006880 Bacteria 11875
67 Ga0075429_100240612 3300006880 Bacteria 1585
68 Ga0075429_100411349 3300006880 Bacteria 1185
69 Ga0075429_101447776 3300006880 Unclassified 598
70 Ga0097620_100079535 3300006931 Bacteria 3318
71 Ga0105240_10124458 3300009093 Unclassified 3101
72 Ga0111539_10103477 3300009094 Bacteria 3342
73 Ga0105245_10583232 3300009098 Bacteria 1143
74 Ga0105245_10630299 3300009098 Bacteria 1101
75 Ga0114129_10002999 3300009147 Bacteria 23644
76 Ga0114129_10082689 3300009147 Unclassified 4461
77 Ga0114129_10643961 3300009147 Unclassified 1369
78 Ga0114129_10699419 3300009147 Bacteria 1303
79 Ga0114129_10758949 3300009147 Bacteria 1241
80 Ga0114129_11272786 3300009147 Bacteria 913
81 Ga0105243_10179724 3300009148 Bacteria 1839
82 Ga0105243_10189075 3300009148 Bacteria 1797
83 Ga0105243_10664787 3300009148 Unclassified 1011
84 Ga0105238_11865607 3300009551 Unclassified 634
85 Ga0105249_11050940 3300009553 Unclassified 884
86 Ga0105246_10088487 3300011119 Bacteria 2225
87 Ga0157370_10204514 3300013104 Bacteria 1831
88 Ga0157369_10048190 3300013105 Bacteria 4623
89 Ga0163162_11109720 3300013306 Bacteria 896
90 Ga0182005_1107295 3300015265 Bacteria 787
91 Ga0207643_10311408 3300025908 Bacteria 981
92 Ga0207643_10344983 3300025908 Unclassified 934
93 Ga0207684_10099284 3300025910 Unclassified 2486
94 Ga0207707_10360522 3300025912 Bacteria 1252
95 Ga0207695_10646182 3300025913 Unclassified 939
96 Ga0207663_10951570 3300025916 Bacteria 688
97 Ga0207660_10401375 3300025917 Unclassified 1104
98 Ga0207646_10058538 3300025922 Bacteria 3441
99 Ga0207646_11606477 3300025922 Unclassified 561
100 Ga0207694_11166561 3300025924 Unclassified 652
101 Ga0207687_10577629 3300025927 Bacteria 945
102 Ga0207709_10111321 3300025935 Bacteria 1831
103 Ga0207709_11284302 3300025935 Unclassified 605
104 Ga0207670_10299027 3300025936 Unclassified 1260
105 Ga0207689_10928604 3300025942 Unclassified 734
106 Ga0207661_10340574 3300025944 Bacteria 1351
107 Ga0207667_10127744 3300025949 Bacteria 2619
108 Ga0207712_10606786 3300025961 Unclassified 947
109 Ga0207640_10264557 3300025981 Bacteria 1342
110 Ga0207708_10008031 3300026075 Bacteria 7823
111 Ga0207676_10255404 3300026095 Bacteria 1580
112 Ga0207674_11639470 3300026116 Bacteria 612
113 Ga0207675_100076368 3300026118 Bacteria 3137
114 Ga0209971_1052595 3300027682 Bacteria 984
115 Ga0268265_10120687 3300028380 Bacteria 2159
116 Ga0265318_10096398 3300028577 Bacteria 1089
117 Ga0265338_10277632 3300028800 Bacteria 1225
118 Ga0265342_10492793 3300031712 Unclassified 626
119 Ga0307405_10258663 3300031731 Bacteria 1299
120 Ga0307413_10602725 3300031824 Unclassified 899
121 Ga0307410_10108165 3300031852 Bacteria 2007
122 Ga0307410_12033448 3300031852 Bacteria 513
123 Ga0307406_10046671 3300031901 Unclassified 2727
124 Ga0307407_10079854 3300031903 Bacteria 1975
125 Ga0307416_100904341 3300032002 Bacteria 983
126 Ga0307411_11356361 3300032005 Unclassified 649
127 Ga0373949_0013235 3300035090 Bacteria 1828
128 Ga0395900_0177227 3300037418 Bacteria 2168
129 Ga0395898_0631674 3300037466 Unclassified 1013
130 Ga0395905_0120052 3300037471 Bacteria 2471
131 Ga0395901_0126362 3300038443 Bacteria 2687
132 Ga0436360_0406904 3300039438 Bacteria 554
133 Ga0451577_0978170 3300042876 Unclassified 760
134 Ga0453683_0070952 3300044673 Bacteria 2179
135 Ga0453683_0104120 3300044673 Bacteria 1782
136 Ga0453683_0742496 3300044673 Bacteria 644
137 Ga0453684_0000802 3300044712 Bacteria 107142
138 Ga0453684_0002536 3300044712 Bacteria 43999
139 Ga0453684_0014553 3300044712 Bacteria 12562
140 Ga0453684_0136479 3300044712 Bacteria 2936
141 Ga0453684_0138165 3300044712 Bacteria 2914
142 Ga0453684_0205537 3300044712 Bacteria 2292
143 Ga0453684_0241436 3300044712 Bacteria 2079
144 Ga0453684_0280065 3300044712 Bacteria 1902
145 Ga0453684_0354226 3300044712 Unclassified 1654
146 Ga0453684_0422011 3300044712 Bacteria 1490
147 Ga0453684_0933042 3300044712 Unclassified 927
148 Ga0453684_1380501 3300044712 Unclassified 731
149 Ga0453684_1602015 3300044712 Bacteria 668
150 Ga0451576_0020615 3300045051 Bacteria 7175
151 Ga0451576_0068697 3300045051 Unclassified 3687
152 Ga0451576_0098322 3300045051 Bacteria 3044
153 Ga0451576_0104570 3300045051 Bacteria 2945
154 Ga0451576_0468474 3300045051 Bacteria 1323
155 Ga0451576_1129815 3300045051 Bacteria 819
156 Ga0466967_0114950 3300045976 Bacteria 2477
157 Ga0495630_0087064 3300046517 Bacteria 2359
158 Ga0495630_0219141 3300046517 Bacteria 1453
159 Ga0495665_0073530 3300046531 Bacteria 1800
160 Ga0495586_0343103 3300046535 Bacteria 857
161 Ga0495667_0412866 3300046559 Bacteria 850
162 Ga0495634_0127516 3300046642 Bacteria 1625
163 Ga0495613_0204067 3300046689 Bacteria 1393
164 Ga0495613_0235855 3300046689 Bacteria 1280
165 Ga0495674_0516602 3300047319 Bacteria 954
166 Ga0495684_0211624 3300047471 Bacteria 1425
167 Ga0496106_1334213 3300048909 Unclassified 556
168 Ga0496112_1361922 3300048915 Bacteria 625
169 Ga0496114_0275403 3300048917 Bacteria 1483
170 Ga0496114_0377930 3300048917 Bacteria 1254
171 Ga0496115_0441819 3300048918 Bacteria 1052
172 Ga0501034_1178134 3300049571 Unclassified 645
173 Ga0501036_0224765 3300049572 Bacteria 1576
174 Ga0501039_0111779 3300049575 Bacteria 2136
175 Ga0501040_0034522 3300049576 Bacteria 3426
176 Ga0501040_0117008 3300049576 Bacteria 1868
177 Ga0501040_0491991 3300049576 Bacteria 884
178 Ga0501041_0151375 3300049577 Bacteria 1449
179 Ga0501042_0121465 3300049578 Bacteria 1881
180 Ga0501043_0365347 3300049579 Bacteria 1095
181 Ga0501046_0834510 3300049580 Unclassified 645
182 Ga0501047_0042381 3300049581 Bacteria 4399
183 Ga0501048_0571085 3300049582 Bacteria 812
184 Ga0501068_0177126 3300049584 Bacteria 1348
185 Ga0501070_0908706 3300049586 Bacteria 686
186 Ga0501072_0146764 3300049588 Bacteria 1881
187 Ga0501074_0297657 3300049590 Bacteria 1146
188 Ga0501074_0873098 3300049590 Bacteria 633
189 Ga0501075_0247846 3300049591 Bacteria 1358
190 Ga0501075_0254174 3300049591 Bacteria 1339
191 Ga0501075_0520098 3300049591 Bacteria 908
192 Ga0501076_0138736 3300049592 Bacteria 1975
193 Ga0501076_0217173 3300049592 Bacteria 1563
194 Ga0501076_0238264 3300049592 Bacteria 1488
195 Ga0501076_0390712 3300049592 Bacteria 1144
196 Ga0501077_0007108 3300049593 Bacteria 6901
197 Ga0501077_0744042 3300049593 Bacteria 630
198 Ga0501079_0100113 3300049741 Bacteria 2247
199 Ga0501079_0219091 3300049741 Unclassified 1487
200 Ga0501080_0042309 3300049742 Bacteria 4242
201 Ga0501080_0205964 3300049742 Bacteria 1804
202 Ga0501081_0104229 3300049743 Bacteria 2008
203 Ga0501081_0225900 3300049743 Bacteria 1362
204 Ga0501081_0342930 3300049743 Bacteria 1100
205 Ga0501083_0229971 3300049744 Bacteria 1208
206 Ga0501045_0393211 3300049824 Bacteria 1032
207 Ga0501045_0457293 3300049824 Unclassified 949
208 Ga0501045_0503162 3300049824 Bacteria 900
209 nmdc:mga05p37_105904_c1 3300050507 Unclassified 3459
210 nmdc:mga05p37_146930_c1 3300050507 Bacteria 2885
211 nmdc:mga05p37_703902_c1 3300050507 Bacteria 1122
212 nmdc:mga05p37_817181_c1 3300050507 Unclassified 1017
213 nmdc:mga05p37_90863_c1 3300050507 Unclassified 3763
214 nmdc:mga09592_166385_c1 3300050508 Bacteria 1906
215 nmdc:mga09592_322269_c1 3300050508 Bacteria 1339
216 nmdc:mga09592_74852_c1 3300050508 Bacteria 2878
217 nmdc:mga06r32_1019163_c1 3300050510 Bacteria 780
218 nmdc:mga06r32_1103216_c1 3300050510 Bacteria 742
219 nmdc:mga06r32_1783242_c1 3300050510 Unclassified 551
220 nmdc:mga06r32_357870_c1 3300050510 Bacteria 1444
221 nmdc:mga06r32_386824_c1 3300050510 Bacteria 1381
222 nmdc:mga0n895_100850_c1 3300050512 Bacteria 2896
223 nmdc:mga0n895_910592_c1 3300050512 Bacteria 864
224 nmdc:mga0a205_23113_c1 3300050515 Bacteria 5896
225 nmdc:mga0a205_653281_c1 3300050515 Bacteria 903
226 Ga0501084_0998923 3300054114 Bacteria 703
227 Ga0501082_0231059 3300060353 Bacteria 1609
228 Ga0530510_0048645 3300061734 Bacteria 3065
229 Ga0530510_0162980 3300061734 Bacteria 1650
230 Ga0070694_100167152
231 SwRhRL3b_contig_951261
232 SwRhRL2b_contig_1565409
233 SwRhRL2b_contig_294902
234 Ga0065704_10000384
235 Ga0065704_10096336
236 Ga0065704_10370834
237 Ga0065704_10389106
238 Ga0065715_10123128
239 Ga0065707_10000885
240 Ga0065707_10086361
241 Ga0065707_10128341
242 Ga0065707_10335597
243 Ga0068869_100180414
244 Ga0070680_100677108
245 Ga0070660_101741830
246 Ga0070689_100126886
247 Ga0070692_10990034
248 Ga0070669_101120348
249 Ga0070705_100115895
250 Ga0070705_100389711
251 Ga0070705_100500437
252 Ga0070705_101891044
253 Ga0070700_100003069
254 Ga0070694_101336208
255 Ga0070681_10113567
256 Ga0070681_10387351
257 Ga0070706_100086782
258 Ga0070706_100466310
259 Ga0070707_100102196
260 Ga0070707_101533842
261 Ga0070698_100001617
262 Ga0070698_100183326
263 Ga0070698_100847051
264 Ga0070698_100909837
265 Ga0070699_100115207
266 Ga0070699_100126281
267 Ga0070684_101463928
268 Ga0070696_100812959
269 Ga0070704_100647456
270 Ga0070704_101291992
271 Ga0068855_100039634
272 Ga0068857_100200872
273 Ga0068857_100211670
274 Ga0068854_100106538
275 Ga0068859_100079535
276 Ga0068864_100090232
277 Ga0068870_10145826
278 Ga0068870_11026979
279 Ga0068858_100237961
280 Ga0068862_100011507
281 Ga0068862_100050589
282 Ga0081539_10006781
283 Ga0081539_10048216
284 Ga0075428_100212831
285 Ga0075428_100765352
286 Ga0075430_100094817
287 Ga0075430_100937038
288 Ga0075431_100025419
289 Ga0075431_100601321
290 Ga0075431_101171869
291 Ga0075433_10027755
292 Ga0075433_10448021
293 Ga0075434_100207653
294 Ga0075434_100372878
295 Ga0075429_100004587
296 Ga0075429_100240612
297 Ga0075429_100411349
298 Ga0075429_101447776
299 Ga0097620_100079535
300 Ga0105240_10124458
301 Ga0111539_10103477
302 Ga0105245_10583232
303 Ga0105245_10630299
304 Ga0114129_10002999
305 Ga0114129_10082689
306 Ga0114129_10643961
307 Ga0114129_10699419
308 Ga0114129_10758949
309 Ga0114129_11272786
310 Ga0105243_10179724
311 Ga0105243_10189075
312 Ga0105243_10664787
313 Ga0105238_11865607
314 Ga0105249_11050940
315 Ga0105246_10088487
316 Ga0157370_10204514
317 Ga0157369_10048190
318 Ga0163162_11109720
319 Ga0182005_1107295
320 Ga0207643_10311408
321 Ga0207643_10344983
322 Ga0207684_10099284
323 Ga0207707_10360522
324 Ga0207695_10646182
325 Ga0207663_10951570
326 Ga0207660_10401375
327 Ga0207646_10058538
328 Ga0207646_11606477
329 Ga0207694_11166561
330 Ga0207687_10577629
331 Ga0207709_10111321
332 Ga0207709_11284302
333 Ga0207670_10299027
334 Ga0207689_10928604
335 Ga0207661_10340574
336 Ga0207667_10127744
337 Ga0207712_10606786
338 Ga0207640_10264557
339 Ga0207708_10008031
340 Ga0207676_10255404
341 Ga0207674_11639470
342 Ga0207675_100076368
343 Ga0209971_1052595
344 Ga0268265_10120687
345 Ga0265318_10096398
346 Ga0265338_10277632
347 Ga0265342_10492793
348 Ga0307405_10258663
349 Ga0307413_10602725
350 Ga0307410_10108165
351 Ga0307410_12033448
352 Ga0307406_10046671
353 Ga0307407_10079854
354 Ga0307416_100904341
355 Ga0307411_11356361
356 Ga0373949_0013235
357 Ga0395900_0177227
358 Ga0395898_0631674
359 Ga0395905_0120052
360 Ga0395901_0126362
361 Ga0436360_0406904
362 Ga0451577_0978170
363 Ga0453683_0070952
364 Ga0453683_0104120
365 Ga0453683_0742496
366 Ga0453684_0000802
367 Ga0453684_0002536
368 Ga0453684_0014553
369 Ga0453684_0136479
370 Ga0453684_0138165
371 Ga0453684_0205537
372 Ga0453684_0241436
373 Ga0453684_0280065
374 Ga0453684_0354226
375 Ga0453684_0422011
376 Ga0453684_0933042
377 Ga0453684_1380501
378 Ga0453684_1602015
379 Ga0451576_0020615
380 Ga0451576_0068697
381 Ga0451576_0098322
382 Ga0451576_0104570
383 Ga0451576_0468474
384 Ga0451576_1129815
385 Ga0466967_0114950
386 Ga0495630_0087064
387 Ga0495630_0219141
388 Ga0495665_0073530
389 Ga0495586_0343103
390 Ga0495667_0412866
391 Ga0495634_0127516
392 Ga0495613_0204067
393 Ga0495613_0235855
394 Ga0495674_0516602
395 Ga0495684_0211624
396 Ga0496106_1334213
397 Ga0496112_1361922
398 Ga0496114_0275403
399 Ga0496114_0377930
400 Ga0496115_0441819
401 Ga0501034_1178134
402 Ga0501036_0224765
403 Ga0501039_0111779
404 Ga0501040_0034522
405 Ga0501040_0117008
406 Ga0501040_0491991
407 Ga0501041_0151375
408 Ga0501042_0121465
409 Ga0501043_0365347
410 Ga0501046_0834510
411 Ga0501047_0042381
412 Ga0501048_0571085
413 Ga0501068_0177126
414 Ga0501070_0908706
415 Ga0501072_0146764
416 Ga0501074_0297657
417 Ga0501074_0873098
418 Ga0501075_0247846
419 Ga0501075_0254174
420 Ga0501075_0520098
421 Ga0501076_0138736
422 Ga0501076_0217173
423 Ga0501076_0238264
424 Ga0501076_0390712
425 Ga0501077_0007108
426 Ga0501077_0744042
427 Ga0501079_0100113
428 Ga0501079_0219091
429 Ga0501080_0042309
430 Ga0501080_0205964
431 Ga0501081_0104229
432 Ga0501081_0225900
433 Ga0501081_0342930
434 Ga0501083_0229971
435 Ga0501045_0393211
436 Ga0501045_0457293
437 Ga0501045_0503162
438 nmdc:mga05p37_105904_c1
439 nmdc:mga05p37_146930_c1
440 nmdc:mga05p37_703902_c1
441 nmdc:mga05p37_817181_c1
442 nmdc:mga05p37_90863_c1
443 nmdc:mga09592_166385_c1
444 nmdc:mga09592_322269_c1
445 nmdc:mga09592_74852_c1
446 nmdc:mga06r32_1019163_c1
447 nmdc:mga06r32_1103216_c1
448 nmdc:mga06r32_1783242_c1
449 nmdc:mga06r32_357870_c1
450 nmdc:mga06r32_386824_c1
451 nmdc:mga0n895_100850_c1
452 nmdc:mga0n895_910592_c1
453 nmdc:mga0a205_23113_c1
454 nmdc:mga0a205_653281_c1
455 Ga0501084_0998923
456 Ga0501082_0231059
457 Ga0530510_0048645
458 Ga0530510_0162980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

20

162

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9756 2 150
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9743 2 149
3s5p-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase b rpib from giardia lamblia 0.9665 1 128
5ifz-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m 0.9622 1 128
6fxs-assembly1.cif.gz_A structure of trypanosoma brucei type b ribose 5-phosphate isomerase 0.9543 2 148
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9751 2 150 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9665 1 128 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9622 1 128 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9543 1 128 3.40.1400.10
6fxsA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9539 2 148 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A350WSB8-F1-model_v4 Ribose-5-phosphate isomerase 0.9933 20 151 GO:0005975
GO:0016861
AF-A0A2M8CQP7-F1-model_v4 Ribose 5-phosphate isomerase B 0.9908 1 152 GO:0005975
GO:0016861
AF-A0A1V5Q544-F1-model_v4 deleted 0.9883 2 155
AF-A0A2M8CQP7-F1-model_v4 Ribose 5-phosphate isomerase B 0.9843 1 152 GO:0005975
GO:0016861
AF-A0A8B5WR16-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9832 1 151 GO:0005975
GO:0016861

Map